Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|3578
Gene name
LocationContig_229:20083..23111
Strand+
Gene length (bp)3028
Transcript length (bp)2670
Coding sequence length (bp)2670
Protein length (aa) 890

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01068 DNA_ligase_A_M ATP dependent DNA ligase domain 9.3E-10 489 525
PF01068 DNA_ligase_A_M ATP dependent DNA ligase domain 2.0E-47 546 713
PF04675 DNA_ligase_A_N DNA ligase N terminus 9.6E-43 232 423
PF04679 DNA_ligase_A_C ATP dependent DNA ligase C terminal region 4.0E-27 738 854
PF09414 RNA_ligase RNA ligase 5.0E-08 509 713

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P12000|DNLI1_SCHPO DNA ligase 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cdc17 PE=3 SV=1 233 885 0.0E+00
sp|P04819|DNLI1_YEAST DNA ligase 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CDC9 PE=1 SV=2 229 875 0.0E+00
sp|P51892|DNLI1_XENLA DNA ligase 1 OS=Xenopus laevis GN=lig1 PE=2 SV=1 225 875 0.0E+00
sp|Q9W1H4|DNLI1_DROME DNA ligase 1 OS=Drosophila melanogaster GN=DNA-ligI PE=1 SV=2 121 879 0.0E+00
sp|P18858|DNLI1_HUMAN DNA ligase 1 OS=Homo sapiens GN=LIG1 PE=1 SV=1 225 880 0.0E+00
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P12000|DNLI1_SCHPO DNA ligase 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cdc17 PE=3 SV=1 233 885 0.0E+00
sp|P04819|DNLI1_YEAST DNA ligase 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CDC9 PE=1 SV=2 229 875 0.0E+00
sp|P51892|DNLI1_XENLA DNA ligase 1 OS=Xenopus laevis GN=lig1 PE=2 SV=1 225 875 0.0E+00
sp|Q9W1H4|DNLI1_DROME DNA ligase 1 OS=Drosophila melanogaster GN=DNA-ligI PE=1 SV=2 121 879 0.0E+00
sp|P18858|DNLI1_HUMAN DNA ligase 1 OS=Homo sapiens GN=LIG1 PE=1 SV=1 225 880 0.0E+00
sp|P37913|DNLI1_MOUSE DNA ligase 1 OS=Mus musculus GN=Lig1 PE=1 SV=2 225 888 0.0E+00
sp|Q42572|DNLI1_ARATH DNA ligase 1 OS=Arabidopsis thaliana GN=LIG1 PE=2 SV=2 165 886 0.0E+00
sp|Q9JHY8|DNLI1_RAT DNA ligase 1 OS=Rattus norvegicus GN=Lig1 PE=1 SV=1 225 888 0.0E+00
sp|Q869E1|DNLI1_DICDI DNA ligase 1 OS=Dictyostelium discoideum GN=lig1 PE=3 SV=1 204 873 0.0E+00
sp|Q27474|DNLI1_CAEEL DNA ligase 1 OS=Caenorhabditis elegans GN=lig-1 PE=3 SV=2 224 879 3.0E-180
sp|Q9C1W9|DNLI3_SCHPO DNA ligase 3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=adl1 PE=3 SV=1 230 872 1.0E-124
sp|A1RTK4|DNLI_PYRIL DNA ligase OS=Pyrobaculum islandicum (strain DSM 4184 / JCM 9189 / GEO3) GN=lig PE=3 SV=1 233 877 3.0E-100
sp|A3MS62|DNLI_PYRCJ DNA ligase OS=Pyrobaculum calidifontis (strain JCM 11548 / VA1) GN=lig PE=3 SV=1 233 875 2.0E-99
sp|Q6L195|DNLI_PICTO DNA ligase OS=Picrophilus torridus (strain ATCC 700027 / DSM 9790 / JCM 10055 / NBRC 100828) GN=lig PE=3 SV=2 233 875 1.0E-98
sp|B1YA52|DNLI_PYRNV DNA ligase OS=Pyrobaculum neutrophilum (strain DSM 2338 / JCM 9278 / V24Sta) GN=lig PE=3 SV=1 233 877 3.0E-98
sp|A8MDU6|DNLI_CALMQ DNA ligase OS=Caldivirga maquilingensis (strain ATCC 700844 / DSM 13496 / JCM 10307 / IC-167) GN=lig PE=3 SV=1 229 875 3.0E-97
sp|A9A3K1|DNLI_NITMS DNA ligase OS=Nitrosopumilus maritimus (strain SCM1) GN=lig PE=3 SV=1 233 879 7.0E-97
sp|A4WH24|DNLI_PYRAR DNA ligase OS=Pyrobaculum arsenaticum (strain DSM 13514 / JCM 11321) GN=lig PE=3 SV=1 233 877 2.0E-94
sp|O93723|DNLI_PYRAE DNA ligase OS=Pyrobaculum aerophilum (strain ATCC 51768 / IM2 / DSM 7523 / JCM 9630 / NBRC 100827) GN=lig PE=3 SV=2 233 877 2.0E-92
sp|A1RY72|DNLI2_THEPD DNA ligase 2 OS=Thermofilum pendens (strain Hrk 5) GN=lig2 PE=3 SV=1 227 873 1.0E-91
sp|Q02093|DNLI_ACIAM DNA ligase OS=Acidianus ambivalens GN=lig PE=3 SV=1 233 872 3.0E-91
sp|Q980T8|DNLI_SULSO DNA ligase OS=Sulfolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) GN=lig PE=1 SV=1 233 885 1.0E-90
sp|A3DP49|DNLI_STAMF DNA ligase OS=Staphylothermus marinus (strain ATCC 43588 / DSM 3639 / JCM 9404 / F1) GN=lig PE=1 SV=2 231 872 2.0E-89
sp|Q4JAM1|DNLI_SULAC DNA ligase OS=Sulfolobus acidocaldarius (strain ATCC 33909 / DSM 639 / JCM 8929 / NBRC 15157 / NCIMB 11770) GN=lig PE=3 SV=1 233 872 3.0E-88
sp|A4YD25|DNLI_METS5 DNA ligase OS=Metallosphaera sedula (strain ATCC 51363 / DSM 5348) GN=lig PE=3 SV=1 233 872 5.0E-88
sp|Q9P9K9|DNLI_SULSH DNA ligase OS=Sulfolobus shibatae GN=lig PE=1 SV=1 233 885 8.0E-88
sp|A0RWD6|DNLI_CENSY DNA ligase OS=Cenarchaeum symbiosum (strain A) GN=lig PE=3 SV=2 233 883 2.0E-87
sp|Q9YD18|DNLI_AERPE DNA ligase OS=Aeropyrum pernix (strain ATCC 700893 / DSM 11879 / JCM 9820 / NBRC 100138 / K1) GN=lig PE=1 SV=2 231 872 8.0E-87
sp|C3NF77|DNLI_SULIN DNA ligase OS=Sulfolobus islandicus (strain Y.N.15.51 / Yellowstone #2) GN=lig PE=3 SV=1 233 872 1.0E-86
sp|Q9HJ26|DNLI_THEAC DNA ligase OS=Thermoplasma acidophilum (strain ATCC 25905 / DSM 1728 / JCM 9062 / NBRC 15155 / AMRC-C165) GN=lig PE=3 SV=1 233 879 1.0E-86
sp|D2CJS7|DNLI_SULZI DNA ligase OS=Sulfophobococcus zilligii GN=lig PE=1 SV=1 231 872 1.0E-86
sp|C3N834|DNLI_SULIY DNA ligase OS=Sulfolobus islandicus (strain Y.G.57.14 / Yellowstone #1) GN=lig PE=3 SV=1 233 872 1.0E-86
sp|Q976G4|DNLI_SULTO DNA ligase OS=Sulfolobus tokodaii (strain DSM 16993 / JCM 10545 / NBRC 100140 / 7) GN=lig PE=3 SV=1 233 870 2.0E-86
sp|C3MYD2|DNLI_SULIM DNA ligase OS=Sulfolobus islandicus (strain M.14.25 / Kamchatka #1) GN=lig PE=3 SV=1 233 872 2.0E-86
sp|C3MJ14|DNLI_SULIL DNA ligase OS=Sulfolobus islandicus (strain L.S.2.15 / Lassen #1) GN=lig PE=3 SV=1 233 872 2.0E-86
sp|C4KIZ2|DNLI_SULIK DNA ligase OS=Sulfolobus islandicus (strain M.16.4 / Kamchatka #3) GN=lig PE=3 SV=1 233 872 2.0E-86
sp|C3MZR1|DNLI_SULIA DNA ligase OS=Sulfolobus islandicus (strain M.16.27) GN=lig PE=3 SV=1 233 872 2.0E-86
sp|O67398|DNLI_AQUAE Probable DNA ligase OS=Aquifex aeolicus (strain VF5) GN=lig PE=3 SV=2 233 875 5.0E-84
sp|B1L3V2|DNLI2_KORCO DNA ligase 2 OS=Korarchaeum cryptofilum (strain OPF8) GN=lig2 PE=3 SV=1 233 872 2.0E-83
sp|Q979A1|DNLI_THEVO DNA ligase OS=Thermoplasma volcanium (strain ATCC 51530 / DSM 4299 / JCM 9571 / NBRC 15438 / GSS1) GN=lig PE=3 SV=1 233 873 6.0E-82
sp|A2BJX6|DNLI_HYPBU DNA ligase OS=Hyperthermus butylicus (strain DSM 5456 / JCM 9403 / PLM1-5) GN=lig PE=1 SV=1 230 872 2.0E-81
sp|C0QSL7|DNLI_PERMH Probable DNA ligase OS=Persephonella marina (strain DSM 14350 / EX-H1) GN=lig PE=3 SV=1 233 872 8.0E-80
sp|A8AB20|DNLI_IGNH4 DNA ligase OS=Ignicoccus hospitalis (strain KIN4/I / DSM 18386 / JCM 14125) GN=lig PE=3 SV=1 233 872 4.0E-79
sp|Q8TSR7|DNLI1_METAC DNA ligase 1 OS=Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A) GN=lig1 PE=3 SV=1 266 868 3.0E-78
sp|Q8PVR7|DNLI1_METMA DNA ligase 1 OS=Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88) GN=lig1 PE=3 SV=1 246 868 2.0E-76
sp|Q46C04|DNLI1_METBF DNA ligase 1 OS=Methanosarcina barkeri (strain Fusaro / DSM 804) GN=lig1 PE=3 SV=1 277 854 2.0E-70
sp|P0CL75|DNLI_PYRAB DNA ligase OS=Pyrococcus abyssi (strain GE5 / Orsay) GN=lig PE=3 SV=1 233 880 3.0E-68
sp|P0CL74|DNLI_PYRAY DNA ligase OS=Pyrococcus abyssi GN=lig PE=3 SV=1 233 880 9.0E-68
sp|P56709|DNLI_PYRFU DNA ligase OS=Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1) GN=lig PE=1 SV=1 233 875 9.0E-66
sp|O59288|DNLI_PYRHO DNA ligase OS=Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3) GN=lig PE=3 SV=1 233 875 1.0E-65
sp|B8DZX8|DNLI_DICTD Probable DNA ligase OS=Dictyoglomus turgidum (strain Z-1310 / DSM 6724) GN=lig PE=3 SV=1 233 872 3.0E-65
sp|B5YD88|DNLI_DICT6 Probable DNA ligase OS=Dictyoglomus thermophilum (strain ATCC 35947 / DSM 3960 / H-6-12) GN=lig PE=3 SV=1 233 872 3.0E-65
sp|B6YTR4|DNLI_THEON DNA ligase OS=Thermococcus onnurineus (strain NA1) GN=lig PE=1 SV=1 233 879 7.0E-65
sp|Q9HH07|DNLI_THEFM DNA ligase OS=Thermococcus fumicolans GN=lig PE=1 SV=1 233 873 1.0E-64
sp|Q9HHC4|DNLI_THEKO DNA ligase OS=Thermococcus kodakarensis (strain ATCC BAA-918 / JCM 12380 / KOD1) GN=lig PE=1 SV=2 233 873 1.0E-63
sp|Q50566|DNLI_METTH DNA ligase OS=Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H) GN=lig PE=3 SV=1 233 870 9.0E-62
sp|P54875|DNLI_METTF DNA ligase OS=Methanothermobacter thermautotrophicus GN=lig PE=3 SV=1 233 871 1.0E-61
sp|Q8TWN3|DNLI_METKA DNA ligase OS=Methanopyrus kandleri (strain AV19 / DSM 6324 / JCM 9639 / NBRC 100938) GN=lig PE=3 SV=1 233 869 1.0E-60
sp|O29632|DNLI_ARCFU DNA ligase OS=Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126) GN=lig PE=1 SV=2 233 878 5.0E-59
sp|A7IAA9|DNLI_METB6 DNA ligase OS=Methanoregula boonei (strain 6A8) GN=lig PE=3 SV=1 233 872 9.0E-58
sp|A5UKX2|DNLI_METS3 DNA ligase OS=Methanobrevibacter smithii (strain PS / ATCC 35061 / DSM 861) GN=lig PE=3 SV=1 233 872 5.0E-56
sp|Q74M64|DNLI_NANEQ DNA ligase OS=Nanoarchaeum equitans (strain Kin4-M) GN=lig PE=3 SV=1 233 872 4.0E-54
sp|Q8TMT1|DNLI2_METAC DNA ligase 2 OS=Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A) GN=lig2 PE=3 SV=1 277 872 4.0E-54
sp|Q8PTK1|DNLI2_METMA DNA ligase 2 OS=Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88) GN=lig2 PE=3 SV=1 277 872 5.0E-54
sp|Q0W0X1|DNLI_METAR DNA ligase OS=Methanocella arvoryzae (strain DSM 22066 / NBRC 105507 / MRE50) GN=lig PE=3 SV=1 233 878 7.0E-54
sp|Q2NHF9|DNLI_METST DNA ligase OS=Methanosphaera stadtmanae (strain ATCC 43021 / DSM 3091 / JCM 11832 / MCB-3) GN=lig PE=3 SV=1 233 868 1.0E-53
sp|A0B7F9|DNLI_METTP DNA ligase OS=Methanosaeta thermophila (strain DSM 6194 / JCM 14653 / NBRC 101360 / PT) GN=lig PE=3 SV=1 233 872 2.0E-53
sp|Q2FTH4|DNLI_METHJ DNA ligase OS=Methanospirillum hungatei JF-1 (strain ATCC 27890 / DSM 864 / NBRC 100397 / JF-1) GN=lig PE=3 SV=1 233 874 2.0E-53
sp|Q46BA3|DNLI2_METBF DNA ligase 2 OS=Methanosarcina barkeri (strain Fusaro / DSM 804) GN=lig2 PE=3 SV=1 277 872 3.0E-52
sp|Q3IPX0|DNLI_NATPD DNA ligase OS=Natronomonas pharaonis (strain ATCC 35678 / DSM 2160) GN=lig PE=3 SV=1 269 859 5.0E-50
sp|A3CWP1|DNLI_METMJ DNA ligase OS=Methanoculleus marisnigri (strain ATCC 35101 / DSM 1498 / JR1) GN=lig PE=3 SV=1 233 874 9.0E-50
sp|A2SR38|DNLI_METLZ DNA ligase OS=Methanocorpusculum labreanum (strain ATCC 43576 / DSM 4855 / Z) GN=lig PE=3 SV=1 231 872 2.0E-49
sp|B8GGB8|DNLI_METPE DNA ligase OS=Methanosphaerula palustris (strain ATCC BAA-1556 / DSM 19958 / E1-9c) GN=lig PE=3 SV=1 233 874 2.0E-48
sp|A6UVC4|DNLI_META3 DNA ligase OS=Methanococcus aeolicus (strain Nankai-3 / ATCC BAA-1280) GN=lig PE=3 SV=1 230 872 2.0E-47
sp|O57250|DNLI_VACCA DNA ligase OS=Vaccinia virus (strain Ankara) GN=LIG PE=3 SV=1 467 868 1.0E-46
sp|P16272|DNLI_VACCW DNA ligase OS=Vaccinia virus (strain Western Reserve) GN=LIG PE=1 SV=1 467 868 1.0E-46
sp|P20492|DNLI_VACCC DNA ligase OS=Vaccinia virus (strain Copenhagen) GN=LIG PE=1 SV=1 477 868 2.0E-46
sp|B9LUZ9|DNLI_HALLT DNA ligase OS=Halorubrum lacusprofundi (strain ATCC 49239 / DSM 5036 / JCM 8891 / ACAM 34) GN=lig PE=3 SV=1 269 868 3.0E-46
sp|P33798|DNLI_VAR67 DNA ligase OS=Variola virus (isolate Human/India/Ind3/1967) GN=LIG PE=3 SV=1 486 868 7.0E-46
sp|A6UNY0|DNLI_METVS DNA ligase OS=Methanococcus vannielii (strain SB / ATCC 35089 / DSM 1224) GN=lig PE=3 SV=1 233 869 1.0E-45
sp|Q6LYM1|DNLI_METMP DNA ligase OS=Methanococcus maripaludis (strain S2 / LL) GN=lig PE=3 SV=1 233 869 3.0E-45
sp|Q57635|DNLI_METJA DNA ligase OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=lig PE=3 SV=1 236 872 5.0E-45
sp|A4FY19|DNLI_METM5 DNA ligase OS=Methanococcus maripaludis (strain C5 / ATCC BAA-1333) GN=lig PE=3 SV=1 233 869 1.0E-44
sp|Q12X08|DNLI_METBU DNA ligase OS=Methanococcoides burtonii (strain DSM 6242 / NBRC 107633 / OCM 468 / ACE-M) GN=lig PE=3 SV=1 233 872 9.0E-44
sp|P97386|DNLI3_MOUSE DNA ligase 3 OS=Mus musculus GN=Lig3 PE=1 SV=2 486 870 1.0E-43
sp|Q5V4R0|DNLI_HALMA DNA ligase OS=Haloarcula marismortui (strain ATCC 43049 / DSM 3752 / JCM 8966 / VKM B-1809) GN=lig PE=3 SV=1 233 872 1.0E-43
sp|A9AAX4|DNLI_METM6 DNA ligase OS=Methanococcus maripaludis (strain C6 / ATCC BAA-1332) GN=lig PE=3 SV=1 233 869 2.0E-43
sp|P49916|DNLI3_HUMAN DNA ligase 3 OS=Homo sapiens GN=LIG3 PE=1 SV=2 486 870 2.0E-42
sp|Q67480|DNLI_FOWPN DNA ligase OS=Fowlpox virus (strain NVSL) GN=LIG PE=3 SV=2 395 869 2.0E-42
sp|A6VFQ9|DNLI_METM7 DNA ligase OS=Methanococcus maripaludis (strain C7 / ATCC BAA-1331) GN=lig PE=3 SV=1 233 869 3.0E-41
sp|D4GYZ4|DNLI_HALVD DNA ligase OS=Haloferax volcanii (strain ATCC 29605 / DSM 3757 / JCM 8879 / NBRC 14742 / NCIMB 2012 / VKM B-1768 / DS2) GN=lig PE=3 SV=1 258 872 6.0E-40
sp|Q9HR35|DNLI_HALSA DNA ligase OS=Halobacterium salinarum (strain ATCC 700922 / JCM 11081 / NRC-1) GN=lig PE=3 SV=1 397 873 1.0E-39
sp|B0R4C9|DNLI_HALS3 DNA ligase OS=Halobacterium salinarum (strain ATCC 29341 / DSM 671 / R1) GN=lig PE=3 SV=1 397 873 1.0E-39
sp|Q90YB1|DNLI4_CHICK DNA ligase 4 OS=Gallus gallus GN=LIG4 PE=2 SV=2 221 885 7.0E-39
sp|Q54QM4|DNLI3_DICDI DNA ligase 3 OS=Dictyostelium discoideum GN=lig3 PE=3 SV=1 486 880 1.0E-38
sp|B1L3K8|DNLI1_KORCO DNA ligase 1 OS=Korarchaeum cryptofilum (strain OPF8) GN=lig1 PE=3 SV=1 236 872 2.0E-38
sp|Q5R6L3|DNLI4_PONAB DNA ligase 4 OS=Pongo abelii GN=DNL4 PE=2 SV=1 227 859 3.0E-38
sp|Q1II25|DNLI_KORVE Probable DNA ligase OS=Koribacter versatilis (strain Ellin345) GN=lig PE=3 SV=1 236 872 4.0E-38
sp|P49917|DNLI4_HUMAN DNA ligase 4 OS=Homo sapiens GN=LIG4 PE=1 SV=2 227 859 4.0E-38
sp|Q18GX5|DNLI2_HALWD DNA ligase 2 OS=Haloquadratum walsbyi (strain DSM 16790 / HBSQ001) GN=lig2 PE=3 SV=1 243 854 5.0E-38
sp|Q8BTF7|DNLI4_MOUSE DNA ligase 4 OS=Mus musculus GN=Lig4 PE=2 SV=2 227 888 3.0E-37
sp|Q6C8A3|DNLI4_YARLI DNA ligase 4 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=LIG4 PE=3 SV=1 504 885 2.0E-35
sp|Q9YMV2|DNLI_NPVLD DNA ligase OS=Lymantria dispar multicapsid nuclear polyhedrosis virus GN=LIG PE=1 SV=1 486 877 3.0E-35
sp|Q54CR9|DNLI4_DICDI DNA ligase 4 OS=Dictyostelium discoideum GN=lig4 PE=3 SV=1 486 869 5.0E-33
sp|Q7Z7W5|DNLI4_COPCI DNA ligase 4 OS=Coprinopsis cinerea GN=LIG4 PE=2 SV=1 221 867 3.0E-31
sp|Q7SB49|DNLI4_NEUCR DNA ligase 4 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=mus-53 PE=3 SV=2 294 859 3.0E-31
sp|A8N936|DNLI4_COPC7 DNA ligase 4 OS=Coprinopsis cinerea (strain Okayama-7 / 130 / ATCC MYA-4618 / FGSC 9003) GN=LIG4 PE=3 SV=2 221 867 3.0E-31
sp|Q18HT7|DNLI1_HALWD DNA ligase 1 OS=Haloquadratum walsbyi (strain DSM 16790 / HBSQ001) GN=lig1 PE=3 SV=1 233 872 7.0E-31
sp|Q5BH83|DNLI4_EMENI DNA ligase 4 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=lig4 PE=3 SV=1 394 879 2.0E-30
sp|Q2U6A1|DNLI4_ASPOR DNA ligase 4 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=lig4 PE=3 SV=1 394 885 5.0E-30
sp|Q0UCI9|DNLI4_PHANO DNA ligase 4 OS=Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) GN=LIG4 PE=3 SV=1 397 868 1.0E-29
sp|Q5YNY7|DNLI_NOCFA Probable DNA ligase OS=Nocardia farcinica (strain IFM 10152) GN=lig PE=3 SV=1 480 859 2.0E-29
sp|A1RXA6|DNLI1_THEPD DNA ligase 1 OS=Thermofilum pendens (strain Hrk 5) GN=lig1 PE=3 SV=1 265 827 4.0E-29
sp|Q2IH69|DNLI_ANADE Probable DNA ligase OS=Anaeromyxobacter dehalogenans (strain 2CP-C) GN=lig PE=3 SV=1 321 869 3.0E-28
sp|Q1DKE7|DNLI4_COCIM DNA ligase 4 OS=Coccidioides immitis (strain RS) GN=LIG4 PE=3 SV=1 394 885 7.0E-28
sp|B8JBM1|DNLI_ANAD2 Probable DNA ligase OS=Anaeromyxobacter dehalogenans (strain 2CP-1 / ATCC BAA-258) GN=lig PE=3 SV=1 343 869 3.0E-27
sp|A4TDS2|DNLI_MYCGI Probable DNA ligase OS=Mycobacterium gilvum (strain PYR-GCK) GN=lig PE=3 SV=1 317 871 6.0E-27
sp|Q4WVG8|DNLI4_ASPFU DNA ligase 4 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=lig4 PE=3 SV=1 394 885 2.0E-26
sp|B2HHE1|DNLI_MYCMM Probable DNA ligase OS=Mycobacterium marinum (strain ATCC BAA-535 / M) GN=lig PE=3 SV=2 317 869 3.0E-26
sp|O74833|DNLI4_SCHPO DNA ligase 4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=lig4 PE=3 SV=3 487 859 7.0E-26
sp|Q9FCB1|DNLI_STRCO Probable DNA ligase OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=lig PE=3 SV=1 343 859 2.0E-24
sp|B4UIS1|DNLI_ANASK Probable DNA ligase OS=Anaeromyxobacter sp. (strain K) GN=lig PE=3 SV=1 480 869 2.0E-24
sp|A0PTC0|DNLI_MYCUA Probable DNA ligase OS=Mycobacterium ulcerans (strain Agy99) GN=lig PE=3 SV=1 317 869 9.0E-24
sp|C1AX87|DNLI_RHOOB Probable DNA ligase OS=Rhodococcus opacus (strain B4) GN=lig PE=3 SV=1 343 859 2.0E-23
sp|A0QUP1|DNLI_MYCS2 DNA ligase B OS=Mycobacterium smegmatis (strain ATCC 700084 / mc(2)155) GN=ligB PE=3 SV=1 296 871 3.0E-23
sp|B8HCE1|DNLI_ARTCA Probable DNA ligase OS=Arthrobacter chlorophenolicus (strain ATCC 700700 / DSM 12829 / JCM 12360 / NCIMB 13794 / A6) GN=lig PE=3 SV=1 324 859 3.0E-23
sp|Q9LL84|DNLI4_ARATH DNA ligase 4 OS=Arabidopsis thaliana GN=LIG4 PE=1 SV=1 392 877 3.0E-23
sp|P9WNV5|DNLI_MYCTU DNA ligase B OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=ligB PE=1 SV=1 477 869 1.0E-22
sp|A5U776|DNLI_MYCTA Probable DNA ligase OS=Mycobacterium tuberculosis (strain ATCC 25177 / H37Ra) GN=lig PE=3 SV=1 477 869 1.0E-22
sp|B1ZZL9|DNLI_OPITP Probable DNA ligase OS=Opitutus terrae (strain DSM 11246 / PB90-1) GN=lig PE=3 SV=1 266 858 1.0E-22
sp|P9WNV4|DNLI_MYCTO DNA ligase B OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=ligB PE=3 SV=1 477 869 2.0E-22
sp|C1AGI1|DNLI_MYCBT Probable DNA ligase OS=Mycobacterium bovis (strain BCG / Tokyo 172 / ATCC 35737 / TMC 1019) GN=lig PE=3 SV=1 477 869 2.0E-22
sp|A1KN60|DNLI_MYCBP Probable DNA ligase OS=Mycobacterium bovis (strain BCG / Pasteur 1173P2) GN=lig PE=3 SV=1 477 869 2.0E-22
sp|Q7TTR7|DNLI_MYCBO Probable DNA ligase OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=lig PE=3 SV=1 477 869 2.0E-22
sp|A1T6P2|DNLI_MYCVP Probable DNA ligase OS=Mycobacterium vanbaalenii (strain DSM 7251 / PYR-1) GN=lig PE=3 SV=1 397 859 3.0E-22
sp|Q1BB26|DNLI_MYCSS Probable DNA ligase OS=Mycobacterium sp. (strain MCS) GN=lig PE=3 SV=1 317 869 4.0E-22
sp|A1UDY9|DNLI_MYCSK Probable DNA ligase OS=Mycobacterium sp. (strain KMS) GN=lig PE=3 SV=1 317 869 4.0E-22
sp|A3PXE2|DNLI_MYCSJ Probable DNA ligase OS=Mycobacterium sp. (strain JLS) GN=lig PE=3 SV=1 317 869 4.0E-22
sp|Q0SG75|DNLI_RHOJR Probable DNA ligase OS=Rhodococcus jostii (strain RHA1) GN=lig PE=3 SV=1 343 859 4.0E-22
sp|Q6FVD8|DNLI4_CANGA DNA ligase 4 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=LIG4 PE=3 SV=1 477 730 5.0E-22
sp|Q826P6|DNLI_STRAW Probable DNA ligase OS=Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680) GN=lig PE=3 SV=1 343 859 3.0E-21
sp|A0QJL0|DNLI_MYCA1 Probable DNA ligase OS=Mycobacterium avium (strain 104) GN=lig PE=3 SV=1 470 869 3.0E-21
sp|A9GU24|DNLI_SORC5 Probable DNA ligase OS=Sorangium cellulosum (strain So ce56) GN=lig PE=3 SV=1 321 869 2.0E-20
sp|B1W5J2|DNLI_STRGG Probable DNA ligase OS=Streptomyces griseus subsp. griseus (strain JCM 4626 / NBRC 13350) GN=lig PE=3 SV=1 343 859 4.0E-20
sp|P0CN08|DNLI4_CRYNJ DNA ligase 4 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=LIG4 PE=3 SV=1 397 856 6.0E-20
sp|P0CN09|DNLI4_CRYNB DNA ligase 4 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=LIG4 PE=3 SV=1 397 856 6.0E-20
sp|Q08387|DNLI4_YEAST DNA ligase 4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DNL4 PE=1 SV=1 481 747 1.0E-19
sp|Q6CSH0|DNLI4_KLULA DNA ligase 4 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=LIG4 PE=3 SV=1 487 770 2.0E-19
sp|P52496|DNLI4_CANAL DNA ligase 4 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=LIG4 PE=2 SV=3 510 868 4.0E-19
sp|A7HID3|DNLI_ANADF Probable DNA ligase OS=Anaeromyxobacter sp. (strain Fw109-5) GN=lig PE=3 SV=1 480 878 2.0E-18
sp|A6WG40|DNLI_KINRD Probable DNA ligase OS=Kineococcus radiotolerans (strain ATCC BAA-149 / DSM 14245 / SRS30216) GN=lig PE=3 SV=1 481 859 8.0E-18
sp|C5BW79|DNLI_BEUC1 Probable DNA ligase OS=Beutenbergia cavernae (strain ATCC BAA-8 / DSM 12333 / NBRC 16432) GN=lig PE=3 SV=1 481 859 1.0E-17
sp|Q7X7E9|DNLI4_ORYSJ Putative DNA ligase 4 OS=Oryza sativa subsp. japonica GN=LIG4 PE=2 SV=2 397 886 5.0E-17
sp|Q75CA4|DNLI4_ASHGO DNA ligase 4 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=LIG4 PE=3 SV=1 436 745 2.0E-16
sp|A0R3R7|LIGD_MYCS2 Multifunctional non-homologous end joining protein LigD OS=Mycobacterium smegmatis (strain ATCC 700084 / mc(2)155) GN=ligD PE=1 SV=2 433 834 2.0E-13
sp|P9WNV2|LIGD_MYCTO Multifunctional non-homologous end joining DNA repair protein LigD OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=ligD PE=3 SV=1 544 834 2.0E-11
sp|P59971|LIGD_MYCBO Multifunctional non-homologous end joining protein LigD OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=ligD PE=3 SV=1 544 834 2.0E-11
sp|P9WNV3|LIGD_MYCTU Multifunctional non-homologous end joining DNA repair protein LigD OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=ligD PE=1 SV=1 544 834 2.0E-11
sp|Q9I1X7|LIGD_PSEAE Multifunctional non-homologous end joining protein LigD OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=ligD PE=1 SV=1 548 863 7.0E-08
[Show less]

GO

GO Term Description Terminal node
GO:0003677 DNA binding Yes
GO:0006310 DNA recombination Yes
GO:0006281 DNA repair Yes
GO:0005524 ATP binding Yes
GO:0003910 DNA ligase (ATP) activity Yes
GO:0034641 cellular nitrogen compound metabolic process No
GO:0051716 cellular response to stimulus No
GO:1901360 organic cyclic compound metabolic process No
GO:0003909 DNA ligase activity No
GO:0097367 carbohydrate derivative binding No
GO:0006807 nitrogen compound metabolic process No
GO:0016886 ligase activity, forming phosphoric ester bonds No
GO:0032553 ribonucleotide binding No
GO:0140640 catalytic activity, acting on a nucleic acid No
GO:0043167 ion binding No
GO:0033554 cellular response to stress No
GO:0000166 nucleotide binding No
GO:0003824 catalytic activity No
GO:0035639 purine ribonucleoside triphosphate binding No
GO:0003674 molecular_function No
GO:0005488 binding No
GO:0140097 catalytic activity, acting on DNA No
GO:0008150 biological_process No
GO:0006725 cellular aromatic compound metabolic process No
GO:0006950 response to stress No
GO:0043170 macromolecule metabolic process No
GO:0008152 metabolic process No
GO:0043168 anion binding No
GO:0046483 heterocycle metabolic process No
GO:0006974 cellular response to DNA damage stimulus No
GO:0030554 adenyl nucleotide binding No
GO:0003676 nucleic acid binding No
GO:0044238 primary metabolic process No
GO:0016874 ligase activity No
GO:0009987 cellular process No
GO:0050896 response to stimulus No
GO:0036094 small molecule binding No
GO:0032559 adenyl ribonucleotide binding No
GO:0006139 nucleobase-containing compound metabolic process No
GO:0044237 cellular metabolic process No
GO:0006259 DNA metabolic process No
GO:0071704 organic substance metabolic process No
GO:0044260 cellular macromolecule metabolic process No
GO:1901363 heterocyclic compound binding No
GO:0032555 purine ribonucleotide binding No
GO:1901265 nucleoside phosphate binding No
GO:0097159 organic cyclic compound binding No
GO:0090304 nucleic acid metabolic process No
GO:0017076 purine nucleotide binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 66 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|3578
MAPKQATLGYVKPKQSTLGKFFGAKTAAPQQQSKLSFTTKTTENDAVASSKPETDVKTDSRKRGRQLDQEKVKKE
EDEVDDDGPIAKRPRRRNRVKVEDDEEGAEEEQRRGSKDEQNTETKAEGDDVPSRKKKTESRQKLEGETSVKKPQ
KSRKGQVKGEPSPRPKEEEQASDQDTSAKPAIESESDPEAEAEDEKKQTAVTAKAREKVQQTLLKVKGQTPYPDW
EAGSAVPYAALCETFSLIEMTTKRLVIMEYCSSFLRQVMRLTPDDLLPTILLMINKLAPDYAGIELGIGESLIMK
AIGETTGRSLAIIKADQKDIGDLGLVAIKSRSTQPTMFKPKPLTVRAVHQGLMGIATVAGHGAQGKKVDGIKKLL
SAADAHAAGKVDIAKDKGGPSEAKFIVRFLEGKLRLGLAERTVLVSLAQAVVCHEAEQKGKVPTSTDLENGESIL
KTVYSELPSYDAIIPVLLEKGLAHVRESCKLRPGIPLKPMLAKPTKAITEVLDRFEGQTFTCEYKYDGERAQIHY
VAKEAPQELSAATANTQNEAAGGVASIFSRNSEDLSTKYPDILAKLHTWVKPDTRSFVLDCETVAWDVYEKKVLP
FQQLMTRKKKDVRADEVKVKVCVFAFDVLYLNGQPLVDRPLRERRQRLSEAFVPVEGEFAFATAMNGQELDEIQG
FLDESVKASCEGLMVKMLDGSESGYEPSKRSRNWLKIKKDYLSGVGDSLDLVVLGAYYGKGKRTSVYGAFLLACY
NASTESYESICNIGTGFSEQVLEQLHAQLSQTTIARPKPFYAHSATLQHQPDVWLEPRFVWEVRTADLTLSPRYK
AGCHEGVDPAGEKGISLRFPRFVRVREDKKADEATGSRQVAEMYRKQESVTRNKGPAVDDDFEY*
Coding >OphauB2|3578
ATGGCACCAAAGCAAGCGACCCTGGGGTATGTGAAGCCAAAGCAGAGCACCCTTGGCAAGTTTTTTGGGGCAAAG
ACGGCGGCGCCGCAACAGCAGTCGAAGCTATCGTTTACGACCAAGACGACGGAGAATGACGCGGTGGCTTCTTCC
AAGCCCGAGACTGATGTCAAAACTGATTCTAGGAAAAGAGGGCGACAGCTAGACCAAGAAAAGGTGAAGAAGGAG
GAAGACGAGGTTGACGATGATGGTCCAATTGCGAAGCGGCCGAGAAGAAGAAACAGGGTCAAGGTTGAAGACGAC
GAAGAAGGCGCTGAGGAGGAGCAGAGGCGTGGCTCCAAGGATGAACAAAATACGGAGACAAAGGCCGAGGGCGAT
GACGTGCCGAGCAGGAAAAAAAAGACAGAGTCACGGCAAAAACTGGAGGGCGAGACTTCTGTGAAGAAGCCGCAG
AAAAGTCGAAAAGGGCAAGTCAAGGGCGAGCCAAGCCCTCGGCCAAAGGAAGAAGAGCAGGCTTCGGATCAAGAC
ACGAGCGCCAAGCCGGCGATCGAGTCTGAATCGGACCCAGAGGCAGAGGCCGAGGACGAGAAGAAGCAAACAGCG
GTTACAGCAAAGGCACGGGAAAAGGTGCAACAGACACTGCTCAAGGTCAAAGGGCAGACGCCCTATCCAGACTGG
GAAGCAGGAAGCGCGGTGCCCTATGCGGCTCTGTGCGAGACATTTTCCTTGATTGAGATGACGACGAAGCGGCTC
GTCATCATGGAGTACTGCTCCTCGTTTCTCCGACAGGTCATGAGGCTTACACCAGACGACTTGCTGCCGACGATT
CTCCTCATGATCAACAAGCTGGCACCAGACTATGCGGGCATTGAGCTTGGCATTGGCGAGTCTCTGATTATGAAG
GCGATTGGCGAGACGACGGGGCGAAGTCTGGCCATTATCAAGGCGGACCAAAAGGATATTGGTGACTTGGGCTTG
GTGGCGATTAAGAGCCGATCGACGCAGCCCACCATGTTCAAGCCCAAGCCGCTGACGGTGCGGGCGGTGCACCAG
GGCTTGATGGGCATTGCAACGGTGGCGGGCCACGGCGCGCAGGGCAAAAAGGTGGACGGCATCAAGAAGCTCTTG
TCGGCGGCCGATGCCCACGCGGCTGGCAAGGTGGACATTGCCAAGGACAAAGGCGGGCCGAGCGAGGCCAAGTTT
ATAGTTCGCTTCCTCGAGGGCAAGCTGAGGCTGGGTCTAGCTGAGCGGACGGTGCTGGTATCTCTTGCGCAGGCC
GTTGTCTGCCACGAGGCAGAGCAAAAGGGCAAGGTGCCGACAAGCACAGACTTGGAGAATGGAGAGTCGATTCTC
AAGACCGTGTATAGTGAATTGCCGAGCTACGACGCCATCATCCCCGTCCTGCTGGAAAAGGGGCTGGCGCATGTG
CGCGAGAGCTGCAAGCTCCGCCCCGGCATACCGCTCAAGCCCATGCTGGCCAAGCCCACAAAGGCCATTACCGAA
GTGCTGGATCGATTCGAGGGCCAAACCTTTACCTGCGAATACAAGTATGACGGCGAGCGGGCGCAAATTCACTAC
GTGGCCAAGGAGGCGCCGCAGGAGCTCAGTGCCGCCACAGCGAACACGCAAAACGAGGCGGCGGGCGGCGTGGCC
AGCATCTTTTCGCGCAACTCGGAAGACTTGTCAACCAAGTATCCCGACATTTTGGCCAAGCTGCACACGTGGGTC
AAGCCAGACACGCGGAGCTTTGTCCTTGACTGCGAAACGGTGGCGTGGGACGTGTACGAAAAAAAAGTGCTGCCG
TTTCAGCAGCTCATGACGCGCAAGAAGAAGGATGTCAGGGCGGACGAGGTCAAGGTCAAGGTGTGCGTCTTTGCC
TTTGACGTGCTCTATCTCAATGGCCAGCCGCTGGTGGACCGGCCGCTGCGCGAGCGTCGCCAACGGCTTAGCGAG
GCGTTTGTGCCCGTCGAGGGCGAATTCGCCTTTGCCACGGCAATGAATGGCCAGGAACTGGATGAGATTCAGGGC
TTTTTGGACGAGAGCGTCAAGGCGTCGTGCGAGGGCTTAATGGTCAAGATGCTCGACGGCAGCGAGAGCGGATAC
GAGCCGAGCAAGCGAAGCCGCAACTGGCTCAAGATCAAAAAGGACTACCTCTCTGGCGTTGGCGACTCGCTCGAC
CTGGTGGTGCTGGGCGCCTACTACGGCAAGGGCAAGCGCACATCTGTCTATGGCGCCTTTCTCCTTGCCTGCTAC
AATGCATCCACCGAGTCGTACGAGAGCATCTGCAACATTGGCACGGGCTTCTCGGAGCAAGTACTGGAGCAGCTG
CACGCCCAGCTCTCGCAAACCACCATTGCGCGGCCCAAGCCCTTTTACGCACACTCGGCCACGCTGCAGCACCAG
CCCGACGTGTGGCTGGAGCCGCGCTTCGTGTGGGAGGTGCGCACCGCCGACTTGACGCTCAGCCCTCGCTACAAG
GCGGGCTGCCACGAGGGCGTCGACCCGGCGGGCGAAAAGGGCATTAGCCTGCGCTTCCCGCGCTTTGTGCGCGTG
CGTGAGGACAAGAAGGCTGACGAGGCTACGGGCAGTCGCCAGGTGGCGGAAATGTACCGCAAGCAAGAGAGCGTC
ACGAGGAACAAGGGGCCGGCGGTGGATGACGATTTCGAATACTAG
Transcript >OphauB2|3578
ATGGCACCAAAGCAAGCGACCCTGGGGTATGTGAAGCCAAAGCAGAGCACCCTTGGCAAGTTTTTTGGGGCAAAG
ACGGCGGCGCCGCAACAGCAGTCGAAGCTATCGTTTACGACCAAGACGACGGAGAATGACGCGGTGGCTTCTTCC
AAGCCCGAGACTGATGTCAAAACTGATTCTAGGAAAAGAGGGCGACAGCTAGACCAAGAAAAGGTGAAGAAGGAG
GAAGACGAGGTTGACGATGATGGTCCAATTGCGAAGCGGCCGAGAAGAAGAAACAGGGTCAAGGTTGAAGACGAC
GAAGAAGGCGCTGAGGAGGAGCAGAGGCGTGGCTCCAAGGATGAACAAAATACGGAGACAAAGGCCGAGGGCGAT
GACGTGCCGAGCAGGAAAAAAAAGACAGAGTCACGGCAAAAACTGGAGGGCGAGACTTCTGTGAAGAAGCCGCAG
AAAAGTCGAAAAGGGCAAGTCAAGGGCGAGCCAAGCCCTCGGCCAAAGGAAGAAGAGCAGGCTTCGGATCAAGAC
ACGAGCGCCAAGCCGGCGATCGAGTCTGAATCGGACCCAGAGGCAGAGGCCGAGGACGAGAAGAAGCAAACAGCG
GTTACAGCAAAGGCACGGGAAAAGGTGCAACAGACACTGCTCAAGGTCAAAGGGCAGACGCCCTATCCAGACTGG
GAAGCAGGAAGCGCGGTGCCCTATGCGGCTCTGTGCGAGACATTTTCCTTGATTGAGATGACGACGAAGCGGCTC
GTCATCATGGAGTACTGCTCCTCGTTTCTCCGACAGGTCATGAGGCTTACACCAGACGACTTGCTGCCGACGATT
CTCCTCATGATCAACAAGCTGGCACCAGACTATGCGGGCATTGAGCTTGGCATTGGCGAGTCTCTGATTATGAAG
GCGATTGGCGAGACGACGGGGCGAAGTCTGGCCATTATCAAGGCGGACCAAAAGGATATTGGTGACTTGGGCTTG
GTGGCGATTAAGAGCCGATCGACGCAGCCCACCATGTTCAAGCCCAAGCCGCTGACGGTGCGGGCGGTGCACCAG
GGCTTGATGGGCATTGCAACGGTGGCGGGCCACGGCGCGCAGGGCAAAAAGGTGGACGGCATCAAGAAGCTCTTG
TCGGCGGCCGATGCCCACGCGGCTGGCAAGGTGGACATTGCCAAGGACAAAGGCGGGCCGAGCGAGGCCAAGTTT
ATAGTTCGCTTCCTCGAGGGCAAGCTGAGGCTGGGTCTAGCTGAGCGGACGGTGCTGGTATCTCTTGCGCAGGCC
GTTGTCTGCCACGAGGCAGAGCAAAAGGGCAAGGTGCCGACAAGCACAGACTTGGAGAATGGAGAGTCGATTCTC
AAGACCGTGTATAGTGAATTGCCGAGCTACGACGCCATCATCCCCGTCCTGCTGGAAAAGGGGCTGGCGCATGTG
CGCGAGAGCTGCAAGCTCCGCCCCGGCATACCGCTCAAGCCCATGCTGGCCAAGCCCACAAAGGCCATTACCGAA
GTGCTGGATCGATTCGAGGGCCAAACCTTTACCTGCGAATACAAGTATGACGGCGAGCGGGCGCAAATTCACTAC
GTGGCCAAGGAGGCGCCGCAGGAGCTCAGTGCCGCCACAGCGAACACGCAAAACGAGGCGGCGGGCGGCGTGGCC
AGCATCTTTTCGCGCAACTCGGAAGACTTGTCAACCAAGTATCCCGACATTTTGGCCAAGCTGCACACGTGGGTC
AAGCCAGACACGCGGAGCTTTGTCCTTGACTGCGAAACGGTGGCGTGGGACGTGTACGAAAAAAAAGTGCTGCCG
TTTCAGCAGCTCATGACGCGCAAGAAGAAGGATGTCAGGGCGGACGAGGTCAAGGTCAAGGTGTGCGTCTTTGCC
TTTGACGTGCTCTATCTCAATGGCCAGCCGCTGGTGGACCGGCCGCTGCGCGAGCGTCGCCAACGGCTTAGCGAG
GCGTTTGTGCCCGTCGAGGGCGAATTCGCCTTTGCCACGGCAATGAATGGCCAGGAACTGGATGAGATTCAGGGC
TTTTTGGACGAGAGCGTCAAGGCGTCGTGCGAGGGCTTAATGGTCAAGATGCTCGACGGCAGCGAGAGCGGATAC
GAGCCGAGCAAGCGAAGCCGCAACTGGCTCAAGATCAAAAAGGACTACCTCTCTGGCGTTGGCGACTCGCTCGAC
CTGGTGGTGCTGGGCGCCTACTACGGCAAGGGCAAGCGCACATCTGTCTATGGCGCCTTTCTCCTTGCCTGCTAC
AATGCATCCACCGAGTCGTACGAGAGCATCTGCAACATTGGCACGGGCTTCTCGGAGCAAGTACTGGAGCAGCTG
CACGCCCAGCTCTCGCAAACCACCATTGCGCGGCCCAAGCCCTTTTACGCACACTCGGCCACGCTGCAGCACCAG
CCCGACGTGTGGCTGGAGCCGCGCTTCGTGTGGGAGGTGCGCACCGCCGACTTGACGCTCAGCCCTCGCTACAAG
GCGGGCTGCCACGAGGGCGTCGACCCGGCGGGCGAAAAGGGCATTAGCCTGCGCTTCCCGCGCTTTGTGCGCGTG
CGTGAGGACAAGAAGGCTGACGAGGCTACGGGCAGTCGCCAGGTGGCGGAAATGTACCGCAAGCAAGAGAGCGTC
ACGAGGAACAAGGGGCCGGCGGTGGATGACGATTTCGAATACTAG
Gene >OphauB2|3578
ATGGCACCAAAGCAAGCGACCCTGGGGTATGTGAAGCCAAAGCAGAGCACCCTTGGGTGCGTGTGTTGTCAAGTA
AAAGCACACGTAGATTCCCATGGGGCAGATTCAATGCTCACAGGAGAGGGACTATAGCAAGTTTTTTGGGGCAAA
GACGGCGGCGCCGCAACAGCAGTCGAAGCTATCGTTTACGACCAAGACGACGGAGAATGACGCGGTGGCTTCTTC
CAAGCCCGAGACTGATGTCAAAACTGGTAGGTGACGATGTCTTTTTTTGTTTCCTTGTCCCTTTTTCTCCGTGTG
TTTTGGTGGCTGACCAAGATATCTCGAGGACAAGATTCTAGGAAAAGAGGGCGACAGCTAGACCAAGAAAAGGTG
AAGAAGGAGGAAGACGAGGTTGACGATGATGGTCCAATTGCGAAGCGGCCGAGAAGAAGAAACAGGGTCAAGGTT
GAAGACGACGAAGAAGGCGCTGAGGAGGAGCAGAGGCGTGGCTCCAAGGATGAACAAAATACGGAGACAAAGGCC
GAGGGCGATGACGTGCCGAGCAGGAAAAAAAAGACAGAGTCACGGCAAAAACTGGAGGGCGAGACTTCTGTGAAG
AAGCCGCAGAAAAGTCGAAAAGGGCAAGTCAAGGGCGAGCCAAGCCCTCGGCCAAAGGAAGAAGAGCAGGCTTCG
GATCAAGACACGAGCGCCAAGCCGGCGATCGAGTCTGAATCGGACCCAGAGGCAGAGGCCGAGGACGAGAAGAAG
CAAACAGCGGTTACAGCAAAGGCACGGGAAAAGGTGCAACAGACACTGCTCAAGGTCAAAGGGCAGACGCCCTAT
CCAGACTGGGAAGCAGGAAGCGCGGTGCCCTATGCGGCTCTGTGCGAGACATTTTCCTTGATTGAGATGACGACG
AAGCGGCTCGTCATCATGGAGTACTGCTCCTCGTTTCTCCGACAGGTCATGAGGCTTACACCAGACGACTTGCTG
CCGACGATTCTCCTCATGATCAACAAGCTGGCACCAGACTATGCGGGCATTGAGCTTGGCATTGGCGAGTCTCTG
ATTATGAAGGCGATTGGCGAGACGACGGGGCGAAGTCTGGCCATTATCAAGGCGGACCAAAAGGATATTGGTGAC
TTGGGCTTGGTGGCGATTAAGAGCCGATCGACGCAGCCCACCATGTTCAAGCCCAAGCCGCTGACGGTGCGGGCG
GTGCACCAGGGCTTGATGGGCATTGCAACGGTGGCGGGCCACGGCGCGCAGGGCAAAAAGGTGGACGGCATCAAG
AAGCTCTTGTCGGCGGCCGATGCCCACGCGGCTGGCAAGGTGGACATTGCCAAGGACAAAGGCGGGCCGAGCGAG
GCCAAGTTTATAGTTCGCTTCCTCGAGGGCAAGCTGAGGCTGGGTCTAGCTGAGCGGACGGTGCTGGTATCTCTT
GCGCAGGCCGTTGTCTGCCACGAGGCAGAGCAAAAGGGCAAGGTGCCGACAAGCACAGACTTGGAGAATGGAGAG
TCGATTCTCAAGACCGTGTATAGGTGAGAAGTGCTTGCTACTACTGGAGAGGGACGAAGTGTGTAATGGTGGCTA
ATGGCGAGACTGGCTTCGTGATAGTGAATTGCCGAGCTACGACGCCATCATCCCCGTCCTGCTGGAAAAGGGGCT
GGCGCATGTGCGCGAGAGCTGCAAGCTCCGCCCCGGCATACCGCTCAAGCCCATGCTGGCCAAGCCCACAAAGGC
CATTACCGAAGTGCTGGATCGATTCGAGGGCCAAACCTTTACCTGCGAATACAAGTATGACGGCGAGCGGGCGCA
AATTCACTACGTGGCCAAGGAGGCGCCGCAGGAGCTCAGTGCCGCCACAGCGAACACGCAAAACGAGGCGGCGGG
CGGCGTGGCCAGCATCTTTTCGCGCAACTCGGAAGACTTGTCAACCAAGTATCCCGACATTTTGGCCAAGCTGCA
CACGTGGGTCAAGCCAGACACGCGGAGCTTTGTCCTTGACTGCGAAACGGTGGCGTGGGACGTGTACGAAAAAAA
AGTGCTGCCGTTTCAGCAGCTCATGACGCGCAAGAAGAAGGATGTCAGGGCGGACGAGGTCAAGGTCAAGGTGTG
CGTCTTTGCCTTTGACGTGCTCTATCTCAATGGCCAGCCGCTGGTGGACCGGCCGCTGCGCGAGCGTCGCCAACG
GCTTAGCGAGGCGTTTGTGCCCGTCGAGGGCGAATTCGCCTTTGCCACGGCAATGAATGGCCAGGAACTGGATGA
GATTCAGGGCTTTTTGGACGAGAGCGTCAAGGCGTCGTGCGAGGGCTTAATGGTCAAGATGCTCGACGGCAGCGA
GAGCGGATACGAGCCGAGCAAGCGAAGCCGCAACTGGCTCAAGGCAAGGCGGCCCCGCCCCTGTCTCTCTTCTTT
ATTCATTGCTGCTTTTCTTTCTTTTGCTCTTTTTTTTTGGCTTTTCAAGAGAAAAAAAAAGGCTGGTTTTGCTAA
CGCTGCTCAATGACAGATCAAAAAGGACTACCTCTCTGGCGTTGGCGACTCGCTCGACCTGGTGGTGCTGGGCGC
CTACTACGGCAAGGGCAAGCGCACATCTGTCTATGGCGCCTTTCTCCTTGCCTGCTACAATGCATCCACCGAGTC
GTACGAGAGCATCTGCAACATTGGCACGGGCTTCTCGGAGCAAGTACTGGAGCAGCTGCACGCCCAGCTCTCGCA
AACCACCATTGCGCGGCCCAAGCCCTTTTACGCACACTCGGCCACGCTGCAGCACCAGCCCGACGTGTGGCTGGA
GCCGCGCTTCGTGTGGGAGGTGCGCACCGCCGACTTGACGCTCAGCCCTCGCTACAAGGCGGGCTGCCACGAGGG
CGTCGACCCGGCGGGCGAAAAGGGCATTAGCCTGCGCTTCCCGCGCTTTGTGCGCGTGCGTGAGGACAAGAAGGC
TGACGAGGCTACGGGCAGTCGCCAGGTGGCGGAAATGTACCGCAAGCAAGAGAGCGTCACGAGGAACAAGGGGCC
GGCGGTGGATGACGATTTCGAATACTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail