Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|3564
Gene name
LocationContig_228:11043..12018
Strand+
Gene length (bp)975
Transcript length (bp)897
Coding sequence length (bp)897
Protein length (aa) 299

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00448 SRP54 SRP54-type protein, GTPase domain 1.8E-06 32 85

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q9UUH3|MUG58_SCHPO Uncharacterized kinase mug58 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mug58 PE=1 SV=1 5 285 2.0E-53
sp|Q944I4|GLYK_ARATH D-glycerate 3-kinase, chloroplastic OS=Arabidopsis thaliana GN=GLYK PE=1 SV=2 11 285 1.0E-42
sp|P42938|TDA10_YEAST Probable ATP-dependent kinase TDA10 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TDA10 PE=1 SV=1 1 287 3.0E-38

GO

GO Term Description Terminal node
GO:0006614 SRP-dependent cotranslational protein targeting to membrane Yes
GO:0005525 GTP binding Yes
GO:0015031 protein transport No
GO:0051179 localization No
GO:0051668 localization within membrane No
GO:0032553 ribonucleotide binding No
GO:0019001 guanyl nucleotide binding No
GO:0043167 ion binding No
GO:0033036 macromolecule localization No
GO:0000166 nucleotide binding No
GO:0046907 intracellular transport No
GO:0035639 purine ribonucleoside triphosphate binding No
GO:0097367 carbohydrate derivative binding No
GO:0003674 molecular_function No
GO:0071702 organic substance transport No
GO:0005488 binding No
GO:0051649 establishment of localization in cell No
GO:0008150 biological_process No
GO:0006613 cotranslational protein targeting to membrane No
GO:0045184 establishment of protein localization No
GO:0070727 cellular macromolecule localization No
GO:0006605 protein targeting No
GO:0051641 cellular localization No
GO:0090150 establishment of protein localization to membrane No
GO:0071705 nitrogen compound transport No
GO:0006886 intracellular protein transport No
GO:0008104 protein localization No
GO:0043168 anion binding No
GO:0032561 guanyl ribonucleotide binding No
GO:0006612 protein targeting to membrane No
GO:0051234 establishment of localization No
GO:0045047 protein targeting to ER No
GO:0072657 protein localization to membrane No
GO:0072594 establishment of protein localization to organelle No
GO:0009987 cellular process No
GO:0033365 protein localization to organelle No
GO:0036094 small molecule binding No
GO:1901363 heterocyclic compound binding No
GO:0032555 purine ribonucleotide binding No
GO:1901265 nucleoside phosphate binding No
GO:0097159 organic cyclic compound binding No
GO:0006810 transport No
GO:0072599 establishment of protein localization to endoplasmic reticulum No
GO:0017076 purine nucleotide binding No
GO:0070972 protein localization to endoplasmic reticulum No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 22 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|3564
MSDRIETVPLCLDFILGHLHARETAGQSRPLVVGINGVQGVGKTTLVTSLAQRLEQRGICAVVCSIDDFYLTHEE
QLAVARENPDNALLQHRGQPGTHDLPLLRSVLSSLCEGKPTLLPRYDKSAFHGQGDRFPSSASIPTNQPGTPSAR
VLLLEGWCIGFRALSPNQLAARYASPSRTLQAHSLQHLLLVNHKLEAYDFLTKLLDLFVHIDTSDLSNVYAWRQQ
QEDSLREQSGDAHAGMTREQVVCFVNAYYPAYELYTNGLRAGLFAHCQDCHLRIVLDSNRRVETVDYVRASAA*
Coding >OphauB2|3564
ATGTCCGACAGGATTGAAACAGTGCCCCTGTGTCTAGACTTTATACTCGGCCACCTCCACGCCCGCGAGACGGCA
GGGCAGTCACGGCCGCTGGTTGTCGGCATCAATGGCGTGCAGGGCGTGGGCAAGACGACGCTTGTGACGAGCTTG
GCGCAACGGCTTGAGCAGCGCGGCATCTGTGCCGTTGTCTGCAGCATTGATGATTTTTACCTGACGCACGAGGAG
CAGCTTGCGGTGGCGCGGGAGAATCCAGATAATGCCTTGTTGCAACATCGAGGACAGCCGGGGACTCATGATTTA
CCACTTTTGCGCTCCGTGCTATCATCGCTGTGCGAGGGGAAACCGACTCTGCTTCCTCGCTACGACAAGAGCGCA
TTCCACGGCCAGGGAGACCGTTTCCCCTCATCGGCTTCCATCCCAACCAACCAGCCCGGCACTCCGTCTGCGCGC
GTCCTCCTCCTCGAGGGCTGGTGCATCGGCTTCCGCGCCCTCTCGCCCAACCAGCTAGCCGCTCGCTACGCCTCC
CCCAGCCGCACCCTCCAAGCCCACTCGCTACAGCATCTCTTGCTCGTCAACCACAAACTCGAGGCCTACGACTTC
TTGACCAAGCTGTTGGACCTCTTTGTTCACATCGACACAAGCGATTTGAGTAATGTCTATGCTTGGCGGCAGCAG
CAGGAGGATTCGCTGCGTGAGCAGTCGGGCGACGCGCACGCTGGCATGACGCGCGAGCAAGTCGTTTGCTTTGTC
AATGCTTACTATCCTGCCTATGAGCTGTATACTAATGGTCTCAGGGCTGGTCTCTTTGCACATTGCCAGGATTGC
CACTTGCGCATCGTCCTCGACTCCAATCGCAGAGTAGAGACTGTCGACTATGTACGCGCCTCAGCTGCATAG
Transcript >OphauB2|3564
ATGTCCGACAGGATTGAAACAGTGCCCCTGTGTCTAGACTTTATACTCGGCCACCTCCACGCCCGCGAGACGGCA
GGGCAGTCACGGCCGCTGGTTGTCGGCATCAATGGCGTGCAGGGCGTGGGCAAGACGACGCTTGTGACGAGCTTG
GCGCAACGGCTTGAGCAGCGCGGCATCTGTGCCGTTGTCTGCAGCATTGATGATTTTTACCTGACGCACGAGGAG
CAGCTTGCGGTGGCGCGGGAGAATCCAGATAATGCCTTGTTGCAACATCGAGGACAGCCGGGGACTCATGATTTA
CCACTTTTGCGCTCCGTGCTATCATCGCTGTGCGAGGGGAAACCGACTCTGCTTCCTCGCTACGACAAGAGCGCA
TTCCACGGCCAGGGAGACCGTTTCCCCTCATCGGCTTCCATCCCAACCAACCAGCCCGGCACTCCGTCTGCGCGC
GTCCTCCTCCTCGAGGGCTGGTGCATCGGCTTCCGCGCCCTCTCGCCCAACCAGCTAGCCGCTCGCTACGCCTCC
CCCAGCCGCACCCTCCAAGCCCACTCGCTACAGCATCTCTTGCTCGTCAACCACAAACTCGAGGCCTACGACTTC
TTGACCAAGCTGTTGGACCTCTTTGTTCACATCGACACAAGCGATTTGAGTAATGTCTATGCTTGGCGGCAGCAG
CAGGAGGATTCGCTGCGTGAGCAGTCGGGCGACGCGCACGCTGGCATGACGCGCGAGCAAGTCGTTTGCTTTGTC
AATGCTTACTATCCTGCCTATGAGCTGTATACTAATGGTCTCAGGGCTGGTCTCTTTGCACATTGCCAGGATTGC
CACTTGCGCATCGTCCTCGACTCCAATCGCAGAGTAGAGACTGTCGACTATGTACGCGCCTCAGCTGCATAG
Gene >OphauB2|3564
ATGTCCGACAGGATTGAAACAGTGCCCCTGTGTCTAGACTTTATACTCGGCCACCTCCACGCCCGCGAGACGGCA
GGGCAGTCACGGCCGCTGGTTGTCGGCATCAATGGCGTGCAGGGCGTGGGCAAGACGACGCTTGTGACGAGCTTG
GCGCAACGGCTTGAGCAGCGCGGCATCTGTGCCGTTGTCTGCAGCATTGATGATTTTTACCTGACGCACGAGGAG
CAGCTTGCGGTGGCGCGGGAGAATCCAGATAATGCCTTGTTGCAACATCGAGGACAGCCGGGTATGTTATATCTA
CTAGAGTTGGGAAACCTACTAGAGTTGGGAACCTTTGACAAAGATTGTTAACGGGGGGAAGTAGGGACTCATGAT
TTACCACTTTTGCGCTCCGTGCTATCATCGCTGTGCGAGGGGAAACCGACTCTGCTTCCTCGCTACGACAAGAGC
GCATTCCACGGCCAGGGAGACCGTTTCCCCTCATCGGCTTCCATCCCAACCAACCAGCCCGGCACTCCGTCTGCG
CGCGTCCTCCTCCTCGAGGGCTGGTGCATCGGCTTCCGCGCCCTCTCGCCCAACCAGCTAGCCGCTCGCTACGCC
TCCCCCAGCCGCACCCTCCAAGCCCACTCGCTACAGCATCTCTTGCTCGTCAACCACAAACTCGAGGCCTACGAC
TTCTTGACCAAGCTGTTGGACCTCTTTGTTCACATCGACACAAGCGATTTGAGTAATGTCTATGCTTGGCGGCAG
CAGCAGGAGGATTCGCTGCGTGAGCAGTCGGGCGACGCGCACGCTGGCATGACGCGCGAGCAAGTCGTTTGCTTT
GTCAATGCTTACTATCCTGCCTATGAGCTGTATACTAATGGTCTCAGGGCTGGTCTCTTTGCACATTGCCAGGAT
TGCCACTTGCGCATCGTCCTCGACTCCAATCGCAGAGTAGAGACTGTCGACTATGTACGCGCCTCAGCTGCATAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail