Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|3534
Gene name
LocationContig_223:20183..22193
Strand+
Gene length (bp)2010
Transcript length (bp)1674
Coding sequence length (bp)1674
Protein length (aa) 558

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01591 6PF2K 6-phosphofructo-2-kinase 3.4E-57 44 264
PF00300 His_Phos_1 Histidine phosphatase superfamily (branch 1) 1.6E-21 269 458

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q06137|YL345_YEAST Putative 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase YLR345W OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YLR345W PE=1 SV=1 24 472 2.0E-109
sp|P16118|F261_HUMAN 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase 1 OS=Homo sapiens GN=PFKFB1 PE=1 SV=3 50 471 1.0E-80
sp|O35552|F263_RAT 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase 3 OS=Rattus norvegicus GN=Pfkfb3 PE=2 SV=1 56 471 2.0E-80
sp|Q16875|F263_HUMAN 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase 3 OS=Homo sapiens GN=PFKFB3 PE=1 SV=1 56 471 3.0E-80
sp|Q5R9C1|F263_PONAB 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase 3 OS=Pongo abelii GN=PFKFB3 PE=2 SV=2 56 471 4.0E-80
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q06137|YL345_YEAST Putative 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase YLR345W OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YLR345W PE=1 SV=1 24 472 2.0E-109
sp|P16118|F261_HUMAN 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase 1 OS=Homo sapiens GN=PFKFB1 PE=1 SV=3 50 471 1.0E-80
sp|O35552|F263_RAT 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase 3 OS=Rattus norvegicus GN=Pfkfb3 PE=2 SV=1 56 471 2.0E-80
sp|Q16875|F263_HUMAN 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase 3 OS=Homo sapiens GN=PFKFB3 PE=1 SV=1 56 471 3.0E-80
sp|Q5R9C1|F263_PONAB 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase 3 OS=Pongo abelii GN=PFKFB3 PE=2 SV=2 56 471 4.0E-80
sp|Q91348|F26L_CHICK 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase OS=Gallus gallus PE=2 SV=2 50 471 1.0E-79
sp|P49872|F261_BOVIN 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase 1 OS=Bos taurus GN=PFKFB1 PE=2 SV=1 50 471 4.0E-79
sp|P07953|F261_RAT 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase 1 OS=Rattus norvegicus GN=Pfkfb1 PE=1 SV=3 50 471 7.0E-79
sp|P70266|F261_MOUSE 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase 1 OS=Mus musculus GN=Pfkfb1 PE=1 SV=2 50 471 3.0E-78
sp|O60825|F262_HUMAN 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase 2 OS=Homo sapiens GN=PFKFB2 PE=1 SV=2 57 471 2.0E-77
sp|Q5NVT1|F262_PONAB 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase 2 OS=Pongo abelii GN=PFKFB2 PE=2 SV=1 57 471 6.0E-77
sp|Q16877|F264_HUMAN 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase 4 OS=Homo sapiens GN=PFKFB4 PE=2 SV=6 41 471 7.0E-77
sp|Q4R8B6|F264_MACFA 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase 4 OS=Macaca fascicularis GN=PFKFB4 PE=2 SV=3 41 471 9.0E-77
sp|Q28901|F263_BOVIN 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase 3 (Fragment) OS=Bos taurus GN=PFKFB3 PE=2 SV=2 56 471 1.0E-76
sp|P26285|F262_BOVIN 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase 2 OS=Bos taurus GN=PFKFB2 PE=1 SV=2 57 471 4.0E-76
sp|P32604|F26_YEAST Fructose-2,6-bisphosphatase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=FBP26 PE=1 SV=2 42 483 1.0E-75
sp|P70265|F262_MOUSE 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase 2 OS=Mus musculus GN=Pfkfb2 PE=1 SV=2 57 471 2.0E-75
sp|Q9JJH5|F262_RAT 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase 2 OS=Rattus norvegicus GN=Pfkfb2 PE=1 SV=1 57 471 2.0E-75
sp|Q6DTY7|F264_MOUSE 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase 4 OS=Mus musculus GN=Pfkfb4 PE=2 SV=4 41 471 3.0E-75
sp|P25114|F264_RAT 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase 4 OS=Rattus norvegicus GN=Pfkfb4 PE=1 SV=3 41 471 3.0E-75
sp|Q91309|F26_LITCT 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase OS=Lithobates catesbeiana PE=2 SV=1 50 471 5.0E-75
sp|Q21122|F2612_CAEEL 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase OS=Caenorhabditis elegans GN=pfkb-1.2 PE=3 SV=2 57 466 3.0E-74
sp|Q9MB58|F26_ARATH 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase OS=Arabidopsis thaliana GN=FKFBP PE=1 SV=1 55 457 1.0E-68
sp|Q9UTK9|YIVH_SCHPO Putative 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase C144.17c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC144.17c PE=1 SV=2 33 461 2.0E-58
sp|Q8TFH0|YIKE_SCHPO Probable 6-phosphofructo-2-kinase PB17E12.14c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAPB17E12.14c PE=1 SV=2 54 462 3.0E-58
sp|P40433|6P21_YEAST 6-phosphofructo-2-kinase 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PFK26 PE=1 SV=1 54 462 2.0E-52
sp|Q9UTE1|YFMD_SCHPO Probable 6-phosphofructo-2-kinase C222.13c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC222.13c PE=3 SV=1 54 450 2.0E-52
sp|Q9URZ7|YK72_SCHPO Probable fructose-2,6-bisphosphatase C732.02c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC732.02c PE=3 SV=1 55 472 6.0E-49
[Show less]

GO

GO Term Description Terminal node
GO:0003873 6-phosphofructo-2-kinase activity Yes
GO:0006000 fructose metabolic process Yes
GO:0005524 ATP binding Yes
GO:0003674 molecular_function No
GO:0017076 purine nucleotide binding No
GO:0003824 catalytic activity No
GO:0097367 carbohydrate derivative binding No
GO:0032553 ribonucleotide binding No
GO:0016301 kinase activity No
GO:0043167 ion binding No
GO:0000166 nucleotide binding No
GO:0035639 purine ribonucleoside triphosphate binding No
GO:0097159 organic cyclic compound binding No
GO:0005488 binding No
GO:0008150 biological_process No
GO:0005975 carbohydrate metabolic process No
GO:0016772 transferase activity, transferring phosphorus-containing groups No
GO:0016773 phosphotransferase activity, alcohol group as acceptor No
GO:0008443 phosphofructokinase activity No
GO:0043168 anion binding No
GO:1901265 nucleoside phosphate binding No
GO:0032555 purine ribonucleotide binding No
GO:1901363 heterocyclic compound binding No
GO:0044281 small molecule metabolic process No
GO:0071704 organic substance metabolic process No
GO:0032559 adenyl ribonucleotide binding No
GO:0036094 small molecule binding No
GO:0008152 metabolic process No
GO:0005996 monosaccharide metabolic process No
GO:0044238 primary metabolic process No
GO:0019318 hexose metabolic process No
GO:0030554 adenyl nucleotide binding No
GO:0016740 transferase activity No
GO:0019200 carbohydrate kinase activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 22 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|3534
MDTLLTAEIAANAPRYRRKSSTFIDGIHDEPSDQDMAPAQLYSTMSGRLFHSGRIAIIMVGPPARGKTHICVSLA
RYLQWLGVKTRIFHLGDYRRATVGPGGSVPEDYFFPNASPASVILRQKILKKCREDIYAWLNHENGQVAIYDAVN
PTASARRSLAKELGKHDVQTLYIESYVDDERILRENARNVKISSPDFAGMDPDEAAKLYLKRIEMRIPMFETMNE
GELNYIKMINAGAKFFYNNVSFNYLSHRIVFYLTNLHIKSRTTFFVRAGTTEEEDSYKADAPLSEQGRIYAEKMS
ETLLKHREQEQAEKMERGGPQVPLRPLTVWTSTRRRTVQTADYLKSKGYKVRQRSQMSQINPGVCENMSERVIRH
IYPEEVEKHELDPYHHRYPRAESYHDLAVRLEPIILELEREQNDLLIIAHESVLRVLYAYLMHCSTMEIPNLRFP
RDEIIEIIPAAYQNEAKRIHIPGLLPEMLPGSSDYVQTPSAAGGGANVSASGGVGGGVNASNSLPGSGSMSPIPG
GMSSPAVPVERPPEKVINTSKDLVADKVDDED*
Coding >OphauB2|3534
ATGGACACTCTGCTGACTGCCGAAATCGCGGCCAATGCCCCCCGGTATCGACGCAAGAGCTCGACTTTTATTGAC
GGCATTCATGATGAGCCCAGTGATCAAGACATGGCCCCCGCACAGCTCTACAGCACCATGTCAGGCCGGCTGTTT
CACTCTGGTCGCATAGCCATTATCATGGTTGGGCCGCCGGCAAGAGGCAAGACCCACATCTGTGTGTCGCTGGCC
AGATACCTGCAATGGCTCGGTGTCAAGACGCGCATTTTCCACTTGGGAGACTACCGACGAGCTACCGTTGGCCCC
GGAGGCTCTGTTCCTGAAGACTACTTTTTCCCCAACGCTTCACCAGCTTCCGTCATATTGCGGCAAAAGATTCTC
AAGAAGTGCCGCGAGGACATCTATGCATGGCTGAATCACGAAAACGGCCAAGTTGCCATTTATGACGCAGTCAAT
CCCACTGCAAGCGCCAGGCGCTCTTTGGCCAAGGAGCTGGGCAAGCATGATGTGCAAACACTGTACATTGAGTCG
TACGTTGATGACGAGCGCATCTTGCGGGAAAATGCAAGAAATGTCAAGATATCCTCACCCGATTTTGCCGGCATG
GACCCCGACGAGGCCGCCAAGCTGTACTTGAAACGCATCGAGATGAGGATTCCCATGTTTGAGACGATGAATGAG
GGCGAACTCAACTACATCAAAATGATTAATGCCGGAGCAAAGTTCTTTTACAACAATGTTAGCTTTAATTACCTT
TCTCACCGCATCGTCTTTTACCTCACCAATCTGCACATCAAGTCGCGCACCACCTTCTTCGTCCGCGCCGGAACG
ACGGAAGAGGAAGATTCATACAAGGCCGACGCTCCGCTCTCTGAGCAGGGCCGCATCTATGCCGAGAAGATGTCG
GAGACACTACTCAAGCACCGTGAACAAGAGCAGGCGGAGAAGATGGAAAGGGGCGGTCCCCAAGTTCCACTACGG
CCCTTGACTGTGTGGACGTCGACTCGACGTAGAACTGTCCAGACGGCGGATTACCTAAAGTCAAAGGGGTACAAG
GTTCGGCAGCGGTCGCAGATGAGCCAGATTAACCCAGGCGTCTGCGAAAACATGTCTGAACGCGTCATTCGTCAT
ATATATCCCGAGGAGGTGGAGAAGCACGAGCTGGATCCATATCATCACAGATATCCGCGTGCAGAGTCGTACCAC
GACCTTGCCGTGCGTTTGGAACCTATAATTCTCGAGCTCGAACGTGAGCAAAACGACTTGCTCATAATTGCCCAC
GAGTCTGTGCTGCGCGTTCTCTACGCCTACCTGATGCACTGCTCCACCATGGAGATCCCCAACCTTAGATTTCCG
CGAGATGAAATCATTGAAATTATTCCTGCCGCCTACCAGAATGAAGCCAAGCGCATCCACATTCCTGGTCTTTTA
CCTGAGATGCTCCCTGGCTCATCCGACTATGTCCAGACTCCATCGGCCGCTGGTGGCGGCGCCAATGTCTCGGCC
AGTGGCGGCGTTGGCGGCGGCGTCAATGCCAGCAACAGCCTCCCCGGGAGTGGCTCCATGAGTCCAATACCTGGT
GGCATGAGCAGTCCTGCTGTGCCAGTTGAGCGACCTCCTGAAAAAGTCATCAACACATCAAAGGATCTGGTTGCC
GACAAGGTAGACGACGAGGATTAG
Transcript >OphauB2|3534
ATGGACACTCTGCTGACTGCCGAAATCGCGGCCAATGCCCCCCGGTATCGACGCAAGAGCTCGACTTTTATTGAC
GGCATTCATGATGAGCCCAGTGATCAAGACATGGCCCCCGCACAGCTCTACAGCACCATGTCAGGCCGGCTGTTT
CACTCTGGTCGCATAGCCATTATCATGGTTGGGCCGCCGGCAAGAGGCAAGACCCACATCTGTGTGTCGCTGGCC
AGATACCTGCAATGGCTCGGTGTCAAGACGCGCATTTTCCACTTGGGAGACTACCGACGAGCTACCGTTGGCCCC
GGAGGCTCTGTTCCTGAAGACTACTTTTTCCCCAACGCTTCACCAGCTTCCGTCATATTGCGGCAAAAGATTCTC
AAGAAGTGCCGCGAGGACATCTATGCATGGCTGAATCACGAAAACGGCCAAGTTGCCATTTATGACGCAGTCAAT
CCCACTGCAAGCGCCAGGCGCTCTTTGGCCAAGGAGCTGGGCAAGCATGATGTGCAAACACTGTACATTGAGTCG
TACGTTGATGACGAGCGCATCTTGCGGGAAAATGCAAGAAATGTCAAGATATCCTCACCCGATTTTGCCGGCATG
GACCCCGACGAGGCCGCCAAGCTGTACTTGAAACGCATCGAGATGAGGATTCCCATGTTTGAGACGATGAATGAG
GGCGAACTCAACTACATCAAAATGATTAATGCCGGAGCAAAGTTCTTTTACAACAATGTTAGCTTTAATTACCTT
TCTCACCGCATCGTCTTTTACCTCACCAATCTGCACATCAAGTCGCGCACCACCTTCTTCGTCCGCGCCGGAACG
ACGGAAGAGGAAGATTCATACAAGGCCGACGCTCCGCTCTCTGAGCAGGGCCGCATCTATGCCGAGAAGATGTCG
GAGACACTACTCAAGCACCGTGAACAAGAGCAGGCGGAGAAGATGGAAAGGGGCGGTCCCCAAGTTCCACTACGG
CCCTTGACTGTGTGGACGTCGACTCGACGTAGAACTGTCCAGACGGCGGATTACCTAAAGTCAAAGGGGTACAAG
GTTCGGCAGCGGTCGCAGATGAGCCAGATTAACCCAGGCGTCTGCGAAAACATGTCTGAACGCGTCATTCGTCAT
ATATATCCCGAGGAGGTGGAGAAGCACGAGCTGGATCCATATCATCACAGATATCCGCGTGCAGAGTCGTACCAC
GACCTTGCCGTGCGTTTGGAACCTATAATTCTCGAGCTCGAACGTGAGCAAAACGACTTGCTCATAATTGCCCAC
GAGTCTGTGCTGCGCGTTCTCTACGCCTACCTGATGCACTGCTCCACCATGGAGATCCCCAACCTTAGATTTCCG
CGAGATGAAATCATTGAAATTATTCCTGCCGCCTACCAGAATGAAGCCAAGCGCATCCACATTCCTGGTCTTTTA
CCTGAGATGCTCCCTGGCTCATCCGACTATGTCCAGACTCCATCGGCCGCTGGTGGCGGCGCCAATGTCTCGGCC
AGTGGCGGCGTTGGCGGCGGCGTCAATGCCAGCAACAGCCTCCCCGGGAGTGGCTCCATGAGTCCAATACCTGGT
GGCATGAGCAGTCCTGCTGTGCCAGTTGAGCGACCTCCTGAAAAAGTCATCAACACATCAAAGGATCTGGTTGCC
GACAAGGTAGACGACGAGGATTAG
Gene >OphauB2|3534
ATGGACACTCTGCTGTAAGTGTATACTTTTGACGAGCAGTCGCAACAATTGCTGGCTCAAGGTTGACCCAAACGA
GGACTGCCGAAATCGCGGCCAATGCCCCCCGGTATCGACGCAAGAGCTCGACTTTTATTGACGGCATTCATGATG
AGCCCAGTGATCAAGACATGGCCCCCGCACAGCTCTACAGCACCATGTCAGGCCGGCTGTTTCACTCTGGTCGCA
TAGCCATTATCATGGTTGGGCCGCCGGCAAGAGGCAAGACGTAAGGCTGATGTGCCCTCCTCCCCAACAGCACGA
CTACAGCTCACCCTTGCAGCCACATCTGTGTGTCGCTGGCCAGATACCTGCAATGGCTCGGTGTCAAGACGCGCA
TTTTCCACTTGGGAGACTACCGACGAGCTACCGTTGGCCCCGGAGGCTCTGTTCCTGAAGACTACTTTTTCCCCA
ACGCTTCACCAGCTTCCGTCATATTGCGGCAAAAGATTCTCAAGAAGTGCCGCGAGGACATCTATGCATGGCTGA
ATCACGAAAACGGCCAAGTTGCCATTTATGACGCAGTCAATCCCACTGCAAGCGCCAGGCGCTCTTTGGCCAAGG
AGCTGGGCAAGCATGATGTGCAAGTATGTCTCGACCAAGGTAATGGGCTTGTACCTGACAATGCATGCACTGACA
TGCAGCTGTTAAGACACTGTACATTGAGTCGTACGTTGATGACGAGCGCATCTTGCGGGAAAATGCAAGAAATGT
CAAGATATCCTCACCCGATGTAAGTTGTTGGCCTCTTTGCTGGGCCGCCACTTGTTAACTTGGATGAATAACTCA
GTTTGCCGGCATGGACCCCGACGAGGCCGCCAAGCTGTACTTGAAACGCATCGAGATGAGGATTCCCATGTTTGA
GACGATGAATGAGGGCGAACTCAACTACATCAAAATGATTAATGCCGGAGCAAAGTTCTTTTACAACAATGTTAG
CTTTAATTACCTTTCTCACCGCATCGTCTTTTACCTCACCAATCTGCACATCAAGTCGCGCACCACCTTCTTCGT
CCGCGCCGGAACGACGGAAGAGGAAGATTCATACAAGGCCGACGCTCCGCTCTCTGAGCAGGGCCGCATCTATGC
CGAGAAGATGTCGGAGACACTACTCAAGCACCGTGAACAAGAGCAGGCGGAGAAGATGGAAAGGGGCGGTCCCCA
AGTTCCACTACGGCCCTTGACTGTGTGGACGTCGACTCGACGTAGAACTGTCCAGACGGCGGATTACCTAAAGTC
AAAGGGGTACAAGGTTCGGCAGCGGTCGCAGATGAGCCAGATTAACCCAGGCGTCTGCGAAAACATGTCTGAACG
CGTCATTCGTCATATATATCCCGAGGAGGTGGAGAAGCACGAGCTGGATCCATATCATCACAGATATCCGCGTGC
AGAGGTAGGTGGATCAGTAGCTGACAAACTGAGCTCTTTGTTCCCCTTGGCCCTGTTAAGATTGAGTTGAACTGA
CTTGTTTCCCTCTCATTGTACGAGTAGTCGTACCACGACCTTGCCGTGCGTTTGGAACCTATAATTCTCGAGCTC
GAACGTGAGCAAAACGACTTGCTCATAATTGCCCACGAGTCTGTGCTGCGCGTTCTCTACGCCTACCTGATGCAC
TGCTCCACCATGGAGATCCCCAACCTTAGATTTCCGCGAGATGAAATCATTGAAATTATTCCTGCCGCCTACCAG
AATGAAGCCAAGCGCATCCACATTCCTGGTCTTTTACCTGAGATGCTCCCTGGCTCATCCGACTATGTCCAGACT
CCATCGGCCGCTGGTGGCGGCGCCAATGTCTCGGCCAGTGGCGGCGTTGGCGGCGGCGTCAATGCCAGCAACAGC
CTCCCCGGGAGTGGCTCCATGAGTCCAATACCTGGTGGCATGAGCAGTCCTGCTGTGCCAGTTGAGCGACCTCCT
GAAAAAGTCATCAACACATCAAAGGATCTGGTTGCCGACAAGGTAGACGACGAGGATTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail