Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|3561
Gene name
LocationContig_228:2724..3402
Strand+
Gene length (bp)678
Transcript length (bp)432
Coding sequence length (bp)432
Protein length (aa) 144

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01648 ACPS 4'-phosphopantetheinyl transferase superfamily 1.3E-10 12 131

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q8Y0H7|ACPS_RALSO Holo-[acyl-carrier-protein] synthase OS=Ralstonia solanacearum (strain GMI1000) GN=acpS PE=3 SV=1 12 138 1.0E-09
sp|A4IJT3|ACPS_GEOTN Holo-[acyl-carrier-protein] synthase OS=Geobacillus thermodenitrificans (strain NG80-2) GN=acpS PE=3 SV=1 9 134 1.0E-08
sp|B3R1Z5|ACPS_CUPTR Holo-[acyl-carrier-protein] synthase OS=Cupriavidus taiwanensis (strain R1 / LMG 19424) GN=acpS PE=3 SV=1 9 134 3.0E-08
sp|Q5L3G7|ACPS_GEOKA Holo-[acyl-carrier-protein] synthase OS=Geobacillus kaustophilus (strain HTA426) GN=acpS PE=3 SV=1 9 133 3.0E-08
sp|A7Z1L9|ACPS_BACMF Holo-[acyl-carrier-protein] synthase OS=Bacillus methylotrophicus (strain DSM 23117 / BGSC 10A6 / FZB42) GN=acpS PE=3 SV=1 9 138 7.0E-08
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q8Y0H7|ACPS_RALSO Holo-[acyl-carrier-protein] synthase OS=Ralstonia solanacearum (strain GMI1000) GN=acpS PE=3 SV=1 12 138 1.0E-09
sp|A4IJT3|ACPS_GEOTN Holo-[acyl-carrier-protein] synthase OS=Geobacillus thermodenitrificans (strain NG80-2) GN=acpS PE=3 SV=1 9 134 1.0E-08
sp|B3R1Z5|ACPS_CUPTR Holo-[acyl-carrier-protein] synthase OS=Cupriavidus taiwanensis (strain R1 / LMG 19424) GN=acpS PE=3 SV=1 9 134 3.0E-08
sp|Q5L3G7|ACPS_GEOKA Holo-[acyl-carrier-protein] synthase OS=Geobacillus kaustophilus (strain HTA426) GN=acpS PE=3 SV=1 9 133 3.0E-08
sp|A7Z1L9|ACPS_BACMF Holo-[acyl-carrier-protein] synthase OS=Bacillus methylotrophicus (strain DSM 23117 / BGSC 10A6 / FZB42) GN=acpS PE=3 SV=1 9 138 7.0E-08
sp|Q5R110|ACPS_IDILO Holo-[acyl-carrier-protein] synthase OS=Idiomarina loihiensis (strain ATCC BAA-735 / DSM 15497 / L2-TR) GN=acpS PE=3 SV=1 11 74 8.0E-08
sp|B7MYJ4|ACPS_ECO81 Holo-[acyl-carrier-protein] synthase OS=Escherichia coli O81 (strain ED1a) GN=acpS PE=3 SV=1 11 74 1.0E-07
sp|Q1LKN5|ACPS_CUPMC Holo-[acyl-carrier-protein] synthase OS=Cupriavidus metallidurans (strain ATCC 43123 / DSM 2839 / NBRC 102507 / CH34) GN=acpS PE=3 SV=1 9 136 1.0E-07
sp|B7UH03|ACPS_ECO27 Holo-[acyl-carrier-protein] synthase OS=Escherichia coli O127:H6 (strain E2348/69 / EPEC) GN=acpS PE=3 SV=1 11 74 1.0E-07
sp|B7MIP8|ACPS_ECO45 Holo-[acyl-carrier-protein] synthase OS=Escherichia coli O45:K1 (strain S88 / ExPEC) GN=acpS PE=3 SV=1 11 74 1.0E-07
sp|Q8XA39|ACPS_ECO57 Holo-[acyl-carrier-protein] synthase OS=Escherichia coli O157:H7 GN=acpS PE=3 SV=2 11 74 1.0E-07
sp|A8A373|ACPS_ECOHS Holo-[acyl-carrier-protein] synthase OS=Escherichia coli O9:H4 (strain HS) GN=acpS PE=3 SV=1 11 74 1.0E-07
sp|A1AE93|ACPS_ECOK1 Holo-[acyl-carrier-protein] synthase OS=Escherichia coli O1:K1 / APEC GN=acpS PE=3 SV=1 11 74 1.0E-07
sp|Q0TES5|ACPS_ECOL5 Holo-[acyl-carrier-protein] synthase OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=acpS PE=3 SV=1 11 74 1.0E-07
sp|Q8FF19|ACPS_ECOL6 Holo-[acyl-carrier-protein] synthase OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=acpS PE=3 SV=3 11 74 1.0E-07
sp|Q1R8H0|ACPS_ECOUT Holo-[acyl-carrier-protein] synthase OS=Escherichia coli (strain UTI89 / UPEC) GN=acpS PE=3 SV=1 11 74 1.0E-07
sp|Q32CV8|ACPS_SHIDS Holo-[acyl-carrier-protein] synthase OS=Shigella dysenteriae serotype 1 (strain Sd197) GN=acpS PE=3 SV=1 11 74 1.0E-07
sp|B7LV01|ACPS_ESCF3 Holo-[acyl-carrier-protein] synthase OS=Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CDC 0568-73) GN=acpS PE=3 SV=1 11 74 1.0E-07
sp|Q1LTI6|ACPS_BAUCH Holo-[acyl-carrier-protein] synthase OS=Baumannia cicadellinicola subsp. Homalodisca coagulata GN=acpS PE=3 SV=1 11 74 3.0E-07
sp|Q62LS6|ACPS_BURMA Holo-[acyl-carrier-protein] synthase OS=Burkholderia mallei (strain ATCC 23344) GN=acpS PE=3 SV=1 12 135 5.0E-07
sp|B7N6F1|ACPS_ECOLU Holo-[acyl-carrier-protein] synthase OS=Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC) GN=acpS PE=3 SV=1 11 74 5.0E-07
sp|B1LP76|ACPS_ECOSM Holo-[acyl-carrier-protein] synthase OS=Escherichia coli (strain SMS-3-5 / SECEC) GN=acpS PE=3 SV=1 11 74 5.0E-07
sp|A3NXL2|ACPS_BURP0 Holo-[acyl-carrier-protein] synthase OS=Burkholderia pseudomallei (strain 1106a) GN=acpS PE=3 SV=1 12 135 5.0E-07
sp|A6Q7U5|ACPS_SULNB Holo-[acyl-carrier-protein] synthase OS=Sulfurovum sp. (strain NBC37-1) GN=acpS PE=3 SV=1 11 131 5.0E-07
sp|A2S9Z9|ACPS_BURM9 Holo-[acyl-carrier-protein] synthase OS=Burkholderia mallei (strain NCTC 10229) GN=acpS PE=3 SV=1 12 135 5.0E-07
sp|A1V6B3|ACPS_BURMS Holo-[acyl-carrier-protein] synthase OS=Burkholderia mallei (strain SAVP1) GN=acpS PE=3 SV=1 12 135 5.0E-07
sp|Q63S99|ACPS_BURPS Holo-[acyl-carrier-protein] synthase OS=Burkholderia pseudomallei (strain K96243) GN=acpS PE=3 SV=1 12 135 5.0E-07
sp|A3MM38|ACPS_BURM7 Holo-[acyl-carrier-protein] synthase OS=Burkholderia mallei (strain NCTC 10247) GN=acpS PE=3 SV=1 12 135 5.0E-07
sp|Q31XS4|ACPS_SHIBS Holo-[acyl-carrier-protein] synthase OS=Shigella boydii serotype 4 (strain Sb227) GN=acpS PE=3 SV=1 11 74 6.0E-07
sp|A7ZQ07|ACPS_ECO24 Holo-[acyl-carrier-protein] synthase OS=Escherichia coli O139:H28 (strain E24377A / ETEC) GN=acpS PE=3 SV=1 11 74 6.0E-07
sp|B7LDF6|ACPS_ECO55 Holo-[acyl-carrier-protein] synthase OS=Escherichia coli (strain 55989 / EAEC) GN=acpS PE=3 SV=1 11 74 6.0E-07
sp|B7NRL6|ACPS_ECO7I Holo-[acyl-carrier-protein] synthase OS=Escherichia coli O7:K1 (strain IAI39 / ExPEC) GN=acpS PE=3 SV=1 11 74 6.0E-07
sp|B7M8H6|ACPS_ECO8A Holo-[acyl-carrier-protein] synthase OS=Escherichia coli O8 (strain IAI1) GN=acpS PE=3 SV=1 11 74 6.0E-07
sp|B6I5D7|ACPS_ECOSE Holo-[acyl-carrier-protein] synthase OS=Escherichia coli (strain SE11) GN=acpS PE=3 SV=1 11 74 6.0E-07
sp|B2TXX6|ACPS_SHIB3 Holo-[acyl-carrier-protein] synthase OS=Shigella boydii serotype 18 (strain CDC 3083-94 / BS512) GN=acpS PE=3 SV=1 11 74 6.0E-07
sp|Q0T1U2|ACPS_SHIF8 Holo-[acyl-carrier-protein] synthase OS=Shigella flexneri serotype 5b (strain 8401) GN=acpS PE=3 SV=1 11 74 6.0E-07
sp|Q83K24|ACPS_SHIFL Holo-[acyl-carrier-protein] synthase OS=Shigella flexneri GN=acpS PE=3 SV=1 11 74 6.0E-07
sp|Q3YYV3|ACPS_SHISS Holo-[acyl-carrier-protein] synthase OS=Shigella sonnei (strain Ss046) GN=acpS PE=3 SV=1 11 74 6.0E-07
sp|A3NBS5|ACPS_BURP6 Holo-[acyl-carrier-protein] synthase OS=Burkholderia pseudomallei (strain 668) GN=acpS PE=3 SV=1 12 135 6.0E-07
sp|C4ZYI6|ACPS_ECOBW Holo-[acyl-carrier-protein] synthase OS=Escherichia coli (strain K12 / MC4100 / BW2952) GN=acpS PE=3 SV=1 11 74 7.0E-07
sp|B1IVR4|ACPS_ECOLC Holo-[acyl-carrier-protein] synthase OS=Escherichia coli (strain ATCC 8739 / DSM 1576 / Crooks) GN=acpS PE=3 SV=1 11 74 7.0E-07
sp|P24224|ACPS_ECOLI Holo-[acyl-carrier-protein] synthase OS=Escherichia coli (strain K12) GN=acpS PE=1 SV=3 11 74 7.0E-07
sp|C5B8X8|ACPS_EDWI9 Holo-[acyl-carrier-protein] synthase OS=Edwardsiella ictaluri (strain 93-146) GN=acpS PE=3 SV=1 11 97 8.0E-07
sp|B2SZV1|ACPS_BURPP Holo-[acyl-carrier-protein] synthase OS=Burkholderia phytofirmans (strain DSM 17436 / PsJN) GN=acpS PE=3 SV=1 12 143 9.0E-07
sp|A4TKX4|ACPS_YERPP Holo-[acyl-carrier-protein] synthase OS=Yersinia pestis (strain Pestoides F) GN=acpS PE=3 SV=1 11 74 9.0E-07
sp|Q1CKE0|ACPS_YERPN Holo-[acyl-carrier-protein] synthase OS=Yersinia pestis bv. Antiqua (strain Nepal516) GN=acpS PE=3 SV=1 11 74 9.0E-07
sp|A9R406|ACPS_YERPG Holo-[acyl-carrier-protein] synthase OS=Yersinia pestis bv. Antiqua (strain Angola) GN=acpS PE=3 SV=1 11 74 9.0E-07
sp|Q8ZCP5|ACPS_YERPE Holo-[acyl-carrier-protein] synthase OS=Yersinia pestis GN=acpS PE=3 SV=1 11 74 9.0E-07
sp|Q1C5D9|ACPS_YERPA Holo-[acyl-carrier-protein] synthase OS=Yersinia pestis bv. Antiqua (strain Antiqua) GN=acpS PE=3 SV=1 11 74 9.0E-07
sp|B2KA43|ACPS_YERPB Holo-[acyl-carrier-protein] synthase OS=Yersinia pseudotuberculosis serotype IB (strain PB1/+) GN=acpS PE=3 SV=1 11 74 1.0E-06
sp|A7FFU3|ACPS_YERP3 Holo-[acyl-carrier-protein] synthase OS=Yersinia pseudotuberculosis serotype O:1b (strain IP 31758) GN=acpS PE=3 SV=1 11 74 1.0E-06
sp|Q667V4|ACPS_YERPS Holo-[acyl-carrier-protein] synthase OS=Yersinia pseudotuberculosis serotype I (strain IP32953) GN=acpS PE=3 SV=1 11 74 1.0E-06
sp|B1JRD1|ACPS_YERPY Holo-[acyl-carrier-protein] synthase OS=Yersinia pseudotuberculosis serotype O:3 (strain YPIII) GN=acpS PE=3 SV=1 11 74 1.0E-06
sp|A9MGY0|ACPS_SALAR Holo-[acyl-carrier-protein] synthase OS=Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980) GN=acpS PE=3 SV=1 11 74 1.0E-06
sp|A1JKK7|ACPS_YERE8 Holo-[acyl-carrier-protein] synthase OS=Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081) GN=acpS PE=3 SV=1 11 74 2.0E-06
sp|A9N1T5|ACPS_SALPB Holo-[acyl-carrier-protein] synthase OS=Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7) GN=acpS PE=3 SV=1 11 74 2.0E-06
sp|Q0K8N7|ACPS_CUPNH Holo-[acyl-carrier-protein] synthase OS=Cupriavidus necator (strain ATCC 17699 / H16 / DSM 428 / Stanier 337) GN=acpS PE=3 SV=1 9 134 3.0E-06
sp|B5F1F7|ACPS_SALA4 Holo-[acyl-carrier-protein] synthase OS=Salmonella agona (strain SL483) GN=acpS PE=3 SV=1 11 74 3.0E-06
sp|B5FRC1|ACPS_SALDC Holo-[acyl-carrier-protein] synthase OS=Salmonella dublin (strain CT_02021853) GN=acpS PE=3 SV=1 11 74 3.0E-06
sp|B5QTU4|ACPS_SALEP Holo-[acyl-carrier-protein] synthase OS=Salmonella enteritidis PT4 (strain P125109) GN=acpS PE=3 SV=1 11 74 3.0E-06
sp|B5RD45|ACPS_SALG2 Holo-[acyl-carrier-protein] synthase OS=Salmonella gallinarum (strain 287/91 / NCTC 13346) GN=acpS PE=3 SV=1 11 74 3.0E-06
sp|B4TE11|ACPS_SALHS Holo-[acyl-carrier-protein] synthase OS=Salmonella heidelberg (strain SL476) GN=acpS PE=3 SV=1 11 74 3.0E-06
sp|Q5PIJ4|ACPS_SALPA Holo-[acyl-carrier-protein] synthase OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=acpS PE=3 SV=1 11 74 3.0E-06
sp|B5BAT4|ACPS_SALPK Holo-[acyl-carrier-protein] synthase OS=Salmonella paratyphi A (strain AKU_12601) GN=acpS PE=3 SV=1 11 74 3.0E-06
sp|B4TS10|ACPS_SALSV Holo-[acyl-carrier-protein] synthase OS=Salmonella schwarzengrund (strain CVM19633) GN=acpS PE=3 SV=1 11 74 3.0E-06
sp|P63467|ACPS_SALTI Holo-[acyl-carrier-protein] synthase OS=Salmonella typhi GN=acpS PE=3 SV=2 11 74 3.0E-06
sp|P63466|ACPS_SALTY Holo-[acyl-carrier-protein] synthase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=acpS PE=3 SV=2 11 74 3.0E-06
sp|A6TCH7|ACPS_KLEP7 Holo-[acyl-carrier-protein] synthase OS=Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578) GN=acpS PE=3 SV=1 11 74 3.0E-06
sp|A4WDD4|ACPS_ENT38 Holo-[acyl-carrier-protein] synthase OS=Enterobacter sp. (strain 638) GN=acpS PE=3 SV=1 11 75 3.0E-06
sp|B8IZX1|ACPS_DESDA Holo-[acyl-carrier-protein] synthase OS=Desulfovibrio desulfuricans (strain ATCC 27774 / DSM 6949) GN=acpS PE=3 SV=1 9 135 3.0E-06
sp|A9ADD4|ACPS_BURM1 Holo-[acyl-carrier-protein] synthase OS=Burkholderia multivorans (strain ATCC 17616 / 249) GN=acpS PE=3 SV=1 12 136 3.0E-06
sp|Q2NS17|ACPS_SODGM Holo-[acyl-carrier-protein] synthase OS=Sodalis glossinidius (strain morsitans) GN=acpS PE=3 SV=1 11 74 3.0E-06
sp|A8AD21|ACPS_CITK8 Holo-[acyl-carrier-protein] synthase OS=Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696) GN=acpS PE=3 SV=1 11 74 4.0E-06
sp|B5XNH4|ACPS_KLEP3 Holo-[acyl-carrier-protein] synthase OS=Klebsiella pneumoniae (strain 342) GN=acpS PE=3 SV=1 11 74 4.0E-06
sp|B4T1F4|ACPS_SALNS Holo-[acyl-carrier-protein] synthase OS=Salmonella newport (strain SL254) GN=acpS PE=3 SV=1 11 74 4.0E-06
sp|Q46Z22|ACPS_CUPPJ Holo-[acyl-carrier-protein] synthase OS=Cupriavidus pinatubonensis (strain JMP 134 / LMG 1197) GN=acpS PE=3 SV=1 9 136 5.0E-06
sp|Q5P082|ACPS_AROAE Holo-[acyl-carrier-protein] synthase OS=Aromatoleum aromaticum (strain EbN1) GN=acpS PE=3 SV=1 12 132 6.0E-06
sp|Q39I69|ACPS_BURL3 Holo-[acyl-carrier-protein] synthase OS=Burkholderia lata (strain ATCC 17760 / LMG 22485 / NCIMB 9086 / R18194 / 383) GN=acpS PE=3 SV=1 11 134 6.0E-06
sp|Q2SXT0|ACPS_BURTA Holo-[acyl-carrier-protein] synthase OS=Burkholderia thailandensis (strain E264 / ATCC 700388 / DSM 13276 / CIP 106301) GN=acpS PE=3 SV=1 12 135 7.0E-06
sp|A5F5H4|ACPS_VIBC3 Holo-[acyl-carrier-protein] synthase OS=Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395) GN=acpS PE=3 SV=1 9 133 1.0E-05
[Show less]

GO

GO Term Description Terminal node
GO:0000287 magnesium ion binding Yes
GO:0008897 holo-[acyl-carrier-protein] synthase activity Yes
GO:0003824 catalytic activity No
GO:0046872 metal ion binding No
GO:0003674 molecular_function No
GO:0005488 binding No
GO:0016772 transferase activity, transferring phosphorus-containing groups No
GO:0016780 phosphotransferase activity, for other substituted phosphate groups No
GO:0016740 transferase activity No
GO:0043167 ion binding No
GO:0043169 cation binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 12 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|3561
MKPLRAFPLALGIGTDICQISRIHGILARGRGAGLVRRVLAPEERSGLVLEGEAWKTSVFLAGRFAAKEAAIKAH
HPHRRLTLHDVVIERQTQTLGSGPPVARIRSEDGGGSDEAALVSISHDGDYATAVCVCHAGTRDARNV*
Coding >OphauB2|3561
ATGAAGCCGCTGCGCGCATTCCCGCTCGCTCTAGGTATCGGCACGGATATATGTCAAATCTCGCGCATCCACGGC
ATACTAGCCCGCGGGCGAGGCGCAGGCTTGGTTCGGCGCGTGTTGGCGCCAGAGGAGAGGAGCGGTCTTGTCCTC
GAGGGCGAGGCGTGGAAGACGTCTGTTTTTCTAGCCGGAAGATTTGCAGCCAAGGAAGCAGCCATCAAGGCGCAT
CATCCGCATAGGCGCCTCACGCTGCACGATGTTGTGATTGAGCGGCAGACACAGACACTGGGTAGCGGGCCGCCA
GTGGCGCGGATTAGGAGCGAGGATGGGGGTGGGAGCGACGAGGCGGCGCTGGTGTCGATTAGCCATGATGGGGAT
TATGCTACGGCGGTGTGTGTGTGTCATGCTGGGACAAGGGATGCAAGAAATGTGTAA
Transcript >OphauB2|3561
ATGAAGCCGCTGCGCGCATTCCCGCTCGCTCTAGGTATCGGCACGGATATATGTCAAATCTCGCGCATCCACGGC
ATACTAGCCCGCGGGCGAGGCGCAGGCTTGGTTCGGCGCGTGTTGGCGCCAGAGGAGAGGAGCGGTCTTGTCCTC
GAGGGCGAGGCGTGGAAGACGTCTGTTTTTCTAGCCGGAAGATTTGCAGCCAAGGAAGCAGCCATCAAGGCGCAT
CATCCGCATAGGCGCCTCACGCTGCACGATGTTGTGATTGAGCGGCAGACACAGACACTGGGTAGCGGGCCGCCA
GTGGCGCGGATTAGGAGCGAGGATGGGGGTGGGAGCGACGAGGCGGCGCTGGTGTCGATTAGCCATGATGGGGAT
TATGCTACGGCGGTGTGTGTGTGTCATGCTGGGACAAGGGATGCAAGAAATGTGTAA
Gene >OphauB2|3561
ATGAAGCCGCTGCGCGCATTCCCGCTCGCTCTAGGTATCGGCACGGATATATGTCAAATCTCGCGCATCCACGGC
ATACTAGCCCGCGGGCGAGGCGCAGGCTTGGTTCGGCGCGTGTTGGCGCCAGAGGAGAGGAGCGGTCTTGTCCTC
GAGGGCGAGGCGTGGAAGACGTCTGTTTTTCTAGCCGGAAGGTAATATTCTTTCCTGTCTATGTTTATATACTCG
TCTACCCTTTTTTTTTAAAAAAACTCTTGGACATGTTGCATTGTTTCCTTTTTTTTTGCTCTACTTTAAACTCTT
GGACATGTTGCATTTTTTCCTTTTTTTTTTTTTGCTCTACTTTAAACTCTTGGACATGTTGCGTGTTTATATTTT
TGGCTAACCTTTTATACCCTTTGCCCACCGCCAACGGCAAAACGTTGCATGTCAGTCTATAGATTTGCAGCCAAG
GAAGCAGCCATCAAGGCGCATCATCCGCATAGGCGCCTCACGCTGCACGATGTTGTGATTGAGCGGCAGACACAG
ACACTGGGTAGCGGGCCGCCAGTGGCGCGGATTAGGAGCGAGGATGGGGGTGGGAGCGACGAGGCGGCGCTGGTG
TCGATTAGCCATGATGGGGATTATGCTACGGCGGTGTGTGTGTGTCATGCTGGGACAAGGGATGCAAGAAATGTG
TAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail