Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|3549
Gene name
LocationContig_225:13429..14912
Strand-
Gene length (bp)1483
Transcript length (bp)1371
Coding sequence length (bp)1371
Protein length (aa) 457

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF09668 Asp_protease Aspartyl protease 1.3E-60 200 323
PF13975 gag-asp_proteas gag-polyprotein putative aspartyl protease 6.8E-24 226 317
PF13650 Asp_protease_2 Aspartyl protease 4.5E-12 226 313
PF00240 ubiquitin Ubiquitin family 4.2E-08 19 83
PF00627 UBA UBA/TS-N domain 9.4E-06 420 453
PF08284 RVP_2 Retroviral aspartyl protease 5.7E-05 225 332
PF00077 RVP Retroviral aspartyl protease 1.2E-04 226 322

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q7S906|DDI1_NEUCR DNA damage-inducible protein 1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=ddi-1 PE=3 SV=2 5 455 1.0E-161
sp|Q2H085|DDI1_CHAGB DNA damage-inducible protein 1 OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=DDI1 PE=3 SV=2 5 455 7.0E-161
sp|Q0U3Y6|DDI1_PHANO DNA damage-inducible protein 1 OS=Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) GN=DDI1 PE=3 SV=2 5 455 7.0E-127
sp|Q2USD7|DDI1_ASPOR DNA damage-inducible protein 1 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=ddi1 PE=3 SV=2 30 455 3.0E-126
sp|A1DCU5|DDI1_NEOFI DNA damage-inducible protein 1 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=ddi1 PE=3 SV=1 30 455 4.0E-125
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q7S906|DDI1_NEUCR DNA damage-inducible protein 1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=ddi-1 PE=3 SV=2 5 455 1.0E-161
sp|Q2H085|DDI1_CHAGB DNA damage-inducible protein 1 OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=DDI1 PE=3 SV=2 5 455 7.0E-161
sp|Q0U3Y6|DDI1_PHANO DNA damage-inducible protein 1 OS=Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) GN=DDI1 PE=3 SV=2 5 455 7.0E-127
sp|Q2USD7|DDI1_ASPOR DNA damage-inducible protein 1 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=ddi1 PE=3 SV=2 30 455 3.0E-126
sp|A1DCU5|DDI1_NEOFI DNA damage-inducible protein 1 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=ddi1 PE=3 SV=1 30 455 4.0E-125
sp|Q4WGS4|DDI1_ASPFU DNA damage-inducible protein 1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=ddi1 PE=3 SV=1 30 455 9.0E-124
sp|Q5AY89|DDI1_EMENI DNA damage-inducible protein 1 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=ddi1 PE=3 SV=2 30 455 4.0E-122
sp|Q0CJ13|DDI1_ASPTN DNA damage-inducible protein 1 OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=ddi1 PE=3 SV=1 30 455 5.0E-122
sp|A1CDT9|DDI1_ASPCL DNA damage-inducible protein 1 OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=ddi1 PE=3 SV=1 30 455 1.0E-119
sp|Q1DNB9|DDI1_COCIM DNA damage-inducible protein 1 OS=Coccidioides immitis (strain RS) GN=DDI1 PE=3 SV=3 19 455 2.0E-119
sp|P0CS14|DDI1_CRYNJ DNA damage-inducible protein 1 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=DDI1 PE=3 SV=1 19 455 6.0E-107
sp|P0CS15|DDI1_CRYNB DNA damage-inducible protein 1 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=DDI1 PE=3 SV=1 19 455 6.0E-107
sp|Q10256|MUD1_SCHPO UBA domain-containing protein mud1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mud1 PE=1 SV=1 122 455 4.0E-85
sp|Q5TDH0|DDI2_HUMAN Protein DDI1 homolog 2 OS=Homo sapiens GN=DDI2 PE=1 SV=1 6 346 7.0E-76
sp|Q6TH22|DDI2_DANRE Protein DDI1 homolog 2 OS=Danio rerio GN=ddi2 PE=2 SV=1 6 355 1.0E-74
sp|A2ADY9|DDI2_MOUSE Protein DDI1 homolog 2 OS=Mus musculus GN=Ddi2 PE=1 SV=1 6 346 4.0E-74
sp|Q497D6|DDI2_XENTR Protein DDI1 homolog 2 OS=Xenopus tropicalis GN=ddi2 PE=2 SV=1 22 346 2.0E-72
sp|Q7ZYA7|DDI2_XENLA Protein DDI1 homolog 2 OS=Xenopus laevis GN=ddi2 PE=2 SV=1 22 346 3.0E-72
sp|Q6BK42|DDI1_DEBHA DNA damage-inducible protein 1 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=DDI1 PE=3 SV=2 16 455 8.0E-71
sp|Q6CFI3|DDI1_YARLI DNA damage-inducible protein 1 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=DDI1 PE=3 SV=1 19 455 3.0E-70
sp|Q2T9Z1|DDI1_BOVIN Protein DDI1 homolog 1 OS=Bos taurus GN=DDI1 PE=2 SV=1 6 345 5.0E-69
sp|A0JPP7|DDI1_RAT Protein DDI1 homolog 1 OS=Rattus norvegicus GN=Ddi1 PE=1 SV=1 22 345 1.0E-68
sp|Q6FQE9|DDI1_CANGA DNA damage-inducible protein 1 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=DDI1 PE=3 SV=1 24 455 8.0E-68
sp|Q8WTU0|DDI1_HUMAN Protein DDI1 homolog 1 OS=Homo sapiens GN=DDI1 PE=1 SV=1 22 345 1.0E-67
sp|Q9DAF3|DDI1_MOUSE Protein DDI1 homolog 1 OS=Mus musculus GN=Ddi1 PE=1 SV=1 22 345 1.0E-67
sp|Q95JI3|DDI1_MACFA Protein DDI1 homolog 1 OS=Macaca fascicularis GN=DDI1 PE=2 SV=1 6 345 8.0E-67
sp|Q6CNS3|DDI1_KLULA DNA damage-inducible protein 1 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=DDI1 PE=3 SV=1 8 455 1.0E-62
sp|P40087|DDI1_YEAST DNA damage-inducible protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DDI1 PE=1 SV=1 24 455 7.0E-62
sp|Q754R2|DDI1_ASHGO DNA damage-inducible protein 1 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=DDI1 PE=3 SV=1 123 455 1.0E-58
sp|Q54JB0|DDI1_DICDI Protein DDI1 homolog OS=Dictyostelium discoideum GN=ddi1 PE=3 SV=1 17 455 7.0E-57
sp|Q9JJR9|NRIP3_MOUSE Nuclear receptor-interacting protein 3 OS=Mus musculus GN=Nrip3 PE=1 SV=1 223 339 2.0E-10
sp|Q9NQ35|NRIP3_HUMAN Nuclear receptor-interacting protein 3 OS=Homo sapiens GN=NRIP3 PE=1 SV=1 223 339 7.0E-09
sp|Q5R7G1|NRIP3_PONAB Nuclear receptor-interacting protein 3 OS=Pongo abelii GN=NRIP3 PE=2 SV=1 223 339 1.0E-07
[Show less]

GO

GO Term Description Terminal node
GO:0005515 protein binding Yes
GO:0004190 aspartic-type endopeptidase activity Yes
GO:0006508 proteolysis Yes
GO:0070001 aspartic-type peptidase activity No
GO:0043170 macromolecule metabolic process No
GO:0005488 binding No
GO:0008233 peptidase activity No
GO:0008150 biological_process No
GO:0016787 hydrolase activity No
GO:0003674 molecular_function No
GO:0140096 catalytic activity, acting on a protein No
GO:1901564 organonitrogen compound metabolic process No
GO:0006807 nitrogen compound metabolic process No
GO:0003824 catalytic activity No
GO:0071704 organic substance metabolic process No
GO:0008152 metabolic process No
GO:0044238 primary metabolic process No
GO:0004175 endopeptidase activity No
GO:0019538 protein metabolic process No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup6380
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|6112
Ophiocordyceps australis map64 (Brazil) OphauB2|3549 (this protein)
Ophiocordyceps camponoti-floridani Ophcf2|04168
Ophiocordyceps camponoti-rufipedis Ophun1|1230
Ophiocordyceps kimflemingae Ophio5|6249

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|3549
MYVTRITLNIFNPQAEDQDSLINLEIFPEMTLATLRESIHAEAKIPSSSQHIYHNGRLVSDDSKTMEQLQMADGD
MLAVHVRQPRDQATSSRQLQASAPIPTSASASTFPQPRRSQNGENDPELLRLQLLGDPGLRQQLQQQHPELAAAV
DDASRFSRILYQSQDRERRERLERQREIERLNDDPFNIENQRKIEDMIRQERVMENLQNAMEHTPEVFGRVHMLY
VNVEVNGHKVKAFVDSGAQATIISPSCAETCGIMRLVDTRFAGVARGVGTANIIGRVHSAQIKIGSLHLPCSFTV
MEGKTTDLLLGLDMLKRYQATIDLARDRLIIQGEEVPFLAEADIPKGEEAAQAQEPTIPGPAGTAIGQRSGVVLP
PEHAQHSQAPGNLQPGPVVSSHAPTLTSRDPSAVPQAAAESEVTPAHVDSLIAMGATRVQAVQALKAADDNVDVA
ASLIFF*
Coding >OphauB2|3549
ATGTACGTGACGCGCATCACACTCAATATTTTCAATCCTCAGGCCGAGGATCAAGATAGCCTCATCAATCTCGAG
ATCTTTCCCGAAATGACGCTTGCAACACTGCGCGAATCTATTCATGCTGAAGCCAAAATCCCCTCCTCCTCCCAG
CACATCTACCACAATGGTCGGCTGGTATCCGATGATTCCAAGACTATGGAGCAGCTACAAATGGCCGACGGTGAC
ATGCTTGCTGTTCATGTAAGGCAGCCGCGCGACCAAGCGACCTCGTCACGGCAGCTCCAGGCCTCCGCTCCCATT
CCCACCTCAGCCTCAGCCTCCACTTTTCCACAGCCGCGGCGATCTCAGAACGGTGAAAATGACCCTGAATTGCTG
CGGCTTCAACTGCTTGGGGATCCTGGCCTTAGACAGCAGCTCCAGCAGCAACATCCTGAGCTTGCTGCTGCTGTC
GATGATGCCTCGCGCTTCTCGCGCATCCTTTATCAATCCCAGGATCGCGAGCGCCGCGAGCGCCTTGAGAGGCAA
CGAGAAATCGAGAGACTTAATGATGACCCGTTCAATATTGAAAACCAGAGAAAAATCGAAGATATGATACGTCAG
GAACGTGTCATGGAAAACCTGCAGAATGCTATGGAGCACACCCCTGAAGTTTTTGGGCGAGTCCATATGCTTTAC
GTCAACGTCGAAGTTAATGGCCACAAGGTTAAAGCATTCGTCGACTCGGGCGCCCAGGCCACGATCATATCACCC
TCGTGTGCCGAGACCTGCGGAATTATGAGACTTGTTGACACGCGATTTGCCGGAGTTGCTCGGGGCGTCGGCACC
GCAAACATCATAGGTCGTGTCCACTCGGCCCAAATCAAGATTGGGAGCTTGCATCTACCTTGCAGTTTCACCGTC
ATGGAGGGCAAGACAACCGACCTACTGCTCGGCCTTGATATGCTCAAGCGTTACCAGGCCACGATTGATCTGGCA
AGAGACCGGCTCATCATCCAAGGAGAAGAGGTGCCGTTTTTAGCAGAGGCCGATATTCCCAAAGGGGAGGAGGCT
GCACAGGCCCAAGAGCCTACCATACCTGGTCCAGCAGGCACTGCCATTGGCCAGCGGTCTGGAGTTGTACTGCCA
CCTGAGCACGCCCAGCACTCACAGGCTCCAGGAAATCTGCAACCTGGACCTGTTGTTTCATCGCACGCCCCAACA
CTAACATCTCGAGATCCATCCGCAGTCCCGCAAGCAGCTGCAGAATCCGAGGTAACACCAGCCCACGTAGACAGC
CTCATTGCCATGGGCGCCACAAGGGTGCAGGCTGTGCAAGCTCTCAAAGCAGCTGATGACAACGTCGATGTGGCA
GCCAGCCTTATCTTCTTTTGA
Transcript >OphauB2|3549
ATGTACGTGACGCGCATCACACTCAATATTTTCAATCCTCAGGCCGAGGATCAAGATAGCCTCATCAATCTCGAG
ATCTTTCCCGAAATGACGCTTGCAACACTGCGCGAATCTATTCATGCTGAAGCCAAAATCCCCTCCTCCTCCCAG
CACATCTACCACAATGGTCGGCTGGTATCCGATGATTCCAAGACTATGGAGCAGCTACAAATGGCCGACGGTGAC
ATGCTTGCTGTTCATGTAAGGCAGCCGCGCGACCAAGCGACCTCGTCACGGCAGCTCCAGGCCTCCGCTCCCATT
CCCACCTCAGCCTCAGCCTCCACTTTTCCACAGCCGCGGCGATCTCAGAACGGTGAAAATGACCCTGAATTGCTG
CGGCTTCAACTGCTTGGGGATCCTGGCCTTAGACAGCAGCTCCAGCAGCAACATCCTGAGCTTGCTGCTGCTGTC
GATGATGCCTCGCGCTTCTCGCGCATCCTTTATCAATCCCAGGATCGCGAGCGCCGCGAGCGCCTTGAGAGGCAA
CGAGAAATCGAGAGACTTAATGATGACCCGTTCAATATTGAAAACCAGAGAAAAATCGAAGATATGATACGTCAG
GAACGTGTCATGGAAAACCTGCAGAATGCTATGGAGCACACCCCTGAAGTTTTTGGGCGAGTCCATATGCTTTAC
GTCAACGTCGAAGTTAATGGCCACAAGGTTAAAGCATTCGTCGACTCGGGCGCCCAGGCCACGATCATATCACCC
TCGTGTGCCGAGACCTGCGGAATTATGAGACTTGTTGACACGCGATTTGCCGGAGTTGCTCGGGGCGTCGGCACC
GCAAACATCATAGGTCGTGTCCACTCGGCCCAAATCAAGATTGGGAGCTTGCATCTACCTTGCAGTTTCACCGTC
ATGGAGGGCAAGACAACCGACCTACTGCTCGGCCTTGATATGCTCAAGCGTTACCAGGCCACGATTGATCTGGCA
AGAGACCGGCTCATCATCCAAGGAGAAGAGGTGCCGTTTTTAGCAGAGGCCGATATTCCCAAAGGGGAGGAGGCT
GCACAGGCCCAAGAGCCTACCATACCTGGTCCAGCAGGCACTGCCATTGGCCAGCGGTCTGGAGTTGTACTGCCA
CCTGAGCACGCCCAGCACTCACAGGCTCCAGGAAATCTGCAACCTGGACCTGTTGTTTCATCGCACGCCCCAACA
CTAACATCTCGAGATCCATCCGCAGTCCCGCAAGCAGCTGCAGAATCCGAGGTAACACCAGCCCACGTAGACAGC
CTCATTGCCATGGGCGCCACAAGGGTGCAGGCTGTGCAAGCTCTCAAAGCAGCTGATGACAACGTCGATGTGGCA
GCCAGCCTTATCTTCTTTTGA
Gene >OphauB2|3549
ATGTACGTGACGTCCAAGAGCTCTGAAGCAGGCTCAAGGCCAGTCCTAATTTACTGTCAACAGGCGCATCACACT
CAATATTTTCAATCCTCAGGCCGAGGATCAAGATAGCCTCATCAATCTCGAGATCTTTCCCGAAATGACGCTTGC
AACACTGCGCGAATCTATTCATGCTGAAGCCAAAATCCCCTCCTCCTCCCAGCACATCTACCACAATGGTCGGCT
GGTATCCGATGATTCCAAGACTATGGAGCAGCTACAAATGGCCGACGGTGACATGCTTGCTGTTCATGTAAGGCA
GCCGCGCGACCAAGCGACCTCGTCACGGCAGCTCCAGGCCTCCGCTCCCATTCCCACCTCAGCCTCAGCCTCCAC
TTTTCCACAGCCGCGGCGATCTCAGAACGGTGAAAATGACCCTGAATTGCTGCGGCTTCAACTGCTTGGGGATCC
TGGCCTTAGACAGCAGCTCCAGCAGCAACATCCTGAGCTTGCTGCTGCTGTCGATGATGCCTCGCGCTTCTCGCG
CATCCTTTATCAATCCCAGGATCGCGAGCGCCGCGAGCGCCTTGAGAGGCAACGAGAAATCGAGAGACTTAATGA
TGACCCGTTCAATATTGAAAACCAGAGAAAAATCGAAGATATGATACGTCAGGAACGTGTCATGGAAAACCTGCA
GAATGCTATGGAGCACACCCCTGAAGGTCGCATATCCCGTTCTTCCACCTCAAATTCGTATAAGCCAGCTTACAC
TACTCTCTCAGTTTTTGGGCGAGTCCATATGCTTTACGTCAACGTCGAAGTTAATGGCCACAAGGTTAAAGCATT
CGTCGACTCGGGCGCCCAGGCCACGATCATATCACCCTCGTGTGCCGAGACCTGCGGAATTATGAGACTTGTTGA
CACGCGATTTGCCGGAGTTGCTCGGGGCGTCGGCACCGCAAACATCATAGGTCGTGTCCACTCGGCCCAAATCAA
GATTGGGAGCTTGCATCTACCTTGCAGTTTCACCGTCATGGAGGGCAAGACAACCGACCTACTGCTCGGCCTTGA
TATGCTCAAGCGTTACCAGGCCACGATTGATCTGGCAAGAGACCGGCTCATCATCCAAGGAGAAGAGGTGCCGTT
TTTAGCAGAGGCCGATATTCCCAAAGGGGAGGAGGCTGCACAGGCCCAAGAGCCTACCATACCTGGTCCAGCAGG
CACTGCCATTGGCCAGCGGTCTGGAGTTGTACTGCCACCTGAGCACGCCCAGCACTCACAGGCTCCAGGAAATCT
GCAACCTGGACCTGTTGTTTCATCGCACGCCCCAACACTAACATCTCGAGATCCATCCGCAGTCCCGCAAGCAGC
TGCAGAATCCGAGGTAACACCAGCCCACGTAGACAGCCTCATTGCCATGGGCGCCACAAGGGTGCAGGCTGTGCA
AGCTCTCAAAGCAGCTGATGACAACGTCGATGTGGCAGCCAGCCTTATCTTCTTTTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail