Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|3560
Gene name
LocationContig_228:877..1968
Strand+
Gene length (bp)1091
Transcript length (bp)864
Coding sequence length (bp)864
Protein length (aa) 288

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF08611 DUF1774 Fungal protein of unknown function (DUF1774) 1.7E-38 191 285

Swissprot hits

(None)

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 40 0.5

Transmembrane Domains

Domain # Start End Length
1 21 43 22
2 77 96 19
3 103 125 22
4 130 149 19
5 156 178 22
6 188 210 22
7 217 239 22
8 243 265 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|3560
MAQFHEYNPFVRREAHSTRSILMYKLLTVFSWLLSVVVSVYYTLHRPHDGVNARHRIWDQNYLYPSAFTMNSVMG
DIYWIVLFIMQAGYIAHLFSSKVENVQAAASVGSHFILNNLLHFAFVMLFVRSHFHWAEVILVVNFVNLSSLYFR
HHTYARFIHAPAVSGPLAWTFVAIYWNGALMVPHQHNLVARIFGNIFIWSILAYGLFFIFAYKDYTMGFALSVLS
AAIGVAQFTRQVIALQWIFAFVIMSVLFVMTLVVAVPAWSGREFNWRRPAAADQERAPLLTD*
Coding >OphauB2|3560
ATGGCGCAGTTTCATGAATATAACCCGTTTGTGAGGCGTGAGGCGCATAGCACGCGCTCGATTTTGATGTATAAG
CTGCTCACAGTCTTTTCGTGGCTGTTGTCGGTGGTGGTGTCGGTTTATTATACGCTGCATCGGCCTCATGATGGG
GTGAATGCGCGTCATCGCATCTGGGACCAGAATTATCTCTACCCGAGTGCCTTTACCATGAATAGTGTCATGGGC
GACATTTACTGGATCGTCCTCTTCATCATGCAGGCCGGCTACATTGCCCACCTCTTTTCCAGCAAGGTCGAAAAC
GTGCAAGCAGCCGCAAGCGTGGGCAGCCACTTTATCCTCAACAACTTGTTGCACTTTGCCTTTGTCATGCTCTTT
GTGCGCTCGCACTTCCACTGGGCAGAAGTGATTTTGGTGGTCAACTTTGTTAATCTGTCGTCGTTGTATTTTCGC
CATCATACGTATGCGCGCTTTATTCACGCGCCTGCCGTGTCGGGACCGCTGGCCTGGACTTTTGTCGCCATTTAC
TGGAATGGGGCGCTCATGGTGCCGCATCAGCACAACTTGGTGGCCAGGATTTTTGGCAACATTTTTATCTGGAGC
ATCTTGGCCTATGGCCTCTTTTTCATTTTTGCCTACAAGGACTACACCATGGGCTTTGCCCTCAGCGTCCTCTCG
GCAGCCATTGGTGTCGCGCAGTTTACGCGCCAGGTTATTGCCCTCCAGTGGATCTTTGCCTTTGTCATCATGTCC
GTCTTGTTTGTCATGACGCTCGTCGTGGCGGTGCCGGCGTGGTCGGGACGCGAGTTTAACTGGCGGCGTCCGGCC
GCCGCAGACCAGGAGCGGGCGCCCTTGCTGACTGACTAG
Transcript >OphauB2|3560
ATGGCGCAGTTTCATGAATATAACCCGTTTGTGAGGCGTGAGGCGCATAGCACGCGCTCGATTTTGATGTATAAG
CTGCTCACAGTCTTTTCGTGGCTGTTGTCGGTGGTGGTGTCGGTTTATTATACGCTGCATCGGCCTCATGATGGG
GTGAATGCGCGTCATCGCATCTGGGACCAGAATTATCTCTACCCGAGTGCCTTTACCATGAATAGTGTCATGGGC
GACATTTACTGGATCGTCCTCTTCATCATGCAGGCCGGCTACATTGCCCACCTCTTTTCCAGCAAGGTCGAAAAC
GTGCAAGCAGCCGCAAGCGTGGGCAGCCACTTTATCCTCAACAACTTGTTGCACTTTGCCTTTGTCATGCTCTTT
GTGCGCTCGCACTTCCACTGGGCAGAAGTGATTTTGGTGGTCAACTTTGTTAATCTGTCGTCGTTGTATTTTCGC
CATCATACGTATGCGCGCTTTATTCACGCGCCTGCCGTGTCGGGACCGCTGGCCTGGACTTTTGTCGCCATTTAC
TGGAATGGGGCGCTCATGGTGCCGCATCAGCACAACTTGGTGGCCAGGATTTTTGGCAACATTTTTATCTGGAGC
ATCTTGGCCTATGGCCTCTTTTTCATTTTTGCCTACAAGGACTACACCATGGGCTTTGCCCTCAGCGTCCTCTCG
GCAGCCATTGGTGTCGCGCAGTTTACGCGCCAGGTTATTGCCCTCCAGTGGATCTTTGCCTTTGTCATCATGTCC
GTCTTGTTTGTCATGACGCTCGTCGTGGCGGTGCCGGCGTGGTCGGGACGCGAGTTTAACTGGCGGCGTCCGGCC
GCCGCAGACCAGGAGCGGGCGCCCTTGCTGACTGACTAG
Gene >OphauB2|3560
ATGGCGCAGTTTCATGAATGTGAGTTTTTTTTTTAAATCTTTGAGAGGGGAGAGGAGGAATTGGGGAGCTGATTT
GGGGGATAGATAACCCGTTTGTGAGGCGTGAGGCGCATAGCACGCGCTCGATTTTGATGTATAAGCTGCTCACAG
TCTTTTCGTGGCTGTTGTCGGTGGTGGTGTCGGTTTATTATACGCTGCATCGGCCTCATGATGGGGTGAATGCGC
GTCATCGCATCTGGGACCAGAATTATCTCTACCCGAGTGCCTTTACCATGAATAGTGTCATGGGCGACATTTACT
GGTTTGTTTTTTTTCCTCCTTGCTTCTTCTCCGTCTTGGAACTTTTTTGGACCATGCTGACGTCTGTTTGCCACA
GGATCGTCCTCTTCATCATGCAGGCCGGCTACATTGCCCACCTCTTTTCCAGCAAGGTCGAAAACGTGCAAGCAG
CCGCAAGCGTGGGCAGCCACTTTATCCTCAACAACTTGTTGCACTTTGCCTTTGTCATGCTCTTTGTGCGCTCGC
ACTTCCACTGGGCAGAAGTGATTTTGGTGGTCAACTTTGTTAATCTGTCGTCGTTGTATTTTCGCCATCATACGT
ATGCGCGCTTTATTCACGCGCCTGCCGTGTCGGGACCGCTGGCCTGGACTTTTGTCGCCATTTACTGGAATGGGG
CGCTCATGGTGCCGCATCAGCACAACTTGGTGGCCAGGATTTTTGGCAACATTTTTATCTGGAGCATCTTGGCCT
ATGGCCTCTTTTTCATTTTTGCCTACAAGGTATGCCCCCCGGGTTTCCATCTATCCCGAAAAAGACTTGGAACTT
GCTGCTTTGAAAGAATTGGGAGTGGCTAACAAGGTCTACAGGACTACACCATGGGCTTTGCCCTCAGCGTCCTCT
CGGCAGCCATTGGTGTCGCGCAGTTTACGCGCCAGGTTATTGCCCTCCAGTGGATCTTTGCCTTTGTCATCATGT
CCGTCTTGTTTGTCATGACGCTCGTCGTGGCGGTGCCGGCGTGGTCGGGACGCGAGTTTAACTGGCGGCGTCCGG
CCGCCGCAGACCAGGAGCGGGCGCCCTTGCTGACTGACTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail