© 2022 - Robin Ohm - Utrecht University - The Netherlands
Built with Python Django and Wagtail
| Protein ID | OphauB2|3531 |
| Gene name | |
| Location | Contig_223:11248..12305 |
| Strand | - |
| Gene length (bp) | 1057 |
| Transcript length (bp) | 930 |
| Coding sequence length (bp) | 930 |
| Protein length (aa) | 310 |
| PFAM Domain ID | Short name | Long name | E-value | Start | End |
|---|---|---|---|---|---|
| PF00673 | Ribosomal_L5_C | ribosomal L5P family C-terminus | 7.5E-25 | 204 | 301 |
| PF00281 | Ribosomal_L5 | Ribosomal protein L5 | 1.3E-09 | 144 | 198 |
| Swissprot ID | Swissprot Description | Start | End | E-value |
|---|---|---|---|---|
| sp|O14337|RM07_SCHPO | Probable 54S ribosomal protein L7, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mrpl7 PE=3 SV=1 | 56 | 301 | 1.0E-37 |
| sp|P36519|RM07_YEAST | 54S ribosomal protein L7, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MRPL7 PE=1 SV=2 | 58 | 302 | 4.0E-35 |
| sp|Q2RFQ9|RL5_MOOTA | 50S ribosomal protein L5 OS=Moorella thermoacetica (strain ATCC 39073) GN=rplE PE=3 SV=1 | 142 | 301 | 3.0E-28 |
| sp|A7HBN0|RL5_ANADF | 50S ribosomal protein L5 OS=Anaeromyxobacter sp. (strain Fw109-5) GN=rplE PE=3 SV=1 | 147 | 301 | 7.0E-28 |
| sp|B0JHZ1|RL5_MICAN | 50S ribosomal protein L5 OS=Microcystis aeruginosa (strain NIES-843) GN=rplE PE=3 SV=1 | 142 | 301 | 1.0E-27 |
| Swissprot ID | Swissprot Description | Start | End | E-value |
|---|---|---|---|---|
| sp|O14337|RM07_SCHPO | Probable 54S ribosomal protein L7, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mrpl7 PE=3 SV=1 | 56 | 301 | 1.0E-37 |
| sp|P36519|RM07_YEAST | 54S ribosomal protein L7, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MRPL7 PE=1 SV=2 | 58 | 302 | 4.0E-35 |
| sp|Q2RFQ9|RL5_MOOTA | 50S ribosomal protein L5 OS=Moorella thermoacetica (strain ATCC 39073) GN=rplE PE=3 SV=1 | 142 | 301 | 3.0E-28 |
| sp|A7HBN0|RL5_ANADF | 50S ribosomal protein L5 OS=Anaeromyxobacter sp. (strain Fw109-5) GN=rplE PE=3 SV=1 | 147 | 301 | 7.0E-28 |
| sp|B0JHZ1|RL5_MICAN | 50S ribosomal protein L5 OS=Microcystis aeruginosa (strain NIES-843) GN=rplE PE=3 SV=1 | 142 | 301 | 1.0E-27 |
| sp|Q49ZF6|RL5_STAS1 | 50S ribosomal protein L5 OS=Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229) GN=rplE PE=3 SV=1 | 145 | 302 | 1.0E-27 |
| sp|B9E9K3|RL5_MACCJ | 50S ribosomal protein L5 OS=Macrococcus caseolyticus (strain JCSC5402) GN=rplE PE=3 SV=1 | 145 | 301 | 1.0E-27 |
| sp|B2A4F1|RL5_NATTJ | 50S ribosomal protein L5 OS=Natranaerobius thermophilus (strain ATCC BAA-1301 / DSM 18059 / JW/NM-WN-LF) GN=rplE PE=3 SV=1 | 142 | 301 | 2.0E-27 |
| sp|B4UBB1|RL5_ANASK | 50S ribosomal protein L5 OS=Anaeromyxobacter sp. (strain K) GN=rplE PE=3 SV=1 | 147 | 301 | 3.0E-27 |
| sp|Q2IJ79|RL5_ANADE | 50S ribosomal protein L5 OS=Anaeromyxobacter dehalogenans (strain 2CP-C) GN=rplE PE=3 SV=1 | 147 | 301 | 3.0E-27 |
| sp|B8J872|RL5_ANAD2 | 50S ribosomal protein L5 OS=Anaeromyxobacter dehalogenans (strain 2CP-1 / ATCC BAA-258) GN=rplE PE=3 SV=1 | 147 | 301 | 3.0E-27 |
| sp|A6TWH0|RL5_ALKMQ | 50S ribosomal protein L5 OS=Alkaliphilus metalliredigens (strain QYMF) GN=rplE PE=3 SV=1 | 145 | 301 | 3.0E-27 |
| sp|Q4L8A2|RL5_STAHJ | 50S ribosomal protein L5 OS=Staphylococcus haemolyticus (strain JCSC1435) GN=rplE PE=3 SV=1 | 145 | 301 | 3.0E-27 |
| sp|Q8YPJ1|RL5_NOSS1 | 50S ribosomal protein L5 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=rplE PE=3 SV=1 | 142 | 301 | 4.0E-27 |
| sp|Q3MFA9|RL5_ANAVT | 50S ribosomal protein L5 OS=Anabaena variabilis (strain ATCC 29413 / PCC 7937) GN=rplE PE=3 SV=1 | 142 | 301 | 4.0E-27 |
| sp|Q5M2C5|RL5_STRT2 | 50S ribosomal protein L5 OS=Streptococcus thermophilus (strain ATCC BAA-250 / LMG 18311) GN=rplE PE=3 SV=1 | 130 | 301 | 5.0E-27 |
| sp|Q5LXS3|RL5_STRT1 | 50S ribosomal protein L5 OS=Streptococcus thermophilus (strain CNRZ 1066) GN=rplE PE=3 SV=1 | 130 | 301 | 5.0E-27 |
| sp|Q8CRH2|RL5_STAES | 50S ribosomal protein L5 OS=Staphylococcus epidermidis (strain ATCC 12228) GN=rplE PE=3 SV=1 | 145 | 301 | 5.0E-27 |
| sp|Q5HM11|RL5_STAEQ | 50S ribosomal protein L5 OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=rplE PE=3 SV=1 | 145 | 301 | 5.0E-27 |
| sp|B8G6R3|RL5_CHLAD | 50S ribosomal protein L5 OS=Chloroflexus aggregans (strain MD-66 / DSM 9485) GN=rplE PE=3 SV=1 | 134 | 301 | 5.0E-27 |
| sp|Q3A9S8|RL5_CARHZ | 50S ribosomal protein L5 OS=Carboxydothermus hydrogenoformans (strain ATCC BAA-161 / DSM 6008 / Z-2901) GN=rplE PE=3 SV=1 | 142 | 301 | 5.0E-27 |
| sp|Q2S924|RL5_HAHCH | 50S ribosomal protein L5 OS=Hahella chejuensis (strain KCTC 2396) GN=rplE PE=3 SV=1 | 134 | 301 | 5.0E-27 |
| sp|B9DM35|RL5_STACT | 50S ribosomal protein L5 OS=Staphylococcus carnosus (strain TM300) GN=rplE PE=3 SV=1 | 139 | 301 | 6.0E-27 |
| sp|Q03IG3|RL5_STRTD | 50S ribosomal protein L5 OS=Streptococcus thermophilus (strain ATCC BAA-491 / LMD-9) GN=rplE PE=3 SV=1 | 130 | 301 | 7.0E-27 |
| sp|Q1GPB1|RL5_SPHAL | 50S ribosomal protein L5 OS=Sphingopyxis alaskensis (strain DSM 13593 / LMG 18877 / RB2256) GN=rplE PE=3 SV=1 | 142 | 301 | 9.0E-27 |
| sp|Q2RQX2|RL5_RHORT | 50S ribosomal protein L5 OS=Rhodospirillum rubrum (strain ATCC 11170 / ATH 1.1.1 / DSM 467 / LMG 4362 / NCIB 8255 / S1) GN=rplE PE=3 SV=1 | 142 | 301 | 1.0E-26 |
| sp|B0U0X7|RL5_FRAP2 | 50S ribosomal protein L5 OS=Francisella philomiragia subsp. philomiragia (strain ATCC 25017) GN=rplE PE=3 SV=1 | 137 | 301 | 1.0E-26 |
| sp|A4J123|RL5_DESRM | 50S ribosomal protein L5 OS=Desulfotomaculum reducens (strain MI-1) GN=rplE PE=3 SV=1 | 142 | 301 | 2.0E-26 |
| sp|B5EFR2|RL5_GEOBB | 50S ribosomal protein L5 OS=Geobacter bemidjiensis (strain Bem / ATCC BAA-1014 / DSM 16622) GN=rplE PE=3 SV=1 | 142 | 301 | 2.0E-26 |
| sp|Q6B8W5|RK5_GRATL | 50S ribosomal protein L5, chloroplastic OS=Gracilaria tenuistipitata var. liui GN=rpl5 PE=3 SV=1 | 142 | 301 | 2.0E-26 |
| sp|Q9A8U1|RL5_CAUCR | 50S ribosomal protein L5 OS=Caulobacter crescentus (strain ATCC 19089 / CB15) GN=rplE PE=3 SV=1 | 142 | 301 | 2.0E-26 |
| sp|B8H4E6|RL5_CAUCN | 50S ribosomal protein L5 OS=Caulobacter crescentus (strain NA1000 / CB15N) GN=rplE PE=3 SV=1 | 142 | 301 | 2.0E-26 |
| sp|Q5WLQ0|RL5_BACSK | 50S ribosomal protein L5 OS=Bacillus clausii (strain KSM-K16) GN=rplE PE=3 SV=1 | 146 | 301 | 2.0E-26 |
| sp|C5CGJ0|RL5_KOSOT | 50S ribosomal protein L5 OS=Kosmotoga olearia (strain TBF 19.5.1) GN=rplE PE=3 SV=1 | 145 | 301 | 2.0E-26 |
| sp|C6E4P5|RL5_GEOSM | 50S ribosomal protein L5 OS=Geobacter sp. (strain M21) GN=rplE PE=3 SV=1 | 142 | 301 | 2.0E-26 |
| sp|Q7A083|RL5_STAAW | 50S ribosomal protein L5 OS=Staphylococcus aureus (strain MW2) GN=rplE PE=3 SV=1 | 145 | 301 | 2.0E-26 |
| sp|A8Z345|RL5_STAAT | 50S ribosomal protein L5 OS=Staphylococcus aureus (strain USA300 / TCH1516) GN=rplE PE=3 SV=1 | 145 | 301 | 2.0E-26 |
| sp|Q6G783|RL5_STAAS | 50S ribosomal protein L5 OS=Staphylococcus aureus (strain MSSA476) GN=rplE PE=3 SV=1 | 145 | 301 | 2.0E-26 |
| sp|Q6GEJ5|RL5_STAAR | 50S ribosomal protein L5 OS=Staphylococcus aureus (strain MRSA252) GN=rplE PE=3 SV=1 | 145 | 301 | 2.0E-26 |
| sp|Q7A465|RL5_STAAN | 50S ribosomal protein L5 OS=Staphylococcus aureus (strain N315) GN=rplE PE=1 SV=1 | 145 | 301 | 2.0E-26 |
| sp|Q99S33|RL5_STAAM | 50S ribosomal protein L5 OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=rplE PE=3 SV=1 | 145 | 301 | 2.0E-26 |
| sp|A6QJ80|RL5_STAAE | 50S ribosomal protein L5 OS=Staphylococcus aureus (strain Newman) GN=rplE PE=3 SV=1 | 145 | 301 | 2.0E-26 |
| sp|Q5HDX0|RL5_STAAC | 50S ribosomal protein L5 OS=Staphylococcus aureus (strain COL) GN=rplE PE=3 SV=1 | 145 | 301 | 2.0E-26 |
| sp|Q2YYK9|RL5_STAAB | 50S ribosomal protein L5 OS=Staphylococcus aureus (strain bovine RF122 / ET3-1) GN=rplE PE=3 SV=1 | 145 | 301 | 2.0E-26 |
| sp|A5IV22|RL5_STAA9 | 50S ribosomal protein L5 OS=Staphylococcus aureus (strain JH9) GN=rplE PE=3 SV=1 | 145 | 301 | 2.0E-26 |
| sp|Q2FW18|RL5_STAA8 | 50S ribosomal protein L5 OS=Staphylococcus aureus (strain NCTC 8325) GN=rplE PE=1 SV=1 | 145 | 301 | 2.0E-26 |
| sp|Q2FEQ1|RL5_STAA3 | 50S ribosomal protein L5 OS=Staphylococcus aureus (strain USA300) GN=rplE PE=3 SV=1 | 145 | 301 | 2.0E-26 |
| sp|A6U3W3|RL5_STAA2 | 50S ribosomal protein L5 OS=Staphylococcus aureus (strain JH1) GN=rplE PE=3 SV=1 | 145 | 301 | 2.0E-26 |
| sp|A7X5E5|RL5_STAA1 | 50S ribosomal protein L5 OS=Staphylococcus aureus (strain Mu3 / ATCC 700698) GN=rplE PE=3 SV=1 | 145 | 301 | 2.0E-26 |
| sp|Q8PC39|RL5_XANCP | 50S ribosomal protein L5 OS=Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25) GN=rplE PE=3 SV=1 | 145 | 301 | 3.0E-26 |
| sp|B0RU70|RL5_XANCB | 50S ribosomal protein L5 OS=Xanthomonas campestris pv. campestris (strain B100) GN=rplE PE=3 SV=1 | 145 | 301 | 3.0E-26 |
| sp|Q4URF1|RL5_XANC8 | 50S ribosomal protein L5 OS=Xanthomonas campestris pv. campestris (strain 8004) GN=rplE PE=3 SV=1 | 145 | 301 | 3.0E-26 |
| sp|Q5GWU7|RL5_XANOR | 50S ribosomal protein L5 OS=Xanthomonas oryzae pv. oryzae (strain KACC10331 / KXO85) GN=rplE PE=3 SV=1 | 145 | 301 | 3.0E-26 |
| sp|B2SQS2|RL5_XANOP | 50S ribosomal protein L5 OS=Xanthomonas oryzae pv. oryzae (strain PXO99A) GN=rplE PE=3 SV=1 | 145 | 301 | 3.0E-26 |
| sp|Q2NZZ7|RL5_XANOM | 50S ribosomal protein L5 OS=Xanthomonas oryzae pv. oryzae (strain MAFF 311018) GN=rplE PE=3 SV=1 | 145 | 301 | 3.0E-26 |
| sp|P62405|RL5_SALTY | 50S ribosomal protein L5 OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=rplE PE=3 SV=2 | 140 | 301 | 4.0E-26 |
| sp|P62404|RL5_SALTI | 50S ribosomal protein L5 OS=Salmonella typhi GN=rplE PE=3 SV=2 | 140 | 301 | 4.0E-26 |
| sp|B4TXD0|RL5_SALSV | 50S ribosomal protein L5 OS=Salmonella schwarzengrund (strain CVM19633) GN=rplE PE=3 SV=1 | 140 | 301 | 4.0E-26 |
| sp|B5BGX4|RL5_SALPK | 50S ribosomal protein L5 OS=Salmonella paratyphi A (strain AKU_12601) GN=rplE PE=3 SV=1 | 140 | 301 | 4.0E-26 |
| sp|C0Q0A4|RL5_SALPC | 50S ribosomal protein L5 OS=Salmonella paratyphi C (strain RKS4594) GN=rplE PE=3 SV=1 | 140 | 301 | 4.0E-26 |
| sp|A9MSY6|RL5_SALPB | 50S ribosomal protein L5 OS=Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7) GN=rplE PE=3 SV=1 | 140 | 301 | 4.0E-26 |
| sp|Q5PIU5|RL5_SALPA | 50S ribosomal protein L5 OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=rplE PE=3 SV=1 | 140 | 301 | 4.0E-26 |
| sp|B4SUS8|RL5_SALNS | 50S ribosomal protein L5 OS=Salmonella newport (strain SL254) GN=rplE PE=3 SV=1 | 140 | 301 | 4.0E-26 |
| sp|B4TKK3|RL5_SALHS | 50S ribosomal protein L5 OS=Salmonella heidelberg (strain SL476) GN=rplE PE=3 SV=1 | 140 | 301 | 4.0E-26 |
| sp|B5RH27|RL5_SALG2 | 50S ribosomal protein L5 OS=Salmonella gallinarum (strain 287/91 / NCTC 13346) GN=rplE PE=3 SV=1 | 140 | 301 | 4.0E-26 |
| sp|B5R279|RL5_SALEP | 50S ribosomal protein L5 OS=Salmonella enteritidis PT4 (strain P125109) GN=rplE PE=3 SV=1 | 140 | 301 | 4.0E-26 |
| sp|B5FJK2|RL5_SALDC | 50S ribosomal protein L5 OS=Salmonella dublin (strain CT_02021853) GN=rplE PE=3 SV=1 | 140 | 301 | 4.0E-26 |
| sp|Q57J44|RL5_SALCH | 50S ribosomal protein L5 OS=Salmonella choleraesuis (strain SC-B67) GN=rplE PE=3 SV=1 | 140 | 301 | 4.0E-26 |
| sp|B5F7T3|RL5_SALA4 | 50S ribosomal protein L5 OS=Salmonella agona (strain SL483) GN=rplE PE=3 SV=1 | 140 | 301 | 4.0E-26 |
| sp|Q3BWX1|RL5_XANC5 | 50S ribosomal protein L5 OS=Xanthomonas campestris pv. vesicatoria (strain 85-10) GN=rplE PE=3 SV=1 | 145 | 301 | 4.0E-26 |
| sp|Q110B9|RL5_TRIEI | 50S ribosomal protein L5 OS=Trichodesmium erythraeum (strain IMS101) GN=rplE PE=3 SV=1 | 142 | 301 | 4.0E-26 |
| sp|B0UX26|RL5_HISS2 | 50S ribosomal protein L5 OS=Histophilus somni (strain 2336) GN=rplE PE=3 SV=1 | 145 | 301 | 4.0E-26 |
| sp|Q0I150|RL5_HAES1 | 50S ribosomal protein L5 OS=Haemophilus somnus (strain 129Pt) GN=rplE PE=3 SV=1 | 145 | 301 | 4.0E-26 |
| sp|B7GJ79|RL5_ANOFW | 50S ribosomal protein L5 OS=Anoxybacillus flavithermus (strain DSM 21510 / WK1) GN=rplE PE=3 SV=1 | 145 | 301 | 4.0E-26 |
| sp|A9MN60|RL5_SALAR | 50S ribosomal protein L5 OS=Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980) GN=rplE PE=3 SV=1 | 140 | 301 | 4.0E-26 |
| sp|Q2G8W8|RL5_NOVAD | 50S ribosomal protein L5 OS=Novosphingobium aromaticivorans (strain DSM 12444 / F199) GN=rplE PE=3 SV=1 | 142 | 301 | 4.0E-26 |
| sp|B2ITP3|RL5_NOSP7 | 50S ribosomal protein L5 OS=Nostoc punctiforme (strain ATCC 29133 / PCC 73102) GN=rplE PE=3 SV=1 | 142 | 301 | 4.0E-26 |
| sp|B9DSW2|RL5_STRU0 | 50S ribosomal protein L5 OS=Streptococcus uberis (strain ATCC BAA-854 / 0140J) GN=rplE PE=3 SV=1 | 130 | 301 | 4.0E-26 |
| sp|Q02W36|RL5_LACLS | 50S ribosomal protein L5 OS=Lactococcus lactis subsp. cremoris (strain SK11) GN=rplE PE=3 SV=1 | 130 | 301 | 4.0E-26 |
| sp|A2RNP3|RL5_LACLM | 50S ribosomal protein L5 OS=Lactococcus lactis subsp. cremoris (strain MG1363) GN=rplE PE=3 SV=1 | 130 | 301 | 4.0E-26 |
| sp|Q9CDX4|RL5_LACLA | 50S ribosomal protein L5 OS=Lactococcus lactis subsp. lactis (strain IL1403) GN=rplE PE=3 SV=1 | 130 | 301 | 4.0E-26 |
| sp|B5XNA5|RL5_KLEP3 | 50S ribosomal protein L5 OS=Klebsiella pneumoniae (strain 342) GN=rplE PE=3 SV=1 | 140 | 301 | 5.0E-26 |
| sp|A9KJI2|RL5_CLOPH | 50S ribosomal protein L5 OS=Clostridium phytofermentans (strain ATCC 700394 / DSM 18823 / ISDg) GN=rplE PE=3 SV=1 | 142 | 301 | 5.0E-26 |
| sp|Q8PNR4|RL5_XANAC | 50S ribosomal protein L5 OS=Xanthomonas axonopodis pv. citri (strain 306) GN=rplE PE=3 SV=1 | 145 | 301 | 5.0E-26 |
| sp|B2SDX3|RL5_FRATM | 50S ribosomal protein L5 OS=Francisella tularensis subsp. mediasiatica (strain FSC147) GN=rplE PE=3 SV=1 | 142 | 301 | 5.0E-26 |
| sp|A4IZS2|RL5_FRATW | 50S ribosomal protein L5 OS=Francisella tularensis subsp. tularensis (strain WY96-3418) GN=rplE PE=3 SV=1 | 142 | 301 | 5.0E-26 |
| sp|Q0BNR5|RL5_FRATO | 50S ribosomal protein L5 OS=Francisella tularensis subsp. holarctica (strain OSU18) GN=rplE PE=3 SV=1 | 142 | 301 | 5.0E-26 |
| sp|A0Q4J5|RL5_FRATN | 50S ribosomal protein L5 OS=Francisella tularensis subsp. novicida (strain U112) GN=rplE PE=3 SV=1 | 142 | 301 | 5.0E-26 |
| sp|Q2A5F8|RL5_FRATH | 50S ribosomal protein L5 OS=Francisella tularensis subsp. holarctica (strain LVS) GN=rplE PE=3 SV=1 | 142 | 301 | 5.0E-26 |
| sp|A7N9T7|RL5_FRATF | 50S ribosomal protein L5 OS=Francisella tularensis subsp. holarctica (strain FTNF002-00 / FTA) GN=rplE PE=3 SV=1 | 142 | 301 | 5.0E-26 |
| sp|Q5NHV6|RL5_FRATT | 50S ribosomal protein L5 OS=Francisella tularensis subsp. tularensis (strain SCHU S4 / Schu 4) GN=rplE PE=3 SV=1 | 142 | 301 | 5.0E-26 |
| sp|Q14JA8|RL5_FRAT1 | 50S ribosomal protein L5 OS=Francisella tularensis subsp. tularensis (strain FSC 198) GN=rplE PE=3 SV=1 | 142 | 301 | 5.0E-26 |
| sp|B0BSU3|RL5_ACTPJ | 50S ribosomal protein L5 OS=Actinobacillus pleuropneumoniae serotype 3 (strain JL03) GN=rplE PE=3 SV=1 | 145 | 301 | 6.0E-26 |
| sp|B3GZ23|RL5_ACTP7 | 50S ribosomal protein L5 OS=Actinobacillus pleuropneumoniae serotype 7 (strain AP76) GN=rplE PE=3 SV=1 | 145 | 301 | 6.0E-26 |
| sp|A3N369|RL5_ACTP2 | 50S ribosomal protein L5 OS=Actinobacillus pleuropneumoniae serotype 5b (strain L20) GN=rplE PE=3 SV=1 | 145 | 301 | 6.0E-26 |
| sp|Q2W2K3|RL5_MAGSA | 50S ribosomal protein L5 OS=Magnetospirillum magneticum (strain AMB-1 / ATCC 700264) GN=rplE PE=3 SV=1 | 135 | 301 | 6.0E-26 |
| sp|Q8DMM0|RL5_THEEB | 50S ribosomal protein L5 OS=Thermosynechococcus elongatus (strain BP-1) GN=rplE PE=3 SV=1 | 142 | 301 | 6.0E-26 |
| sp|B8G1X8|RL5_DESHD | 50S ribosomal protein L5 OS=Desulfitobacterium hafniense (strain DCB-2 / DSM 10664) GN=rplE PE=3 SV=1 | 142 | 301 | 6.0E-26 |
| sp|Q250M0|RL5_DESHY | 50S ribosomal protein L5 OS=Desulfitobacterium hafniense (strain Y51) GN=rplE PE=3 SV=1 | 142 | 301 | 6.0E-26 |
| sp|A1T0D0|RL5_PSYIN | 50S ribosomal protein L5 OS=Psychromonas ingrahamii (strain 37) GN=rplE PE=3 SV=1 | 145 | 301 | 6.0E-26 |
| sp|B8HMR6|RL5_CYAP4 | 50S ribosomal protein L5 OS=Cyanothece sp. (strain PCC 7425 / ATCC 29141) GN=rplE PE=3 SV=1 | 142 | 301 | 7.0E-26 |
| sp|A7NR51|RL5_ROSCS | 50S ribosomal protein L5 OS=Roseiflexus castenholzii (strain DSM 13941 / HLO8) GN=rplE PE=3 SV=1 | 123 | 301 | 7.0E-26 |
| sp|B1HMW8|RL5_LYSSC | 50S ribosomal protein L5 OS=Lysinibacillus sphaericus (strain C3-41) GN=rplE PE=3 SV=1 | 145 | 301 | 8.0E-26 |
| sp|C4ZBT1|RL5_EUBR3 | 50S ribosomal protein L5 OS=Eubacterium rectale (strain ATCC 33656 / VPI 0990) GN=rplE PE=3 SV=1 | 142 | 301 | 8.0E-26 |
| sp|Q9Z9K2|RL5_BACHD | 50S ribosomal protein L5 OS=Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125) GN=rplE PE=3 SV=1 | 146 | 301 | 9.0E-26 |
| sp|A5GAV4|RL5_GEOUR | 50S ribosomal protein L5 OS=Geobacter uraniireducens (strain Rf4) GN=rplE PE=3 SV=1 | 142 | 301 | 9.0E-26 |
| sp|C5BGL3|RL5_EDWI9 | 50S ribosomal protein L5 OS=Edwardsiella ictaluri (strain 93-146) GN=rplE PE=3 SV=1 | 140 | 301 | 1.0E-25 |
| sp|Q3ZZL2|RL5_DEHMC | 50S ribosomal protein L5 OS=Dehalococcoides mccartyi (strain CBDB1) GN=rplE PE=3 SV=1 | 124 | 301 | 1.0E-25 |
| sp|A5FRX3|RL5_DEHMB | 50S ribosomal protein L5 OS=Dehalococcoides mccartyi (strain ATCC BAA-2100 / JCM 16839 / KCTC 5957 / BAV1) GN=rplE PE=3 SV=1 | 124 | 301 | 1.0E-25 |
| sp|B0K5Q5|RL5_THEPX | 50S ribosomal protein L5 OS=Thermoanaerobacter sp. (strain X514) GN=rplE PE=3 SV=1 | 142 | 301 | 1.0E-25 |
| sp|B0KCL2|RL5_THEP3 | 50S ribosomal protein L5 OS=Thermoanaerobacter pseudethanolicus (strain ATCC 33223 / 39E) GN=rplE PE=3 SV=1 | 142 | 301 | 1.0E-25 |
| sp|B0C1E5|RL5_ACAM1 | 50S ribosomal protein L5 OS=Acaryochloris marina (strain MBIC 11017) GN=rplE PE=3 SV=1 | 142 | 301 | 1.0E-25 |
| sp|B8I7Z1|RL5_CLOCE | 50S ribosomal protein L5 OS=Clostridium cellulolyticum (strain ATCC 35319 / DSM 5812 / JCM 6584 / H10) GN=rplE PE=3 SV=1 | 145 | 301 | 1.0E-25 |
| sp|P38517|RL5_THEMA | 50S ribosomal protein L5 OS=Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099) GN=rplE PE=3 SV=2 | 134 | 301 | 1.0E-25 |
| sp|B9LJE4|RL5_CHLSY | 50S ribosomal protein L5 OS=Chloroflexus aurantiacus (strain ATCC 29364 / DSM 637 / Y-400-fl) GN=rplE PE=3 SV=1 | 134 | 301 | 2.0E-25 |
| sp|A9WH78|RL5_CHLAA | 50S ribosomal protein L5 OS=Chloroflexus aurantiacus (strain ATCC 29366 / DSM 635 / J-10-fl) GN=rplE PE=3 SV=1 | 134 | 301 | 2.0E-25 |
| sp|B1LBM8|RL5_THESQ | 50S ribosomal protein L5 OS=Thermotoga sp. (strain RQ2) GN=rplE PE=3 SV=1 | 134 | 301 | 2.0E-25 |
| sp|B8F6Q9|RL5_HAEPS | 50S ribosomal protein L5 OS=Haemophilus parasuis serovar 5 (strain SH0165) GN=rplE PE=3 SV=1 | 145 | 301 | 2.0E-25 |
| sp|Q3Z969|RL5_DEHM1 | 50S ribosomal protein L5 OS=Dehalococcoides mccartyi (strain ATCC BAA-2266 / KCTC 15142 / 195) GN=rplE PE=3 SV=1 | 124 | 301 | 2.0E-25 |
| sp|Q605C4|RL5_METCA | 50S ribosomal protein L5 OS=Methylococcus capsulatus (strain ATCC 33009 / NCIMB 11132 / Bath) GN=rplE PE=3 SV=1 | 145 | 301 | 2.0E-25 |
| sp|A9WSU5|RL5_RENSM | 50S ribosomal protein L5 OS=Renibacterium salmoninarum (strain ATCC 33209 / DSM 20767 / JCM 11484 / NBRC 15589 / NCIMB 2235) GN=rplE PE=3 SV=1 | 141 | 301 | 2.0E-25 |
| sp|Q0AUJ2|RL5_SYNWW | 50S ribosomal protein L5 OS=Syntrophomonas wolfei subsp. wolfei (strain DSM 2245B / Goettingen) GN=rplE PE=3 SV=1 | 142 | 301 | 2.0E-25 |
| sp|A7HWS3|RL5_PARL1 | 50S ribosomal protein L5 OS=Parvibaculum lavamentivorans (strain DS-1 / DSM 13023 / NCIMB 13966) GN=rplE PE=3 SV=1 | 142 | 301 | 2.0E-25 |
| sp|B2TII7|RL5_CLOBB | 50S ribosomal protein L5 OS=Clostridium botulinum (strain Eklund 17B / Type B) GN=rplE PE=3 SV=1 | 142 | 301 | 2.0E-25 |
| sp|B2UYC2|RL5_CLOBA | 50S ribosomal protein L5 OS=Clostridium botulinum (strain Alaska E43 / Type E3) GN=rplE PE=3 SV=1 | 142 | 301 | 2.0E-25 |
| sp|A1TYK9|RL5_MARHV | 50S ribosomal protein L5 OS=Marinobacter hydrocarbonoclasticus (strain ATCC 700491 / DSM 11845 / VT8) GN=rplE PE=3 SV=1 | 130 | 301 | 2.0E-25 |
| sp|Q6F7S4|RL5_ACIAD | 50S ribosomal protein L5 OS=Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1) GN=rplE PE=3 SV=1 | 142 | 301 | 2.0E-25 |
| sp|Q890P8|RL5_CLOTE | 50S ribosomal protein L5 OS=Clostridium tetani (strain Massachusetts / E88) GN=rplE PE=3 SV=1 | 142 | 303 | 2.0E-25 |
| sp|A0PXV8|RL5_CLONN | 50S ribosomal protein L5 OS=Clostridium novyi (strain NT) GN=rplE PE=3 SV=1 | 142 | 301 | 2.0E-25 |
| sp|C1DKM5|RL5_AZOVD | 50S ribosomal protein L5 OS=Azotobacter vinelandii (strain DJ / ATCC BAA-1303) GN=rplE PE=3 SV=1 | 141 | 301 | 2.0E-25 |
| sp|B1KSL3|RL5_CLOBM | 50S ribosomal protein L5 OS=Clostridium botulinum (strain Loch Maree / Type A3) GN=rplE PE=3 SV=1 | 142 | 301 | 2.0E-25 |
| sp|Q6LVA4|RL5_PHOPR | 50S ribosomal protein L5 OS=Photobacterium profundum GN=rplE PE=3 SV=1 | 145 | 301 | 3.0E-25 |
| sp|B4R8M9|RL5_PHEZH | 50S ribosomal protein L5 OS=Phenylobacterium zucineum (strain HLK1) GN=rplE PE=3 SV=1 | 142 | 301 | 3.0E-25 |
| sp|Q7NEG4|RL5_GLOVI | 50S ribosomal protein L5 OS=Gloeobacter violaceus (strain PCC 7421) GN=rplE PE=3 SV=1 | 142 | 301 | 3.0E-25 |
| sp|B0V6V7|RL5_ACIBY | 50S ribosomal protein L5 OS=Acinetobacter baumannii (strain AYE) GN=rplE PE=3 SV=1 | 142 | 301 | 3.0E-25 |
| sp|A3M972|RL5_ACIBT | 50S ribosomal protein L5 OS=Acinetobacter baumannii (strain ATCC 17978 / CIP 53.77 / LMG 1025 / NCDC KC755 / 5377) GN=rplE PE=3 SV=2 | 142 | 301 | 3.0E-25 |
| sp|B0VQT0|RL5_ACIBS | 50S ribosomal protein L5 OS=Acinetobacter baumannii (strain SDF) GN=rplE PE=3 SV=1 | 142 | 301 | 3.0E-25 |
| sp|B7IA27|RL5_ACIB5 | 50S ribosomal protein L5 OS=Acinetobacter baumannii (strain AB0057) GN=rplE PE=3 SV=1 | 142 | 301 | 3.0E-25 |
| sp|B7GW14|RL5_ACIB3 | 50S ribosomal protein L5 OS=Acinetobacter baumannii (strain AB307-0294) GN=rplE PE=3 SV=1 | 142 | 301 | 3.0E-25 |
| sp|A7GJ62|RL5_CLOBL | 50S ribosomal protein L5 OS=Clostridium botulinum (strain Langeland / NCTC 10281 / Type F) GN=rplE PE=3 SV=1 | 142 | 301 | 3.0E-25 |
| sp|B1IGE2|RL5_CLOBK | 50S ribosomal protein L5 OS=Clostridium botulinum (strain Okra / Type B1) GN=rplE PE=3 SV=1 | 142 | 301 | 3.0E-25 |
| sp|C1FMT9|RL5_CLOBJ | 50S ribosomal protein L5 OS=Clostridium botulinum (strain Kyoto / Type A2) GN=rplE PE=3 SV=1 | 142 | 301 | 3.0E-25 |
| sp|A5I7J4|RL5_CLOBH | 50S ribosomal protein L5 OS=Clostridium botulinum (strain Hall / ATCC 3502 / NCTC 13319 / Type A) GN=rplE PE=3 SV=1 | 142 | 301 | 3.0E-25 |
| sp|C3KVN9|RL5_CLOB6 | 50S ribosomal protein L5 OS=Clostridium botulinum (strain 657 / Type Ba4) GN=rplE PE=3 SV=1 | 142 | 301 | 3.0E-25 |
| sp|A7FZ57|RL5_CLOB1 | 50S ribosomal protein L5 OS=Clostridium botulinum (strain ATCC 19397 / Type A) GN=rplE PE=3 SV=1 | 142 | 301 | 3.0E-25 |
| sp|Q9CL42|RL5_PASMU | 50S ribosomal protein L5 OS=Pasteurella multocida (strain Pm70) GN=rplE PE=3 SV=1 | 145 | 301 | 3.0E-25 |
| sp|Q97EJ0|RL5_CLOAB | 50S ribosomal protein L5 OS=Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / LMG 5710 / VKM B-1787) GN=rplE PE=3 SV=1 | 142 | 301 | 3.0E-25 |
| sp|Q839F2|RL5_ENTFA | 50S ribosomal protein L5 OS=Enterococcus faecalis (strain ATCC 700802 / V583) GN=rplE PE=3 SV=1 | 136 | 301 | 3.0E-25 |
| sp|B1YGW2|RL5_EXIS2 | 50S ribosomal protein L5 OS=Exiguobacterium sibiricum (strain DSM 17290 / JCM 13490 / 255-15) GN=rplE PE=3 SV=1 | 147 | 301 | 3.0E-25 |
| sp|A2BYS4|RL5_PROM5 | 50S ribosomal protein L5 OS=Prochlorococcus marinus (strain MIT 9515) GN=rplE PE=3 SV=1 | 142 | 301 | 3.0E-25 |
| sp|P73308|RL5_SYNY3 | 50S ribosomal protein L5 OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=rplE PE=3 SV=2 | 134 | 301 | 3.0E-25 |
| sp|Q7UZV6|RL5_PROMP | 50S ribosomal protein L5 OS=Prochlorococcus marinus subsp. pastoris (strain CCMP1986 / MED4) GN=rplE PE=3 SV=1 | 142 | 301 | 3.0E-25 |
| sp|Q8E2C2|RL5_STRA5 | 50S ribosomal protein L5 OS=Streptococcus agalactiae serotype V (strain ATCC BAA-611 / 2603 V/R) GN=rplE PE=3 SV=1 | 130 | 301 | 3.0E-25 |
| sp|Q8E7S9|RL5_STRA3 | 50S ribosomal protein L5 OS=Streptococcus agalactiae serotype III (strain NEM316) GN=rplE PE=3 SV=1 | 130 | 301 | 3.0E-25 |
| sp|Q3K3V7|RL5_STRA1 | 50S ribosomal protein L5 OS=Streptococcus agalactiae serotype Ia (strain ATCC 27591 / A909 / CDC SS700) GN=rplE PE=3 SV=1 | 130 | 301 | 3.0E-25 |
| sp|B1I1K0|RL5_DESAP | 50S ribosomal protein L5 OS=Desulforudis audaxviator (strain MP104C) GN=rplE PE=3 SV=1 | 142 | 301 | 4.0E-25 |
| sp|Q5NQ53|RL5_ZYMMO | 50S ribosomal protein L5 OS=Zymomonas mobilis subsp. mobilis (strain ATCC 31821 / ZM4 / CP4) GN=rplE PE=3 SV=1 | 142 | 301 | 4.0E-25 |
| sp|Q31IX0|RL5_THICR | 50S ribosomal protein L5 OS=Thiomicrospira crunogena (strain XCL-2) GN=rplE PE=3 SV=1 | 147 | 301 | 4.0E-25 |
| sp|B8E1E5|RL5_DICTD | 50S ribosomal protein L5 OS=Dictyoglomus turgidum (strain Z-1310 / DSM 6724) GN=rplE PE=3 SV=1 | 146 | 301 | 4.0E-25 |
| sp|C0MCC2|RL5_STRS7 | 50S ribosomal protein L5 OS=Streptococcus equi subsp. zooepidemicus (strain H70) GN=rplE PE=3 SV=1 | 130 | 301 | 5.0E-25 |
| sp|B4U512|RL5_STREM | 50S ribosomal protein L5 OS=Streptococcus equi subsp. zooepidemicus (strain MGCS10565) GN=rplE PE=3 SV=1 | 130 | 301 | 5.0E-25 |
| sp|C0M9H3|RL5_STRE4 | 50S ribosomal protein L5 OS=Streptococcus equi subsp. equi (strain 4047) GN=rplE PE=3 SV=1 | 130 | 301 | 5.0E-25 |
| sp|Q9HWE7|RL5_PSEAE | 50S ribosomal protein L5 OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=rplE PE=3 SV=1 | 142 | 301 | 5.0E-25 |
| sp|Q02T68|RL5_PSEAB | 50S ribosomal protein L5 OS=Pseudomonas aeruginosa (strain UCBPP-PA14) GN=rplE PE=3 SV=1 | 142 | 301 | 5.0E-25 |
| sp|B7V656|RL5_PSEA8 | 50S ribosomal protein L5 OS=Pseudomonas aeruginosa (strain LESB58) GN=rplE PE=3 SV=1 | 142 | 301 | 5.0E-25 |
| sp|Q8R7W6|RL5_CALS4 | 50S ribosomal protein L5 OS=Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4) GN=rplE PE=3 SV=1 | 142 | 301 | 5.0E-25 |
| sp|A4WFB6|RL5_ENT38 | 50S ribosomal protein L5 OS=Enterobacter sp. (strain 638) GN=rplE PE=3 SV=1 | 140 | 301 | 5.0E-25 |
| sp|Q0ANR2|RL5_MARMM | 50S ribosomal protein L5 OS=Maricaulis maris (strain MCS10) GN=rplE PE=3 SV=1 | 142 | 301 | 6.0E-25 |
| sp|Q39XZ4|RL5_GEOMG | 50S ribosomal protein L5 OS=Geobacter metallireducens (strain GS-15 / ATCC 53774 / DSM 7210) GN=rplE PE=3 SV=1 | 142 | 301 | 6.0E-25 |
| sp|B7KHZ9|RL5_CYAP7 | 50S ribosomal protein L5 OS=Cyanothece sp. (strain PCC 7424) GN=rplE PE=3 SV=1 | 142 | 301 | 6.0E-25 |
| sp|A6UZK0|RL5_PSEA7 | 50S ribosomal protein L5 OS=Pseudomonas aeruginosa (strain PA7) GN=rplE PE=3 SV=1 | 142 | 301 | 6.0E-25 |
| sp|C4KZN4|RL5_EXISA | 50S ribosomal protein L5 OS=Exiguobacterium sp. (strain ATCC BAA-1283 / AT1b) GN=rplE PE=3 SV=1 | 145 | 301 | 6.0E-25 |
| sp|B0TC68|RL5_HELMI | 50S ribosomal protein L5 OS=Heliobacterium modesticaldum (strain ATCC 51547 / Ice1) GN=rplE PE=3 SV=1 | 142 | 301 | 7.0E-25 |
| sp|A7Z0Q0|RL5_BACMF | 50S ribosomal protein L5 OS=Bacillus methylotrophicus (strain DSM 23117 / BGSC 10A6 / FZB42) GN=rplE PE=3 SV=1 | 145 | 301 | 7.0E-25 |
| sp|A0LIK2|RL5_SYNFM | 50S ribosomal protein L5 OS=Syntrophobacter fumaroxidans (strain DSM 10017 / MPOB) GN=rplE PE=3 SV=1 | 145 | 301 | 7.0E-25 |
| sp|Q65P95|RL5_BACLD | 50S ribosomal protein L5 OS=Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / NBRC 12200 / NCIMB 9375 / NRRL NRS-1264 / Gibson 46) GN=rplE PE=3 SV=1 | 145 | 301 | 7.0E-25 |
| sp|Q5FTZ5|RL5_GLUOX | 50S ribosomal protein L5 OS=Gluconobacter oxydans (strain 621H) GN=rplE PE=3 SV=1 | 145 | 301 | 7.0E-25 |
| sp|Q5L411|RL5_GEOKA | 50S ribosomal protein L5 OS=Geobacillus kaustophilus (strain HTA426) GN=rplE PE=3 SV=1 | 145 | 301 | 8.0E-25 |
| sp|A7GK32|RL5_BACCN | 50S ribosomal protein L5 OS=Bacillus cytotoxicus (strain DSM 22905 / CIP 110041 / 391-98 / NVH 391-98) GN=rplE PE=3 SV=1 | 145 | 301 | 8.0E-25 |
| sp|P44346|RL5_HAEIN | 50S ribosomal protein L5 OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=rplE PE=3 SV=2 | 145 | 301 | 8.0E-25 |
| sp|A5UHU3|RL5_HAEIG | 50S ribosomal protein L5 OS=Haemophilus influenzae (strain PittGG) GN=rplE PE=3 SV=1 | 145 | 301 | 8.0E-25 |
| sp|A5UDT5|RL5_HAEIE | 50S ribosomal protein L5 OS=Haemophilus influenzae (strain PittEE) GN=rplE PE=3 SV=1 | 145 | 301 | 8.0E-25 |
| sp|Q4QMA9|RL5_HAEI8 | 50S ribosomal protein L5 OS=Haemophilus influenzae (strain 86-028NP) GN=rplE PE=3 SV=1 | 145 | 301 | 8.0E-25 |
| sp|Q7VKE5|RL5_HAEDU | 50S ribosomal protein L5 OS=Haemophilus ducreyi (strain 35000HP / ATCC 700724) GN=rplE PE=3 SV=1 | 145 | 301 | 8.0E-25 |
| sp|C5D3S9|RL5_GEOSW | 50S ribosomal protein L5 OS=Geobacillus sp. (strain WCH70) GN=rplE PE=3 SV=1 | 145 | 301 | 9.0E-25 |
| sp|B5XJ48|RL5_STRPZ | 50S ribosomal protein L5 OS=Streptococcus pyogenes serotype M49 (strain NZ131) GN=rplE PE=3 SV=1 | 130 | 301 | 9.0E-25 |
| sp|B1XJS7|RL5_SYNP2 | 50S ribosomal protein L5 OS=Synechococcus sp. (strain ATCC 27264 / PCC 7002 / PR-6) GN=rplE PE=3 SV=1 | 142 | 301 | 9.0E-25 |
| sp|Q6CZY2|RL5_PECAS | 50S ribosomal protein L5 OS=Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) GN=rplE PE=3 SV=1 | 140 | 301 | 1.0E-24 |
| sp|B0T2D4|RL5_CAUSK | 50S ribosomal protein L5 OS=Caulobacter sp. (strain K31) GN=rplE PE=3 SV=1 | 126 | 301 | 1.0E-24 |
| sp|A8G1D6|RL5_SHESH | 50S ribosomal protein L5 OS=Shewanella sediminis (strain HAW-EB3) GN=rplE PE=3 SV=1 | 145 | 301 | 1.0E-24 |
| sp|A1ALV3|RL5_PELPD | 50S ribosomal protein L5 OS=Pelobacter propionicus (strain DSM 2379) GN=rplE PE=3 SV=1 | 142 | 301 | 1.0E-24 |
| sp|A6VLK0|RL5_ACTSZ | 50S ribosomal protein L5 OS=Actinobacillus succinogenes (strain ATCC 55618 / 130Z) GN=rplE PE=3 SV=1 | 145 | 301 | 1.0E-24 |
| sp|Q6XYX6|RL5_SPIKU | 50S ribosomal protein L5 OS=Spiroplasma kunkelii GN=rplE PE=3 SV=1 | 145 | 301 | 1.0E-24 |
| sp|A5GVX2|RL5_SYNR3 | 50S ribosomal protein L5 OS=Synechococcus sp. (strain RCC307) GN=rplE PE=3 SV=1 | 142 | 301 | 1.0E-24 |
| sp|A1S230|RL5_SHEAM | 50S ribosomal protein L5 OS=Shewanella amazonensis (strain ATCC BAA-1098 / SB2B) GN=rplE PE=3 SV=1 | 145 | 301 | 1.0E-24 |
| sp|Q8DS25|RL5_STRMU | 50S ribosomal protein L5 OS=Streptococcus mutans serotype c (strain ATCC 700610 / UA159) GN=rplE PE=3 SV=1 | 146 | 301 | 1.0E-24 |
| sp|B5YDV5|RL5_DICT6 | 50S ribosomal protein L5 OS=Dictyoglomus thermophilum (strain ATCC 35947 / DSM 3960 / H-6-12) GN=rplE PE=3 SV=1 | 146 | 301 | 1.0E-24 |
| sp|Q2NQN4|RL5_SODGM | 50S ribosomal protein L5 OS=Sodalis glossinidius (strain morsitans) GN=rplE PE=3 SV=1 | 145 | 301 | 1.0E-24 |
| sp|A4IJK0|RL5_GEOTN | 50S ribosomal protein L5 OS=Geobacillus thermodenitrificans (strain NG80-2) GN=rplE PE=3 SV=1 | 145 | 301 | 1.0E-24 |
| sp|Q3IJJ7|RL5_PSEHT | 50S ribosomal protein L5 OS=Pseudoalteromonas haloplanktis (strain TAC 125) GN=rplE PE=3 SV=1 | 145 | 301 | 1.0E-24 |
| sp|P08895|RL5_GEOSE | 50S ribosomal protein L5 OS=Geobacillus stearothermophilus GN=rplE PE=1 SV=1 | 145 | 301 | 1.0E-24 |
| sp|A8F997|RL5_BACP2 | 50S ribosomal protein L5 OS=Bacillus pumilus (strain SAFR-032) GN=rplE PE=3 SV=1 | 145 | 301 | 1.0E-24 |
| sp|Q88QM3|RL5_PSEPK | 50S ribosomal protein L5 OS=Pseudomonas putida (strain KT2440) GN=rplE PE=3 SV=1 | 142 | 301 | 2.0E-24 |
| sp|B0KK79|RL5_PSEPG | 50S ribosomal protein L5 OS=Pseudomonas putida (strain GB-1) GN=rplE PE=3 SV=1 | 142 | 301 | 2.0E-24 |
| sp|A5VXQ9|RL5_PSEP1 | 50S ribosomal protein L5 OS=Pseudomonas putida (strain F1 / ATCC 700007) GN=rplE PE=3 SV=1 | 142 | 301 | 2.0E-24 |
| sp|P12877|RL5_BACSU | 50S ribosomal protein L5 OS=Bacillus subtilis (strain 168) GN=rplE PE=1 SV=1 | 145 | 301 | 2.0E-24 |
| sp|Q6HPP6|RL5_BACHK | 50S ribosomal protein L5 OS=Bacillus thuringiensis subsp. konkukian (strain 97-27) GN=rplE PE=3 SV=1 | 145 | 301 | 2.0E-24 |
| sp|Q63H78|RL5_BACCZ | 50S ribosomal protein L5 OS=Bacillus cereus (strain ZK / E33L) GN=rplE PE=3 SV=1 | 145 | 301 | 2.0E-24 |
| sp|Q81J30|RL5_BACCR | 50S ribosomal protein L5 OS=Bacillus cereus (strain ATCC 14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL B-3711) GN=rplE PE=3 SV=1 | 145 | 301 | 2.0E-24 |
| sp|B7HJ60|RL5_BACC4 | 50S ribosomal protein L5 OS=Bacillus cereus (strain B4264) GN=rplE PE=3 SV=1 | 145 | 301 | 2.0E-24 |
| sp|C1ET51|RL5_BACC3 | 50S ribosomal protein L5 OS=Bacillus cereus (strain 03BB102) GN=rplE PE=3 SV=1 | 145 | 301 | 2.0E-24 |
| sp|B7JKD1|RL5_BACC0 | 50S ribosomal protein L5 OS=Bacillus cereus (strain AH820) GN=rplE PE=3 SV=1 | 145 | 301 | 2.0E-24 |
| sp|A0R8J2|RL5_BACAH | 50S ribosomal protein L5 OS=Bacillus thuringiensis (strain Al Hakam) GN=rplE PE=3 SV=1 | 145 | 301 | 2.0E-24 |
| sp|Q2S3Q2|RL5_SALRD | 50S ribosomal protein L5 OS=Salinibacter ruber (strain DSM 13855 / M31) GN=rplE PE=3 SV=1 | 145 | 304 | 2.0E-24 |
| sp|B1JAK0|RL5_PSEPW | 50S ribosomal protein L5 OS=Pseudomonas putida (strain W619) GN=rplE PE=3 SV=1 | 142 | 301 | 2.0E-24 |
| sp|Q81VR8|RL5_BACAN | 50S ribosomal protein L5 OS=Bacillus anthracis GN=rplE PE=3 SV=1 | 145 | 301 | 2.0E-24 |
| sp|C3LJ94|RL5_BACAC | 50S ribosomal protein L5 OS=Bacillus anthracis (strain CDC 684 / NRRL 3495) GN=rplE PE=3 SV=1 | 145 | 301 | 2.0E-24 |
| sp|C3P9R7|RL5_BACAA | 50S ribosomal protein L5 OS=Bacillus anthracis (strain A0248) GN=rplE PE=3 SV=1 | 145 | 301 | 2.0E-24 |
| sp|B9M6G6|RL5_GEODF | 50S ribosomal protein L5 OS=Geobacter daltonii (strain DSM 22248 / JCM 15807 / FRC-32) GN=rplE PE=3 SV=1 | 142 | 301 | 2.0E-24 |
| sp|P0DE57|RL5_STRPQ | 50S ribosomal protein L5 OS=Streptococcus pyogenes serotype M3 (strain SSI-1) GN=rplE PE=3 SV=1 | 130 | 301 | 2.0E-24 |
| sp|Q48VT7|RL5_STRPM | 50S ribosomal protein L5 OS=Streptococcus pyogenes serotype M28 (strain MGAS6180) GN=rplE PE=3 SV=1 | 130 | 301 | 2.0E-24 |
| sp|A2RC26|RL5_STRPG | 50S ribosomal protein L5 OS=Streptococcus pyogenes serotype M5 (strain Manfredo) GN=rplE PE=3 SV=1 | 130 | 301 | 2.0E-24 |
| sp|Q1J901|RL5_STRPF | 50S ribosomal protein L5 OS=Streptococcus pyogenes serotype M4 (strain MGAS10750) GN=rplE PE=3 SV=1 | 130 | 301 | 2.0E-24 |
| sp|Q1JJ50|RL5_STRPD | 50S ribosomal protein L5 OS=Streptococcus pyogenes serotype M2 (strain MGAS10270) GN=rplE PE=3 SV=1 | 130 | 301 | 2.0E-24 |
| sp|Q1JP05|RL5_STRPC | 50S ribosomal protein L5 OS=Streptococcus pyogenes serotype M12 (strain MGAS9429) GN=rplE PE=3 SV=1 | 130 | 301 | 2.0E-24 |
| sp|Q1JE46|RL5_STRPB | 50S ribosomal protein L5 OS=Streptococcus pyogenes serotype M12 (strain MGAS2096) GN=rplE PE=3 SV=1 | 130 | 301 | 2.0E-24 |
| sp|Q7CNP5|RL5_STRP8 | 50S ribosomal protein L5 OS=Streptococcus pyogenes serotype M18 (strain MGAS8232) GN=rplE PE=3 SV=1 | 130 | 301 | 2.0E-24 |
| sp|Q5XEC3|RL5_STRP6 | 50S ribosomal protein L5 OS=Streptococcus pyogenes serotype M6 (strain ATCC BAA-946 / MGAS10394) GN=rplE PE=3 SV=1 | 130 | 301 | 2.0E-24 |
| sp|P0DE56|RL5_STRP3 | 50S ribosomal protein L5 OS=Streptococcus pyogenes serotype M3 (strain ATCC BAA-595 / MGAS315) GN=rplE PE=3 SV=1 | 130 | 301 | 2.0E-24 |
| sp|Q9A1W2|RL5_STRP1 | 50S ribosomal protein L5 OS=Streptococcus pyogenes serotype M1 GN=rplE PE=3 SV=1 | 130 | 301 | 2.0E-24 |
| sp|Q9PE64|RL5_XYLFA | 50S ribosomal protein L5 OS=Xylella fastidiosa (strain 9a5c) GN=rplE PE=3 SV=1 | 146 | 301 | 2.0E-24 |
| sp|Q87E70|RL5_XYLFT | 50S ribosomal protein L5 OS=Xylella fastidiosa (strain Temecula1 / ATCC 700964) GN=rplE PE=3 SV=1 | 146 | 301 | 2.0E-24 |
| sp|B2I8I1|RL5_XYLF2 | 50S ribosomal protein L5 OS=Xylella fastidiosa (strain M23) GN=rplE PE=3 SV=1 | 146 | 301 | 2.0E-24 |
| sp|A0KF33|RL5_AERHH | 50S ribosomal protein L5 OS=Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / JCM 1027 / KCTC 2358 / NCIMB 9240) GN=rplE PE=3 SV=1 | 145 | 301 | 2.0E-24 |
| sp|Q2JQN2|RL5_SYNJA | 50S ribosomal protein L5 OS=Synechococcus sp. (strain JA-3-3Ab) GN=rplE PE=3 SV=1 | 134 | 301 | 2.0E-24 |
| sp|B8CNE5|RL5_SHEPW | 50S ribosomal protein L5 OS=Shewanella piezotolerans (strain WP3 / JCM 13877) GN=rplE PE=3 SV=1 | 145 | 301 | 2.0E-24 |
| sp|A9B423|RL5_HERA2 | 50S ribosomal protein L5 OS=Herpetosiphon aurantiacus (strain ATCC 23779 / DSM 785) GN=rplE PE=3 SV=1 | 145 | 301 | 2.0E-24 |
| sp|A4SSZ4|RL5_AERS4 | 50S ribosomal protein L5 OS=Aeromonas salmonicida (strain A449) GN=rplE PE=3 SV=1 | 145 | 301 | 2.0E-24 |
| sp|B2FQJ6|RL5_STRMK | 50S ribosomal protein L5 OS=Stenotrophomonas maltophilia (strain K279a) GN=rplE PE=3 SV=1 | 145 | 301 | 2.0E-24 |
| sp|B1KMX1|RL5_SHEWM | 50S ribosomal protein L5 OS=Shewanella woodyi (strain ATCC 51908 / MS32) GN=rplE PE=3 SV=1 | 145 | 301 | 2.0E-24 |
| sp|B4SKX5|RL5_STRM5 | 50S ribosomal protein L5 OS=Stenotrophomonas maltophilia (strain R551-3) GN=rplE PE=3 SV=1 | 145 | 301 | 2.0E-24 |
| sp|Q2JIL5|RL5_SYNJB | 50S ribosomal protein L5 OS=Synechococcus sp. (strain JA-2-3B'a(2-13)) GN=rplE PE=3 SV=1 | 134 | 301 | 2.0E-24 |
| sp|A1R8T3|RL5_ARTAT | 50S ribosomal protein L5 OS=Arthrobacter aurescens (strain TC1) GN=rplE PE=3 SV=1 | 142 | 301 | 2.0E-24 |
| sp|A6LLM5|RL5_THEM4 | 50S ribosomal protein L5 OS=Thermosipho melanesiensis (strain DSM 12029 / CIP 104789 / BI429) GN=rplE PE=3 SV=1 | 142 | 301 | 2.0E-24 |
| sp|Q8RIG8|RL5_FUSNN | 50S ribosomal protein L5 OS=Fusobacterium nucleatum subsp. nucleatum (strain ATCC 25586 / CIP 101130 / JCM 8532 / LMG 13131) GN=rplE PE=3 SV=1 | 138 | 301 | 2.0E-24 |
| sp|Q0SQF6|RL5_CLOPS | 50S ribosomal protein L5 OS=Clostridium perfringens (strain SM101 / Type A) GN=rplE PE=3 SV=1 | 142 | 301 | 3.0E-24 |
| sp|Q8XHT5|RL5_CLOPE | 50S ribosomal protein L5 OS=Clostridium perfringens (strain 13 / Type A) GN=rplE PE=3 SV=1 | 142 | 301 | 3.0E-24 |
| sp|Q0TMQ8|RL5_CLOP1 | 50S ribosomal protein L5 OS=Clostridium perfringens (strain ATCC 13124 / DSM 756 / JCM 1290 / NCIMB 6125 / NCTC 8237 / Type A) GN=rplE PE=3 SV=1 | 142 | 301 | 3.0E-24 |
| sp|A1W320|RL5_ACISJ | 50S ribosomal protein L5 OS=Acidovorax sp. (strain JS42) GN=rplE PE=3 SV=1 | 145 | 301 | 3.0E-24 |
| sp|B9MBU9|RL5_ACIET | 50S ribosomal protein L5 OS=Acidovorax ebreus (strain TPSY) GN=rplE PE=3 SV=1 | 145 | 301 | 3.0E-24 |
| sp|Q30Z54|RL5_DESAG | 50S ribosomal protein L5 OS=Desulfovibrio alaskensis (strain G20) GN=rplE PE=3 SV=1 | 135 | 301 | 3.0E-24 |
| sp|C1CPA0|RL5_STRZT | 50S ribosomal protein L5 OS=Streptococcus pneumoniae (strain Taiwan19F-14) GN=rplE PE=3 SV=1 | 134 | 301 | 3.0E-24 |
| sp|C1CIA9|RL5_STRZP | 50S ribosomal protein L5 OS=Streptococcus pneumoniae (strain P1031) GN=rplE PE=3 SV=1 | 134 | 301 | 3.0E-24 |
| sp|C1CC18|RL5_STRZJ | 50S ribosomal protein L5 OS=Streptococcus pneumoniae (strain JJA) GN=rplE PE=3 SV=1 | 134 | 301 | 3.0E-24 |
| sp|Q8CWV4|RL5_STRR6 | 50S ribosomal protein L5 OS=Streptococcus pneumoniae (strain ATCC BAA-255 / R6) GN=rplE PE=3 SV=1 | 134 | 301 | 3.0E-24 |
| sp|B2IS52|RL5_STRPS | 50S ribosomal protein L5 OS=Streptococcus pneumoniae (strain CGSP14) GN=rplE PE=3 SV=1 | 134 | 301 | 3.0E-24 |
| sp|Q97SV1|RL5_STRPN | 50S ribosomal protein L5 OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) GN=rplE PE=3 SV=1 | 134 | 301 | 3.0E-24 |
| sp|B8ZKG9|RL5_STRPJ | 50S ribosomal protein L5 OS=Streptococcus pneumoniae (strain ATCC 700669 / Spain 23F-1) GN=rplE PE=3 SV=1 | 134 | 301 | 3.0E-24 |
| sp|B1I8L0|RL5_STRPI | 50S ribosomal protein L5 OS=Streptococcus pneumoniae (strain Hungary19A-6) GN=rplE PE=3 SV=1 | 134 | 301 | 3.0E-24 |
| sp|C1CAM4|RL5_STRP7 | 50S ribosomal protein L5 OS=Streptococcus pneumoniae (strain 70585) GN=rplE PE=3 SV=1 | 134 | 301 | 3.0E-24 |
| sp|B5E6G7|RL5_STRP4 | 50S ribosomal protein L5 OS=Streptococcus pneumoniae serotype 19F (strain G54) GN=rplE PE=3 SV=1 | 134 | 301 | 3.0E-24 |
| sp|Q04MM4|RL5_STRP2 | 50S ribosomal protein L5 OS=Streptococcus pneumoniae serotype 2 (strain D39 / NCTC 7466) GN=rplE PE=3 SV=1 | 134 | 301 | 3.0E-24 |
| sp|Q1IFV4|RL5_PSEE4 | 50S ribosomal protein L5 OS=Pseudomonas entomophila (strain L48) GN=rplE PE=3 SV=1 | 142 | 301 | 3.0E-24 |
| sp|B6EPT7|RL5_ALISL | 50S ribosomal protein L5 OS=Aliivibrio salmonicida (strain LFI1238) GN=rplE PE=3 SV=1 | 145 | 301 | 3.0E-24 |
| sp|Q03EC8|RL5_PEDPA | 50S ribosomal protein L5 OS=Pediococcus pentosaceus (strain ATCC 25745 / 183-1w) GN=rplE PE=3 SV=1 | 145 | 301 | 3.0E-24 |
| sp|Q7NQG4|RL5_CHRVO | 50S ribosomal protein L5 OS=Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / NBRC 12614 / NCIMB 9131 / NCTC 9757) GN=rplE PE=3 SV=1 | 145 | 301 | 3.0E-24 |
| sp|Q8K962|RL5_BUCAP | 50S ribosomal protein L5 OS=Buchnera aphidicola subsp. Schizaphis graminum (strain Sg) GN=rplE PE=3 SV=1 | 140 | 301 | 3.0E-24 |
| sp|B1MW02|RL5_LEUCK | 50S ribosomal protein L5 OS=Leuconostoc citreum (strain KM20) GN=rplE PE=3 SV=1 | 147 | 301 | 3.0E-24 |
| sp|Q65QW7|RL5_MANSM | 50S ribosomal protein L5 OS=Mannheimia succiniciproducens (strain MBEL55E) GN=rplE PE=3 SV=1 | 145 | 301 | 3.0E-24 |
| sp|Q1R0G3|RL5_CHRSD | 50S ribosomal protein L5 OS=Chromohalobacter salexigens (strain DSM 3043 / ATCC BAA-138 / NCIMB 13768) GN=rplE PE=3 SV=1 | 142 | 301 | 3.0E-24 |
| sp|A6W380|RL5_MARMS | 50S ribosomal protein L5 OS=Marinomonas sp. (strain MWYL1) GN=rplE PE=3 SV=1 | 142 | 301 | 3.0E-24 |
| sp|B7VLE5|RL5_VIBTL | 50S ribosomal protein L5 OS=Vibrio tasmaniensis (strain LGP32) GN=rplE PE=3 SV=1 | 145 | 301 | 3.0E-24 |
| sp|C3LRP6|RL5_VIBCM | 50S ribosomal protein L5 OS=Vibrio cholerae serotype O1 (strain M66-2) GN=rplE PE=3 SV=1 | 145 | 301 | 3.0E-24 |
| sp|Q9KNZ6|RL5_VIBCH | 50S ribosomal protein L5 OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=rplE PE=3 SV=1 | 145 | 301 | 3.0E-24 |
| sp|A5F554|RL5_VIBC3 | 50S ribosomal protein L5 OS=Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395) GN=rplE PE=3 SV=1 | 145 | 301 | 3.0E-24 |
| sp|A0KRN6|RL5_SHESA | 50S ribosomal protein L5 OS=Shewanella sp. (strain ANA-3) GN=rplE PE=3 SV=1 | 145 | 301 | 3.0E-24 |
| sp|B0U5L1|RL5_XYLFM | 50S ribosomal protein L5 OS=Xylella fastidiosa (strain M12) GN=rplE PE=3 SV=1 | 146 | 301 | 3.0E-24 |
| sp|Q73PM0|RL5_TREDE | 50S ribosomal protein L5 OS=Treponema denticola (strain ATCC 35405 / CIP 103919 / DSM 14222) GN=rplE PE=3 SV=1 | 130 | 301 | 4.0E-24 |
| sp|A3Q994|RL5_SHELP | 50S ribosomal protein L5 OS=Shewanella loihica (strain ATCC BAA-1088 / PV-4) GN=rplE PE=3 SV=1 | 145 | 301 | 4.0E-24 |
| sp|Q4FUE4|RL5_PSYA2 | 50S ribosomal protein L5 OS=Psychrobacter arcticus (strain DSM 17307 / 273-4) GN=rplE PE=3 SV=1 | 142 | 301 | 4.0E-24 |
| sp|Q1AU41|RL5_RUBXD | 50S ribosomal protein L5 OS=Rubrobacter xylanophilus (strain DSM 9941 / NBRC 16129) GN=rplE PE=3 SV=1 | 145 | 301 | 4.0E-24 |
| sp|O67568|RL5_AQUAE | 50S ribosomal protein L5 OS=Aquifex aeolicus (strain VF5) GN=rplE PE=3 SV=1 | 134 | 301 | 4.0E-24 |
| sp|C0ZIJ2|RL5_BREBN | 50S ribosomal protein L5 OS=Brevibacillus brevis (strain 47 / JCM 6285 / NBRC 100599) GN=rplE PE=3 SV=1 | 130 | 301 | 4.0E-24 |
| sp|A5WCK2|RL5_PSYWF | 50S ribosomal protein L5 OS=Psychrobacter sp. (strain PRwf-1) GN=rplE PE=3 SV=1 | 142 | 301 | 4.0E-24 |
| sp|B5FG21|RL5_VIBFM | 50S ribosomal protein L5 OS=Vibrio fischeri (strain MJ11) GN=rplE PE=3 SV=1 | 145 | 301 | 4.0E-24 |
| sp|A1VEA4|RL5_DESVV | 50S ribosomal protein L5 OS=Desulfovibrio vulgaris subsp. vulgaris (strain DP4) GN=rplE PE=3 SV=1 | 134 | 301 | 4.0E-24 |
| sp|Q72CG8|RL5_DESVH | 50S ribosomal protein L5 OS=Desulfovibrio vulgaris (strain Hildenborough / ATCC 29579 / NCIMB 8303) GN=rplE PE=3 SV=1 | 134 | 301 | 4.0E-24 |
| sp|A0JZ72|RL5_ARTS2 | 50S ribosomal protein L5 OS=Arthrobacter sp. (strain FB24) GN=rplE PE=3 SV=1 | 142 | 301 | 4.0E-24 |
| sp|A4VHP2|RL5_PSEU5 | 50S ribosomal protein L5 OS=Pseudomonas stutzeri (strain A1501) GN=rplE PE=3 SV=1 | 142 | 301 | 4.0E-24 |
| sp|A4VSG6|RL5_STRSY | 50S ribosomal protein L5 OS=Streptococcus suis (strain 05ZYH33) GN=rplE PE=3 SV=1 | 134 | 301 | 5.0E-24 |
| sp|A4VYQ5|RL5_STRS2 | 50S ribosomal protein L5 OS=Streptococcus suis (strain 98HAH33) GN=rplE PE=3 SV=1 | 134 | 301 | 5.0E-24 |
| sp|Q01WA4|RL5_SOLUE | 50S ribosomal protein L5 OS=Solibacter usitatus (strain Ellin6076) GN=rplE PE=3 SV=1 | 142 | 301 | 5.0E-24 |
| sp|B9IZK6|RL5_BACCQ | 50S ribosomal protein L5 OS=Bacillus cereus (strain Q1) GN=rplE PE=3 SV=1 | 145 | 301 | 5.0E-24 |
| sp|B7HQV6|RL5_BACC7 | 50S ribosomal protein L5 OS=Bacillus cereus (strain AH187) GN=rplE PE=3 SV=1 | 145 | 301 | 5.0E-24 |
| sp|Q73F84|RL5_BACC1 | 50S ribosomal protein L5 OS=Bacillus cereus (strain ATCC 10987 / NRS 248) GN=rplE PE=3 SV=1 | 145 | 301 | 5.0E-24 |
| sp|A2C4Y7|RL5_PROM1 | 50S ribosomal protein L5 OS=Prochlorococcus marinus (strain NATL1A) GN=rplE PE=3 SV=1 | 142 | 304 | 5.0E-24 |
| sp|Q089P2|RL5_SHEFN | 50S ribosomal protein L5 OS=Shewanella frigidimarina (strain NCIMB 400) GN=rplE PE=3 SV=1 | 145 | 301 | 5.0E-24 |
| sp|A4XZ78|RL5_PSEMY | 50S ribosomal protein L5 OS=Pseudomonas mendocina (strain ymp) GN=rplE PE=3 SV=1 | 142 | 301 | 6.0E-24 |
| sp|Q1QDH4|RL5_PSYCK | 50S ribosomal protein L5 OS=Psychrobacter cryohalolentis (strain K5) GN=rplE PE=3 SV=1 | 142 | 301 | 6.0E-24 |
| sp|A1TJS9|RL5_ACIAC | 50S ribosomal protein L5 OS=Acidovorax citrulli (strain AAC00-1) GN=rplE PE=3 SV=1 | 145 | 301 | 6.0E-24 |
| sp|B0TM00|RL5_SHEHH | 50S ribosomal protein L5 OS=Shewanella halifaxensis (strain HAW-EB4) GN=rplE PE=3 SV=1 | 145 | 301 | 6.0E-24 |
| sp|B2GDV7|RL5_LACF3 | 50S ribosomal protein L5 OS=Lactobacillus fermentum (strain NBRC 3956 / LMG 18251) GN=rplE PE=3 SV=1 | 147 | 301 | 6.0E-24 |
| sp|Q46IS1|RL5_PROMT | 50S ribosomal protein L5 OS=Prochlorococcus marinus (strain NATL2A) GN=rplE PE=3 SV=1 | 142 | 304 | 7.0E-24 |
| sp|A8GYY8|RL5_SHEPA | 50S ribosomal protein L5 OS=Shewanella pealeana (strain ATCC 700345 / ANG-SQ1) GN=rplE PE=3 SV=1 | 145 | 301 | 7.0E-24 |
| sp|B1X4Z6|RK5_PAUCH | 50S ribosomal protein L5, organellar chromatophore OS=Paulinella chromatophora GN=rpl5 PE=3 SV=1 | 142 | 301 | 7.0E-24 |
| sp|Q3YWV1|RL5_SHISS | 50S ribosomal protein L5 OS=Shigella sonnei (strain Ss046) GN=rplE PE=3 SV=1 | 140 | 301 | 7.0E-24 |
| sp|Q0SZZ4|RL5_SHIF8 | 50S ribosomal protein L5 OS=Shigella flexneri serotype 5b (strain 8401) GN=rplE PE=3 SV=1 | 140 | 301 | 7.0E-24 |
| sp|Q32B43|RL5_SHIDS | 50S ribosomal protein L5 OS=Shigella dysenteriae serotype 1 (strain Sd197) GN=rplE PE=3 SV=1 | 140 | 301 | 7.0E-24 |
| sp|Q31VW8|RL5_SHIBS | 50S ribosomal protein L5 OS=Shigella boydii serotype 4 (strain Sb227) GN=rplE PE=3 SV=1 | 140 | 301 | 7.0E-24 |
| sp|B2U2S6|RL5_SHIB3 | 50S ribosomal protein L5 OS=Shigella boydii serotype 18 (strain CDC 3083-94 / BS512) GN=rplE PE=3 SV=1 | 140 | 301 | 7.0E-24 |
| sp|A6TEW0|RL5_KLEP7 | 50S ribosomal protein L5 OS=Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578) GN=rplE PE=3 SV=1 | 140 | 301 | 7.0E-24 |
| sp|B7LRS4|RL5_ESCF3 | 50S ribosomal protein L5 OS=Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CDC 0568-73) GN=rplE PE=3 SV=1 | 140 | 301 | 7.0E-24 |
| sp|Q1R620|RL5_ECOUT | 50S ribosomal protein L5 OS=Escherichia coli (strain UTI89 / UPEC) GN=rplE PE=3 SV=1 | 140 | 301 | 7.0E-24 |
| sp|B1LHC2|RL5_ECOSM | 50S ribosomal protein L5 OS=Escherichia coli (strain SMS-3-5 / SECEC) GN=rplE PE=3 SV=1 | 140 | 301 | 7.0E-24 |
| sp|B6I222|RL5_ECOSE | 50S ribosomal protein L5 OS=Escherichia coli (strain SE11) GN=rplE PE=3 SV=1 | 140 | 301 | 7.0E-24 |
| sp|B7NDS9|RL5_ECOLU | 50S ribosomal protein L5 OS=Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC) GN=rplE PE=3 SV=1 | 140 | 301 | 7.0E-24 |
| sp|P62399|RL5_ECOLI | 50S ribosomal protein L5 OS=Escherichia coli (strain K12) GN=rplE PE=1 SV=2 | 140 | 301 | 7.0E-24 |
| sp|B1IPZ1|RL5_ECOLC | 50S ribosomal protein L5 OS=Escherichia coli (strain ATCC 8739 / DSM 1576 / Crooks) GN=rplE PE=3 SV=1 | 140 | 301 | 7.0E-24 |
| sp|P62400|RL5_ECOL6 | 50S ribosomal protein L5 OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=rplE PE=3 SV=2 | 140 | 301 | 7.0E-24 |
| sp|Q0TCF3|RL5_ECOL5 | 50S ribosomal protein L5 OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=rplE PE=3 SV=1 | 140 | 301 | 7.0E-24 |
| sp|A1AGJ7|RL5_ECOK1 | 50S ribosomal protein L5 OS=Escherichia coli O1:K1 / APEC GN=rplE PE=3 SV=1 | 140 | 301 | 7.0E-24 |
| sp|A8A5B3|RL5_ECOHS | 50S ribosomal protein L5 OS=Escherichia coli O9:H4 (strain HS) GN=rplE PE=3 SV=1 | 140 | 301 | 7.0E-24 |
| sp|B1X6G0|RL5_ECODH | 50S ribosomal protein L5 OS=Escherichia coli (strain K12 / DH10B) GN=rplE PE=3 SV=1 | 140 | 301 | 7.0E-24 |
| sp|C4ZUG3|RL5_ECOBW | 50S ribosomal protein L5 OS=Escherichia coli (strain K12 / MC4100 / BW2952) GN=rplE PE=3 SV=1 | 140 | 301 | 7.0E-24 |
| sp|B7M1M2|RL5_ECO8A | 50S ribosomal protein L5 OS=Escherichia coli O8 (strain IAI1) GN=rplE PE=3 SV=1 | 140 | 301 | 7.0E-24 |
| sp|B7N192|RL5_ECO81 | 50S ribosomal protein L5 OS=Escherichia coli O81 (strain ED1a) GN=rplE PE=3 SV=1 | 140 | 301 | 7.0E-24 |
| sp|B7NLM7|RL5_ECO7I | 50S ribosomal protein L5 OS=Escherichia coli O7:K1 (strain IAI39 / ExPEC) GN=rplE PE=3 SV=1 | 140 | 301 | 7.0E-24 |
| sp|B5YTM9|RL5_ECO5E | 50S ribosomal protein L5 OS=Escherichia coli O157:H7 (strain EC4115 / EHEC) GN=rplE PE=3 SV=1 | 140 | 301 | 7.0E-24 |
| sp|P62401|RL5_ECO57 | 50S ribosomal protein L5 OS=Escherichia coli O157:H7 GN=rplE PE=3 SV=2 | 140 | 301 | 7.0E-24 |
| sp|B7L4J7|RL5_ECO55 | 50S ribosomal protein L5 OS=Escherichia coli (strain 55989 / EAEC) GN=rplE PE=3 SV=1 | 140 | 301 | 7.0E-24 |
| sp|B7MCS3|RL5_ECO45 | 50S ribosomal protein L5 OS=Escherichia coli O45:K1 (strain S88 / ExPEC) GN=rplE PE=3 SV=1 | 140 | 301 | 7.0E-24 |
| sp|B7UK32|RL5_ECO27 | 50S ribosomal protein L5 OS=Escherichia coli O127:H6 (strain E2348/69 / EPEC) GN=rplE PE=3 SV=1 | 140 | 301 | 7.0E-24 |
| sp|A7ZSJ7|RL5_ECO24 | 50S ribosomal protein L5 OS=Escherichia coli O139:H28 (strain E24377A / ETEC) GN=rplE PE=3 SV=1 | 140 | 301 | 7.0E-24 |
| sp|A8AQK4|RL5_CITK8 | 50S ribosomal protein L5 OS=Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696) GN=rplE PE=3 SV=1 | 140 | 301 | 7.0E-24 |
| sp|B7K236|RL5_CYAP8 | 50S ribosomal protein L5 OS=Cyanothece sp. (strain PCC 8801) GN=rplE PE=3 SV=1 | 142 | 301 | 7.0E-24 |
| sp|A9KWB4|RL5_SHEB9 | 50S ribosomal protein L5 OS=Shewanella baltica (strain OS195) GN=rplE PE=3 SV=1 | 145 | 301 | 8.0E-24 |
| sp|A6WHU0|RL5_SHEB8 | 50S ribosomal protein L5 OS=Shewanella baltica (strain OS185) GN=rplE PE=3 SV=1 | 145 | 301 | 8.0E-24 |
| sp|A3DA60|RL5_SHEB5 | 50S ribosomal protein L5 OS=Shewanella baltica (strain OS155 / ATCC BAA-1091) GN=rplE PE=3 SV=1 | 145 | 301 | 8.0E-24 |
| sp|B8EBJ3|RL5_SHEB2 | 50S ribosomal protein L5 OS=Shewanella baltica (strain OS223) GN=rplE PE=3 SV=1 | 145 | 301 | 8.0E-24 |
| sp|Q8ETX1|RL5_OCEIH | 50S ribosomal protein L5 OS=Oceanobacillus iheyensis (strain DSM 14371 / JCM 11309 / KCTC 3954 / HTE831) GN=rplE PE=3 SV=1 | 142 | 301 | 8.0E-24 |
| sp|Q7V9X4|RL5_PROMA | 50S ribosomal protein L5 OS=Prochlorococcus marinus (strain SARG / CCMP1375 / SS120) GN=rplE PE=3 SV=1 | 142 | 301 | 8.0E-24 |
| sp|A9VP89|RL5_BACWK | 50S ribosomal protein L5 OS=Bacillus weihenstephanensis (strain KBAB4) GN=rplE PE=3 SV=1 | 145 | 301 | 8.0E-24 |
| sp|A7N0I9|RL5_VIBCB | 50S ribosomal protein L5 OS=Vibrio campbellii (strain ATCC BAA-1116 / BB120) GN=rplE PE=3 SV=1 | 145 | 301 | 8.0E-24 |
| sp|B7IT31|RL5_BACC2 | 50S ribosomal protein L5 OS=Bacillus cereus (strain G9842) GN=rplE PE=3 SV=1 | 145 | 301 | 9.0E-24 |
| sp|A8MLF2|RL5_ALKOO | 50S ribosomal protein L5 OS=Alkaliphilus oremlandii (strain OhILAs) GN=rplE PE=3 SV=1 | 145 | 301 | 9.0E-24 |
| sp|Q04G73|RL5_OENOB | 50S ribosomal protein L5 OS=Oenococcus oeni (strain ATCC BAA-331 / PSU-1) GN=rplE PE=3 SV=1 | 147 | 301 | 9.0E-24 |
| sp|B1VEW6|RL5_CORU7 | 50S ribosomal protein L5 OS=Corynebacterium urealyticum (strain ATCC 43042 / DSM 7109) GN=rplE PE=3 SV=1 | 137 | 304 | 9.0E-24 |
| sp|Q0I093|RL5_SHESR | 50S ribosomal protein L5 OS=Shewanella sp. (strain MR-7) GN=rplE PE=3 SV=1 | 145 | 301 | 1.0E-23 |
| sp|Q0HNS5|RL5_SHESM | 50S ribosomal protein L5 OS=Shewanella sp. (strain MR-4) GN=rplE PE=3 SV=1 | 145 | 301 | 1.0E-23 |
| sp|Q2LQA8|RL5_SYNAS | 50S ribosomal protein L5 OS=Syntrophus aciditrophicus (strain SB) GN=rplE PE=3 SV=1 | 145 | 301 | 1.0E-23 |
| sp|Q8EK57|RL5_SHEON | 50S ribosomal protein L5 OS=Shewanella oneidensis (strain MR-1) GN=rplE PE=3 SV=1 | 145 | 301 | 1.0E-23 |
| sp|Q3K600|RL5_PSEPF | 50S ribosomal protein L5 OS=Pseudomonas fluorescens (strain Pf0-1) GN=rplE PE=3 SV=1 | 142 | 301 | 1.0E-23 |
| sp|Q4K545|RL5_PSEF5 | 50S ribosomal protein L5 OS=Pseudomonas fluorescens (strain Pf-5 / ATCC BAA-477) GN=rplE PE=3 SV=1 | 142 | 301 | 1.0E-23 |
| sp|B8HCZ4|RL5_ARTCA | 50S ribosomal protein L5 OS=Arthrobacter chlorophenolicus (strain ATCC 700700 / DSM 12829 / JCM 12360 / NCIMB 13794 / A6) GN=rplE PE=3 SV=1 | 142 | 301 | 1.0E-23 |
| sp|Q820Q9|RL5_NITEU | 50S ribosomal protein L5 OS=Nitrosomonas europaea (strain ATCC 19718 / NBRC 14298) GN=rplE PE=3 SV=1 | 145 | 301 | 1.0E-23 |
| sp|C5BQ73|RL5_TERTT | 50S ribosomal protein L5 OS=Teredinibacter turnerae (strain ATCC 39867 / T7901) GN=rplE PE=3 SV=1 | 142 | 301 | 1.0E-23 |
| sp|A1REC6|RL5_SHESW | 50S ribosomal protein L5 OS=Shewanella sp. (strain W3-18-1) GN=rplE PE=3 SV=1 | 145 | 301 | 1.0E-23 |
| sp|A4YBX1|RL5_SHEPC | 50S ribosomal protein L5 OS=Shewanella putrefaciens (strain CN-32 / ATCC BAA-453) GN=rplE PE=3 SV=1 | 145 | 301 | 1.0E-23 |
| sp|A3CK75|RL5_STRSV | 50S ribosomal protein L5 OS=Streptococcus sanguinis (strain SK36) GN=rplE PE=3 SV=1 | 146 | 301 | 1.0E-23 |
| sp|Q889V9|RL5_PSESM | 50S ribosomal protein L5 OS=Pseudomonas syringae pv. tomato (strain DC3000) GN=rplE PE=3 SV=1 | 142 | 301 | 1.0E-23 |
| sp|A6LPS3|RL5_CLOB8 | 50S ribosomal protein L5 OS=Clostridium beijerinckii (strain ATCC 51743 / NCIMB 8052) GN=rplE PE=3 SV=1 | 142 | 301 | 1.0E-23 |
| sp|C3K2W4|RL5_PSEFS | 50S ribosomal protein L5 OS=Pseudomonas fluorescens (strain SBW25) GN=rplE PE=3 SV=1 | 142 | 301 | 2.0E-23 |
| sp|A8AZL3|RL5_STRGC | 50S ribosomal protein L5 OS=Streptococcus gordonii (strain Challis / ATCC 35105 / CH1 / DL1 / V288) GN=rplE PE=3 SV=1 | 146 | 301 | 2.0E-23 |
| sp|Q0ABG3|RL5_ALKEH | 50S ribosomal protein L5 OS=Alkalilimnicola ehrlichii (strain ATCC BAA-1101 / DSM 17681 / MLHE-1) GN=rplE PE=3 SV=1 | 142 | 301 | 2.0E-23 |
| sp|Q4ZMQ6|RL5_PSEU2 | 50S ribosomal protein L5 OS=Pseudomonas syringae pv. syringae (strain B728a) GN=rplE PE=3 SV=1 | 142 | 301 | 2.0E-23 |
| sp|Q48D48|RL5_PSE14 | 50S ribosomal protein L5 OS=Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6) GN=rplE PE=3 SV=1 | 142 | 301 | 2.0E-23 |
| sp|Q89A78|RL5_BUCBP | 50S ribosomal protein L5 OS=Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp) GN=rplE PE=3 SV=1 | 141 | 301 | 2.0E-23 |
| sp|Q03ZN3|RL5_LEUMM | 50S ribosomal protein L5 OS=Leuconostoc mesenteroides subsp. mesenteroides (strain ATCC 8293 / NCDO 523) GN=rplE PE=3 SV=1 | 135 | 301 | 2.0E-23 |
| sp|Q1WSA2|RL5_LACS1 | 50S ribosomal protein L5 OS=Lactobacillus salivarius (strain UCC118) GN=rplE PE=3 SV=1 | 134 | 301 | 2.0E-23 |
| sp|Q7MPH6|RL5_VIBVY | 50S ribosomal protein L5 OS=Vibrio vulnificus (strain YJ016) GN=rplE PE=3 SV=1 | 145 | 301 | 2.0E-23 |
| sp|Q8DE51|RL5_VIBVU | 50S ribosomal protein L5 OS=Vibrio vulnificus (strain CMCP6) GN=rplE PE=3 SV=2 | 145 | 301 | 2.0E-23 |
| sp|B7IHV8|RL5_THEAB | 50S ribosomal protein L5 OS=Thermosipho africanus (strain TCF52B) GN=rplE PE=3 SV=1 | 142 | 301 | 2.0E-23 |
| sp|A7HM40|RL5_FERNB | 50S ribosomal protein L5 OS=Fervidobacterium nodosum (strain ATCC 35602 / DSM 5306 / Rt17-B1) GN=rplE PE=3 SV=1 | 134 | 301 | 2.0E-23 |
| sp|Q8XV24|RL5_RALSO | 50S ribosomal protein L5 OS=Ralstonia solanacearum (strain GMI1000) GN=rplE PE=3 SV=1 | 145 | 301 | 2.0E-23 |
| sp|A1QZS6|RL5_BORT9 | 50S ribosomal protein L5 OS=Borrelia turicatae (strain 91E135) GN=rplE PE=3 SV=1 | 147 | 301 | 2.0E-23 |
| sp|C4L7U2|RL5_TOLAT | 50S ribosomal protein L5 OS=Tolumonas auensis (strain DSM 9187 / TA4) GN=rplE PE=3 SV=1 | 145 | 301 | 2.0E-23 |
| sp|Q1LTC6|RL5_BAUCH | 50S ribosomal protein L5 OS=Baumannia cicadellinicola subsp. Homalodisca coagulata GN=rplE PE=3 SV=1 | 145 | 301 | 2.0E-23 |
| sp|A7MPH6|RL5_CROS8 | 50S ribosomal protein L5 OS=Cronobacter sakazakii (strain ATCC BAA-894) GN=rplE PE=3 SV=1 | 140 | 301 | 2.0E-23 |
| sp|Q7VTB9|RL5_BORPE | 50S ribosomal protein L5 OS=Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251) GN=rplE PE=3 SV=1 | 145 | 301 | 2.0E-23 |
| sp|Q7W2E3|RL5_BORPA | 50S ribosomal protein L5 OS=Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253) GN=rplE PE=3 SV=1 | 145 | 301 | 2.0E-23 |
| sp|Q7WRB1|RL5_BORBR | 50S ribosomal protein L5 OS=Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50) GN=rplE PE=3 SV=1 | 145 | 301 | 2.0E-23 |
| sp|A1WKA4|RL5_VEREI | 50S ribosomal protein L5 OS=Verminephrobacter eiseniae (strain EF01-2) GN=rplE PE=3 SV=1 | 145 | 301 | 3.0E-23 |
| sp|Q1LI49|RL5_CUPMC | 50S ribosomal protein L5 OS=Cupriavidus metallidurans (strain ATCC 43123 / DSM 2839 / NBRC 102507 / CH34) GN=rplE PE=3 SV=1 | 145 | 301 | 3.0E-23 |
| sp|A0ALV6|RL5_LISW6 | 50S ribosomal protein L5 OS=Listeria welshimeri serovar 6b (strain ATCC 35897 / DSM 20650 / SLCC5334) GN=rplE PE=3 SV=1 | 145 | 301 | 3.0E-23 |
| sp|Q927L9|RL5_LISMO | 50S ribosomal protein L5 OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=rplE PE=3 SV=1 | 145 | 301 | 3.0E-23 |
| sp|B8DB20|RL5_LISMH | 50S ribosomal protein L5 OS=Listeria monocytogenes serotype 4a (strain HCC23) GN=rplE PE=3 SV=1 | 145 | 301 | 3.0E-23 |
| sp|Q71WF8|RL5_LISMF | 50S ribosomal protein L5 OS=Listeria monocytogenes serotype 4b (strain F2365) GN=rplE PE=3 SV=1 | 145 | 301 | 3.0E-23 |
| sp|C1KZG8|RL5_LISMC | 50S ribosomal protein L5 OS=Listeria monocytogenes serotype 4b (strain CLIP80459) GN=rplE PE=3 SV=1 | 145 | 301 | 3.0E-23 |
| sp|Q7ANU7|RL5_LISIN | 50S ribosomal protein L5 OS=Listeria innocua serovar 6a (strain CLIP 11262) GN=rplE PE=3 SV=1 | 145 | 301 | 3.0E-23 |
| sp|A8ZV69|RL5_DESOH | 50S ribosomal protein L5 OS=Desulfococcus oleovorans (strain DSM 6200 / Hxd3) GN=rplE PE=3 SV=1 | 142 | 301 | 3.0E-23 |
| sp|A5V5Z0|RL5_SPHWW | 50S ribosomal protein L5 OS=Sphingomonas wittichii (strain RW1 / DSM 6014 / JCM 10273) GN=rplE PE=3 SV=1 | 142 | 301 | 3.0E-23 |
| sp|Q88XX4|RL5_LACPL | 50S ribosomal protein L5 OS=Lactobacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1) GN=rplE PE=3 SV=1 | 145 | 301 | 3.0E-23 |
| sp|B6J5E4|RL5_COXB1 | 50S ribosomal protein L5 OS=Coxiella burnetii (strain CbuK_Q154) GN=rplE PE=3 SV=1 | 135 | 301 | 3.0E-23 |
| sp|Q8UE30|RL5_AGRFC | 50S ribosomal protein L5 OS=Agrobacterium fabrum (strain C58 / ATCC 33970) GN=rplE PE=3 SV=1 | 142 | 303 | 3.0E-23 |
| sp|Q2YAY5|RL5_NITMU | 50S ribosomal protein L5 OS=Nitrosospira multiformis (strain ATCC 25196 / NCIMB 11849) GN=rplE PE=3 SV=1 | 145 | 301 | 3.0E-23 |
| sp|Q7U4I8|RL5_SYNPX | 50S ribosomal protein L5 OS=Synechococcus sp. (strain WH8102) GN=rplE PE=3 SV=1 | 142 | 301 | 3.0E-23 |
| sp|C4XLY5|RL5_DESMR | 50S ribosomal protein L5 OS=Desulfovibrio magneticus (strain ATCC 700980 / DSM 13731 / RS-1) GN=rplE PE=3 SV=1 | 145 | 301 | 3.0E-23 |
| sp|O24701|RL5_SYNP6 | 50S ribosomal protein L5 OS=Synechococcus sp. (strain ATCC 27144 / PCC 6301 / SAUG 1402/1) GN=rplE PE=3 SV=1 | 142 | 301 | 3.0E-23 |
| sp|Q31L19|RL5_SYNE7 | 50S ribosomal protein L5 OS=Synechococcus elongatus (strain PCC 7942) GN=rplE PE=3 SV=1 | 142 | 301 | 3.0E-23 |
| sp|A9IHT8|RL5_BORPD | 50S ribosomal protein L5 OS=Bordetella petrii (strain ATCC BAA-461 / DSM 12804 / CCUG 43448) GN=rplE PE=3 SV=1 | 145 | 301 | 3.0E-23 |
| sp|Q83ER4|RL5_COXBU | 50S ribosomal protein L5 OS=Coxiella burnetii (strain RSA 493 / Nine Mile phase I) GN=rplE PE=3 SV=1 | 135 | 301 | 3.0E-23 |
| sp|A9KD19|RL5_COXBN | 50S ribosomal protein L5 OS=Coxiella burnetii (strain Dugway 5J108-111) GN=rplE PE=3 SV=1 | 135 | 301 | 3.0E-23 |
| sp|B6J251|RL5_COXB2 | 50S ribosomal protein L5 OS=Coxiella burnetii (strain CbuG_Q212) GN=rplE PE=3 SV=1 | 135 | 301 | 3.0E-23 |
| sp|A9NAY2|RL5_COXBR | 50S ribosomal protein L5 OS=Coxiella burnetii (strain RSA 331 / Henzerling II) GN=rplE PE=3 SV=1 | 135 | 301 | 3.0E-23 |
| sp|Q5E8A2|RL5_VIBF1 | 50S ribosomal protein L5 OS=Vibrio fischeri (strain ATCC 700601 / ES114) GN=rplE PE=3 SV=1 | 145 | 301 | 4.0E-23 |
| sp|Q6MSN8|RL5_MYCMS | 50S ribosomal protein L5 OS=Mycoplasma mycoides subsp. mycoides SC (strain PG1) GN=rplE PE=3 SV=1 | 134 | 301 | 4.0E-23 |
| sp|B9KLA3|RL5_RHOSK | 50S ribosomal protein L5 OS=Rhodobacter sphaeroides (strain KD131 / KCTC 12085) GN=rplE PE=3 SV=1 | 142 | 301 | 4.0E-23 |
| sp|Q3J5R0|RL5_RHOS4 | 50S ribosomal protein L5 OS=Rhodobacter sphaeroides (strain ATCC 17023 / 2.4.1 / NCIB 8253 / DSM 158) GN=rplE PE=3 SV=1 | 142 | 301 | 4.0E-23 |
| sp|A9BRW3|RL5_DELAS | 50S ribosomal protein L5 OS=Delftia acidovorans (strain DSM 14801 / SPH-1) GN=rplE PE=3 SV=1 | 145 | 301 | 4.0E-23 |
| sp|A3PGM3|RL5_RHOS1 | 50S ribosomal protein L5 OS=Rhodobacter sphaeroides (strain ATCC 17029 / ATH 2.4.9) GN=rplE PE=3 SV=1 | 142 | 301 | 4.0E-23 |
| sp|Q3B6F0|RL5_CHLL7 | 50S ribosomal protein L5 OS=Chlorobium luteolum (strain DSM 273 / 2530) GN=rplE PE=3 SV=1 | 142 | 304 | 5.0E-23 |
| sp|P14807|RK5_CYAPA | 50S ribosomal protein L5, cyanelle OS=Cyanophora paradoxa GN=rpl5 PE=3 SV=2 | 142 | 301 | 5.0E-23 |
| sp|A4SCS1|RL5_CHLPM | 50S ribosomal protein L5 OS=Chlorobium phaeovibrioides (strain DSM 265 / 1930) GN=rplE PE=3 SV=1 | 142 | 306 | 5.0E-23 |
| sp|Q2L279|RL5_BORA1 | 50S ribosomal protein L5 OS=Bordetella avium (strain 197N) GN=rplE PE=3 SV=1 | 145 | 301 | 5.0E-23 |
| sp|C5CC50|RL5_MICLC | 50S ribosomal protein L5 OS=Micrococcus luteus (strain ATCC 4698 / DSM 20030 / JCM 1464 / NBRC 3333 / NCIMB 9278 / NCTC 2665 / VKM Ac-2230) GN=rplE PE=3 SV=1 | 142 | 301 | 5.0E-23 |
| sp|Q6A6N8|RL5_PROAC | 50S ribosomal protein L5 OS=Propionibacterium acnes (strain KPA171202 / DSM 16379) GN=rplE PE=3 SV=1 | 146 | 301 | 6.0E-23 |
| sp|B2UEK7|RL5_RALPJ | 50S ribosomal protein L5 OS=Ralstonia pickettii (strain 12J) GN=rplE PE=3 SV=1 | 145 | 301 | 6.0E-23 |
| sp|A6GZ87|RL5_FLAPJ | 50S ribosomal protein L5 OS=Flavobacterium psychrophilum (strain JIP02/86 / ATCC 49511) GN=rplE PE=3 SV=1 | 142 | 301 | 6.0E-23 |
| sp|A6T3J2|RL5_JANMA | 50S ribosomal protein L5 OS=Janthinobacterium sp. (strain Marseille) GN=rplE PE=3 SV=1 | 145 | 301 | 7.0E-23 |
| sp|Q5P320|RL5_AROAE | 50S ribosomal protein L5 OS=Aromatoleum aromaticum (strain EbN1) GN=rplE PE=3 SV=1 | 145 | 301 | 7.0E-23 |
| sp|Q12SU7|RL5_SHEDO | 50S ribosomal protein L5 OS=Shewanella denitrificans (strain OS217 / ATCC BAA-1090 / DSM 15013) GN=rplE PE=3 SV=1 | 145 | 301 | 7.0E-23 |
| sp|Q47J91|RL5_DECAR | 50S ribosomal protein L5 OS=Dechloromonas aromatica (strain RCB) GN=rplE PE=3 SV=1 | 145 | 301 | 7.0E-23 |
| sp|A1KB15|RL5_AZOSB | 50S ribosomal protein L5 OS=Azoarcus sp. (strain BH72) GN=rplE PE=3 SV=1 | 145 | 301 | 7.0E-23 |
| sp|P10136|RL5_MYCCT | 50S ribosomal protein L5 OS=Mycoplasma capricolum subsp. capricolum (strain California kid / ATCC 27343 / NCTC 10154) GN=rplE PE=3 SV=2 | 134 | 301 | 8.0E-23 |
| sp|A4G9S6|RL5_HERAR | 50S ribosomal protein L5 OS=Herminiimonas arsenicoxydans GN=rplE PE=3 SV=1 | 145 | 301 | 8.0E-23 |
| sp|B2S0J3|RL5_BORHD | 50S ribosomal protein L5 OS=Borrelia hermsii (strain HS1 / DAH) GN=rplE PE=3 SV=1 | 147 | 301 | 8.0E-23 |
| sp|Q3SLN7|RL5_THIDA | 50S ribosomal protein L5 OS=Thiobacillus denitrificans (strain ATCC 25259) GN=rplE PE=3 SV=1 | 145 | 301 | 9.0E-23 |
| sp|B4RT40|RL5_ALTMD | 50S ribosomal protein L5 OS=Alteromonas macleodii (strain DSM 17117 / Deep ecotype) GN=rplE PE=3 SV=1 | 145 | 301 | 9.0E-23 |
| sp|A4WVJ6|RL5_RHOS5 | 50S ribosomal protein L5 OS=Rhodobacter sphaeroides (strain ATCC 17025 / ATH 2.4.3) GN=rplE PE=3 SV=1 | 142 | 301 | 9.0E-23 |
| sp|Q3AMP2|RL5_SYNSC | 50S ribosomal protein L5 OS=Synechococcus sp. (strain CC9605) GN=rplE PE=3 SV=1 | 142 | 301 | 1.0E-22 |
| sp|Q3AW81|RL5_SYNS9 | 50S ribosomal protein L5 OS=Synechococcus sp. (strain CC9902) GN=rplE PE=3 SV=1 | 142 | 301 | 1.0E-22 |
| sp|Q0VSJ1|RL5_ALCBS | 50S ribosomal protein L5 OS=Alcanivorax borkumensis (strain ATCC 700651 / DSM 11573 / NCIMB 13689 / SK2) GN=rplE PE=3 SV=1 | 142 | 301 | 1.0E-22 |
| sp|B8DNA8|RL5_DESVM | 50S ribosomal protein L5 OS=Desulfovibrio vulgaris (strain Miyazaki F / DSM 19637) GN=rplE PE=3 SV=1 | 134 | 301 | 1.0E-22 |
| sp|Q87T01|RL5_VIBPA | 50S ribosomal protein L5 OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) GN=rplE PE=3 SV=1 | 145 | 301 | 1.0E-22 |
| sp|P33098|RL5_MICLU | 50S ribosomal protein L5 OS=Micrococcus luteus GN=rplE PE=3 SV=1 | 142 | 301 | 1.0E-22 |
| sp|B8IYK3|RL5_DESDA | 50S ribosomal protein L5 OS=Desulfovibrio desulfuricans (strain ATCC 27774 / DSM 6949) GN=rplE PE=3 SV=1 | 134 | 301 | 1.0E-22 |
| sp|B6JEX7|RL5_OLICO | 50S ribosomal protein L5 OS=Oligotropha carboxidovorans (strain ATCC 49405 / DSM 1227 / OM5) GN=rplE PE=3 SV=1 | 142 | 301 | 1.0E-22 |
| sp|B1JIX3|RL5_YERPY | 50S ribosomal protein L5 OS=Yersinia pseudotuberculosis serotype O:3 (strain YPIII) GN=rplE PE=3 SV=1 | 145 | 301 | 1.0E-22 |
| sp|Q664T3|RL5_YERPS | 50S ribosomal protein L5 OS=Yersinia pseudotuberculosis serotype I (strain IP32953) GN=rplE PE=3 SV=1 | 145 | 301 | 1.0E-22 |
| sp|A4TH04|RL5_YERPP | 50S ribosomal protein L5 OS=Yersinia pestis (strain Pestoides F) GN=rplE PE=3 SV=1 | 145 | 301 | 1.0E-22 |
| sp|Q1CCV6|RL5_YERPN | 50S ribosomal protein L5 OS=Yersinia pestis bv. Antiqua (strain Nepal516) GN=rplE PE=3 SV=1 | 145 | 301 | 1.0E-22 |
| sp|A9R907|RL5_YERPG | 50S ribosomal protein L5 OS=Yersinia pestis bv. Antiqua (strain Angola) GN=rplE PE=3 SV=1 | 145 | 301 | 1.0E-22 |
| sp|Q8ZJA0|RL5_YERPE | 50S ribosomal protein L5 OS=Yersinia pestis GN=rplE PE=3 SV=1 | 145 | 301 | 1.0E-22 |
| sp|B2K5L8|RL5_YERPB | 50S ribosomal protein L5 OS=Yersinia pseudotuberculosis serotype IB (strain PB1/+) GN=rplE PE=3 SV=1 | 145 | 301 | 1.0E-22 |
| sp|Q1C2V9|RL5_YERPA | 50S ribosomal protein L5 OS=Yersinia pestis bv. Antiqua (strain Antiqua) GN=rplE PE=3 SV=1 | 145 | 301 | 1.0E-22 |
| sp|A7FNM2|RL5_YERP3 | 50S ribosomal protein L5 OS=Yersinia pseudotuberculosis serotype O:1b (strain IP 31758) GN=rplE PE=3 SV=1 | 145 | 301 | 1.0E-22 |
| sp|A8GPD8|RL5_RICAH | 50S ribosomal protein L5 OS=Rickettsia akari (strain Hartford) GN=rplE PE=3 SV=1 | 142 | 302 | 1.0E-22 |
| sp|Q4JT81|RL5_CORJK | 50S ribosomal protein L5 OS=Corynebacterium jeikeium (strain K411) GN=rplE PE=3 SV=1 | 142 | 304 | 1.0E-22 |
| sp|A5N4Q9|RL5_CLOK5 | 50S ribosomal protein L5 OS=Clostridium kluyveri (strain ATCC 8527 / DSM 555 / NCIMB 10680) GN=rplE PE=3 SV=1 | 142 | 304 | 1.0E-22 |
| sp|B9DYC1|RL5_CLOK1 | 50S ribosomal protein L5 OS=Clostridium kluyveri (strain NBRC 12016) GN=rplE PE=3 SV=1 | 142 | 304 | 1.0E-22 |
| sp|A8GT57|RL5_RICRS | 50S ribosomal protein L5 OS=Rickettsia rickettsii (strain Sheila Smith) GN=rplE PE=3 SV=1 | 142 | 302 | 1.0E-22 |
| sp|B0BUP8|RL5_RICRO | 50S ribosomal protein L5 OS=Rickettsia rickettsii (strain Iowa) GN=rplE PE=3 SV=1 | 142 | 302 | 1.0E-22 |
| sp|B4S5B6|RL5_PROA2 | 50S ribosomal protein L5 OS=Prosthecochloris aestuarii (strain DSM 271 / SK 413) GN=rplE PE=3 SV=1 | 142 | 306 | 1.0E-22 |
| sp|Q7V533|RL5_PROMM | 50S ribosomal protein L5 OS=Prochlorococcus marinus (strain MIT 9313) GN=rplE PE=3 SV=1 | 142 | 301 | 1.0E-22 |
| sp|Q5WZK0|RL5_LEGPL | 50S ribosomal protein L5 OS=Legionella pneumophila (strain Lens) GN=rplE PE=3 SV=1 | 145 | 301 | 1.0E-22 |
| sp|A5IHQ2|RL5_LEGPC | 50S ribosomal protein L5 OS=Legionella pneumophila (strain Corby) GN=rplE PE=3 SV=1 | 145 | 301 | 1.0E-22 |
| sp|Q5X847|RL5_LEGPA | 50S ribosomal protein L5 OS=Legionella pneumophila (strain Paris) GN=rplE PE=3 SV=1 | 145 | 301 | 1.0E-22 |
| sp|Q1RHN3|RL5_RICBR | 50S ribosomal protein L5 OS=Rickettsia bellii (strain RML369-C) GN=rplE PE=3 SV=1 | 142 | 302 | 1.0E-22 |
| sp|A8GVC6|RL5_RICB8 | 50S ribosomal protein L5 OS=Rickettsia bellii (strain OSU 85-389) GN=rplE PE=3 SV=1 | 142 | 302 | 1.0E-22 |
| sp|A5GIT3|RL5_SYNPW | 50S ribosomal protein L5 OS=Synechococcus sp. (strain WH7803) GN=rplE PE=3 SV=1 | 142 | 301 | 1.0E-22 |
| sp|B4SBV9|RL5_PELPB | 50S ribosomal protein L5 OS=Pelodictyon phaeoclathratiforme (strain DSM 5477 / BU-1) GN=rplE PE=3 SV=1 | 136 | 306 | 1.0E-22 |
| sp|Q5ZYN1|RL5_LEGPH | 50S ribosomal protein L5 OS=Legionella pneumophila subsp. pneumophila (strain Philadelphia 1 / ATCC 33152 / DSM 7513) GN=rplE PE=3 SV=1 | 145 | 304 | 1.0E-22 |
| sp|P46178|RL5_BUCAK | 50S ribosomal protein L5 OS=Buchnera aphidicola subsp. Acyrthosiphon kondoi GN=rplE PE=3 SV=1 | 145 | 301 | 1.0E-22 |
| sp|B3R7F6|RL5_CUPTR | 50S ribosomal protein L5 OS=Cupriavidus taiwanensis (strain R1 / LMG 19424) GN=rplE PE=3 SV=1 | 145 | 301 | 1.0E-22 |
| sp|Q0K631|RL5_CUPNH | 50S ribosomal protein L5 OS=Cupriavidus necator (strain ATCC 17699 / H16 / DSM 428 / Stanier 337) GN=rplE PE=3 SV=1 | 145 | 301 | 1.0E-22 |
| sp|Q03PW9|RL5_LACBA | 50S ribosomal protein L5 OS=Lactobacillus brevis (strain ATCC 367 / JCM 1170) GN=rplE PE=3 SV=1 | 147 | 303 | 2.0E-22 |
| sp|Q67JV5|RL5_SYMTH | 50S ribosomal protein L5 OS=Symbiobacterium thermophilum (strain T / IAM 14863) GN=rplE PE=3 SV=1 | 135 | 301 | 2.0E-22 |
| sp|Q9TL23|RK5_NEPOL | 50S ribosomal protein L5, chloroplastic OS=Nephroselmis olivacea GN=rpl5 PE=3 SV=1 | 142 | 301 | 2.0E-22 |
| sp|B2VK52|RL5_ERWT9 | 50S ribosomal protein L5 OS=Erwinia tasmaniensis (strain DSM 17950 / Et1/99) GN=rplE PE=3 SV=1 | 140 | 301 | 2.0E-22 |
| sp|A8GKI5|RL5_SERP5 | 50S ribosomal protein L5 OS=Serratia proteamaculans (strain 568) GN=rplE PE=3 SV=1 | 145 | 301 | 2.0E-22 |
| sp|Q46WF6|RL5_CUPPJ | 50S ribosomal protein L5 OS=Cupriavidus pinatubonensis (strain JMP 134 / LMG 1197) GN=rplE PE=3 SV=1 | 145 | 301 | 2.0E-22 |
| sp|A2CC40|RL5_PROM3 | 50S ribosomal protein L5 OS=Prochlorococcus marinus (strain MIT 9303) GN=rplE PE=3 SV=1 | 142 | 301 | 2.0E-22 |
| sp|A8G749|RL5_PROM2 | 50S ribosomal protein L5 OS=Prochlorococcus marinus (strain MIT 9215) GN=rplE PE=3 SV=1 | 160 | 301 | 2.0E-22 |
| sp|Q748Z9|RL5_GEOSL | 50S ribosomal protein L5 OS=Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA) GN=rplE PE=3 SV=1 | 142 | 303 | 2.0E-22 |
| sp|A2BTC5|RL5_PROMS | 50S ribosomal protein L5 OS=Prochlorococcus marinus (strain AS9601) GN=rplE PE=3 SV=1 | 160 | 301 | 2.0E-22 |
| sp|C6DG62|RL5_PECCP | 50S ribosomal protein L5 OS=Pectobacterium carotovorum subsp. carotovorum (strain PC1) GN=rplE PE=3 SV=1 | 140 | 301 | 2.0E-22 |
| sp|Q6F1Y2|RL5_MESFL | 50S ribosomal protein L5 OS=Mesoplasma florum (strain ATCC 33453 / NBRC 100688 / NCTC 11704 / L1) GN=rplE PE=3 SV=1 | 122 | 301 | 2.0E-22 |
| sp|Q47LK5|RL5_THEFY | 50S ribosomal protein L5 OS=Thermobifida fusca (strain YX) GN=rplE PE=3 SV=1 | 142 | 301 | 2.0E-22 |
| sp|Q318J6|RL5_PROM9 | 50S ribosomal protein L5 OS=Prochlorococcus marinus (strain MIT 9312) GN=rplE PE=3 SV=1 | 160 | 301 | 2.0E-22 |
| sp|Q9ZCR7|RL5_RICPR | 50S ribosomal protein L5 OS=Rickettsia prowazekii (strain Madrid E) GN=rplE PE=3 SV=1 | 142 | 302 | 2.0E-22 |
| sp|A3PF35|RL5_PROM0 | 50S ribosomal protein L5 OS=Prochlorococcus marinus (strain MIT 9301) GN=rplE PE=3 SV=1 | 160 | 301 | 2.0E-22 |
| sp|O21252|RM05_RECAM | 60S ribosomal protein L5, mitochondrial OS=Reclinomonas americana GN=RPL5 PE=3 SV=1 | 120 | 301 | 2.0E-22 |
| sp|B4F1J6|RL5_PROMH | 50S ribosomal protein L5 OS=Proteus mirabilis (strain HI4320) GN=rplE PE=3 SV=1 | 145 | 301 | 2.0E-22 |
| sp|A0L5Y5|RL5_MAGMM | 50S ribosomal protein L5 OS=Magnetococcus marinus (strain ATCC BAA-1437 / JCM 17883 / MC-1) GN=rplE PE=3 SV=1 | 142 | 304 | 2.0E-22 |
| sp|C5CQ88|RL5_VARPS | 50S ribosomal protein L5 OS=Variovorax paradoxus (strain S110) GN=rplE PE=3 SV=1 | 145 | 301 | 3.0E-22 |
| sp|B5RPJ4|RL5_BORRA | 50S ribosomal protein L5 OS=Borrelia recurrentis (strain A1) GN=rplE PE=3 SV=1 | 147 | 301 | 3.0E-22 |
| sp|B5RM48|RL5_BORDL | 50S ribosomal protein L5 OS=Borrelia duttonii (strain Ly) GN=rplE PE=3 SV=1 | 147 | 301 | 3.0E-22 |
| sp|Q7UN08|RL5_RHOBA | 50S ribosomal protein L5 OS=Rhodopirellula baltica (strain DSM 10527 / NCIMB 13988 / SH1) GN=rplE PE=3 SV=1 | 142 | 301 | 3.0E-22 |
| sp|B2G8W6|RL5_LACRJ | 50S ribosomal protein L5 OS=Lactobacillus reuteri (strain JCM 1112) GN=rplE PE=3 SV=1 | 147 | 301 | 3.0E-22 |
| sp|A5VLJ3|RL5_LACRD | 50S ribosomal protein L5 OS=Lactobacillus reuteri (strain DSM 20016) GN=rplE PE=3 SV=1 | 147 | 301 | 3.0E-22 |
| sp|Q6AD07|RL5_LEIXX | 50S ribosomal protein L5 OS=Leifsonia xyli subsp. xyli (strain CTCB07) GN=rplE PE=3 SV=1 | 142 | 301 | 3.0E-22 |
| sp|Q9ZI40|RL5_AQUPY | 50S ribosomal protein L5 OS=Aquifex pyrophilus GN=rplE PE=3 SV=2 | 145 | 301 | 3.0E-22 |
| sp|Q0P3L4|RK5_OSTTA | 50S ribosomal protein L5, chloroplastic OS=Ostreococcus tauri GN=rpl5 PE=3 SV=1 | 142 | 301 | 4.0E-22 |
| sp|B3EP49|RL5_CHLPB | 50S ribosomal protein L5 OS=Chlorobium phaeobacteroides (strain BS1) GN=rplE PE=3 SV=1 | 142 | 306 | 4.0E-22 |
| sp|A1VJ27|RL5_POLNA | 50S ribosomal protein L5 OS=Polaromonas naphthalenivorans (strain CJ2) GN=rplE PE=3 SV=1 | 145 | 301 | 4.0E-22 |
| sp|A5USH7|RL5_ROSS1 | 50S ribosomal protein L5 OS=Roseiflexus sp. (strain RS-1) GN=rplE PE=3 SV=1 | 145 | 301 | 4.0E-22 |
| sp|A9NEE5|RL5_ACHLI | 50S ribosomal protein L5 OS=Acholeplasma laidlawii (strain PG-8A) GN=rplE PE=3 SV=1 | 145 | 301 | 4.0E-22 |
| sp|C3PL19|RL5_CORA7 | 50S ribosomal protein L5 OS=Corynebacterium aurimucosum (strain ATCC 700975 / DSM 44827 / CN-1) GN=rplE PE=3 SV=1 | 142 | 301 | 4.0E-22 |
| sp|B8FES3|RL5_DESAA | 50S ribosomal protein L5 OS=Desulfatibacillum alkenivorans (strain AK-01) GN=rplE PE=3 SV=1 | 142 | 301 | 4.0E-22 |
| sp|B3E7U7|RL5_GEOLS | 50S ribosomal protein L5 OS=Geobacter lovleyi (strain ATCC BAA-1151 / DSM 17278 / SZ) GN=rplE PE=3 SV=1 | 142 | 301 | 4.0E-22 |
| SignalP signal predicted | Location (based on Ymax) |
D score (significance: > 0.45) |
|---|---|---|
| No | 1 - 70 | 0.45 |
| Type of sequence | Sequence |
|---|---|
| Locus | Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded. |
| Protein | >OphauB2|3531 MESTTTFTTPQPDQSTVEKFLSGRSNEDQLKLPGTRYQYHPPKYNRGSLHPIQSPPSSDPVARDFRPGPFSFPRL RDTYESTIVPDLLTLTYQHKPPGFTPPQSTKGTLRTWDDSSPYYLNRPKREPRGTSARLPLVEREINFNHIPKLW GISVAMHTPEAAHNKDYIHVARAVMQAITGTYPRVTTTRTSVAAWGSRAGTLGGLKTSLDGARAYEFFDKLVTLV LPKIKDWPGVNQTTGDGSGNVAIGMKPAWMAYFPELEYNFDMYPTKLIPGCYIYIKTTATSDRQGKLLLQSLGLP FYYKLNRHT* |
| Coding | >OphauB2|3531 ATGGAATCCACGACAACTTTTACTACGCCTCAGCCAGACCAGAGCACAGTAGAGAAATTTCTGTCTGGAAGAAGC AATGAGGATCAACTGAAGCTTCCCGGCACTCGCTATCAGTATCATCCTCCAAAGTATAATCGCGGTTCATTGCAC CCCATCCAGTCGCCGCCTTCATCAGATCCGGTCGCACGAGACTTTAGGCCCGGACCCTTCAGCTTTCCCCGGCTC AGGGACACGTACGAGTCGACAATTGTGCCAGATCTCCTAACTCTCACTTATCAACACAAGCCCCCCGGGTTTACG CCACCCCAATCAACAAAGGGCACACTCCGAACTTGGGACGACTCATCTCCCTACTATCTGAACCGGCCGAAGCGA GAGCCTCGAGGCACATCCGCAAGACTTCCCTTGGTGGAGCGCGAAATCAACTTCAACCACATCCCCAAACTCTGG GGAATCTCTGTTGCCATGCACACTCCAGAGGCCGCTCACAACAAAGACTATATACACGTTGCTCGCGCAGTCATG CAGGCTATTACCGGCACCTATCCCCGTGTGACGACAACCAGGACGAGTGTAGCGGCGTGGGGGAGTAGGGCTGGC ACGTTGGGAGGCCTCAAAACGTCACTGGATGGTGCAAGAGCGTATGAGTTTTTTGACAAACTCGTGACCCTGGTG CTTCCCAAGATCAAGGACTGGCCTGGCGTCAACCAAACAACCGGCGATGGCTCGGGCAACGTGGCAATCGGAATG AAGCCAGCATGGATGGCATATTTCCCAGAGCTCGAGTACAACTTTGACATGTATCCTACAAAGCTGATACCTGGC TGTTACATCTATATCAAAACCACCGCCACATCTGATAGACAAGGCAAGCTGCTTCTACAGTCGCTGGGATTGCCC TTTTACTACAAGCTCAACCGCCACACTTGA |
| Transcript | >OphauB2|3531 ATGGAATCCACGACAACTTTTACTACGCCTCAGCCAGACCAGAGCACAGTAGAGAAATTTCTGTCTGGAAGAAGC AATGAGGATCAACTGAAGCTTCCCGGCACTCGCTATCAGTATCATCCTCCAAAGTATAATCGCGGTTCATTGCAC CCCATCCAGTCGCCGCCTTCATCAGATCCGGTCGCACGAGACTTTAGGCCCGGACCCTTCAGCTTTCCCCGGCTC AGGGACACGTACGAGTCGACAATTGTGCCAGATCTCCTAACTCTCACTTATCAACACAAGCCCCCCGGGTTTACG CCACCCCAATCAACAAAGGGCACACTCCGAACTTGGGACGACTCATCTCCCTACTATCTGAACCGGCCGAAGCGA GAGCCTCGAGGCACATCCGCAAGACTTCCCTTGGTGGAGCGCGAAATCAACTTCAACCACATCCCCAAACTCTGG GGAATCTCTGTTGCCATGCACACTCCAGAGGCCGCTCACAACAAAGACTATATACACGTTGCTCGCGCAGTCATG CAGGCTATTACCGGCACCTATCCCCGTGTGACGACAACCAGGACGAGTGTAGCGGCGTGGGGGAGTAGGGCTGGC ACGTTGGGAGGCCTCAAAACGTCACTGGATGGTGCAAGAGCGTATGAGTTTTTTGACAAACTCGTGACCCTGGTG CTTCCCAAGATCAAGGACTGGCCTGGCGTCAACCAAACAACCGGCGATGGCTCGGGCAACGTGGCAATCGGAATG AAGCCAGCATGGATGGCATATTTCCCAGAGCTCGAGTACAACTTTGACATGTATCCTACAAAGCTGATACCTGGC TGTTACATCTATATCAAAACCACCGCCACATCTGATAGACAAGGCAAGCTGCTTCTACAGTCGCTGGGATTGCCC TTTTACTACAAGCTCAACCGCCACACTTGA |
| Gene | >OphauB2|3531 ATGGAATCCACGACAACTTTTACTACGCCTCAGCCAGACCAGAGCACAGTAGAGAAATTTCTGTCTGGAAGAAGC AATGAGGATCAACTGAAGCTTCCCGGCACTCGGTTGGTATCCCGTCATCTAAAGATGATGCCGACATGTGCTGAC CAGAGCCAGCTATCAGTATCATCCTCCAAAGTATAATCGCGGTTCATTGCACCCCATCCAGTCGCCGCCTTCATC AGATCCGGTCGCACGAGACTTTAGGCCCGGACCCTTCAGCTTTCCCCGGCTCAGGGACACGTACGAGTCGACAAT TGTGCCAGATCTCCTAACTCTCACTTATCAACACAAGCCCCCCGGGTTTACGCCACCCCAATCAACAAAGGGCAC ACTCCGAACTTGGGACGACTCATCTCCCTACTATCTGAACCGGCCGAAGCGAGAGCCTCGAGGCACATCCGCAAG ACTTCCCTTGGTGGAGCGCGAAATCAACTTCAACCACATCCCCAAACTCTGGGGAATCTCTGTTGCCATGCACAC TCCAGAGGCCGCTCACAACAAAGACTATATACACGTTGCTCGCGCAGTCATGCAGGCTATTACCGGCACCTATCC CCGTGTGACGACAACCAGGACGAGTGTAGCGGCGTGGGGGAGTAGGGCTGGCACGTTGGGAGGCCTCAAAACGTC ACTGGATGGTGCAAGAGCGTATGAGTTTTTTGACAAACTCGTGACCCTGGTGCTTCCCAAGATCAAGGACTGGCC TGGCGTCAACCAAACAACCGGCGATGGCTCGGGCAACGTGGCAATCGGAATGAAGCCAGCATGGATGGCATATTT CCCAGAGCTCGAGTACAACTTTGACGTGAGTCAATCAGCCTTTATAAGACGGCTAATTACGGTGTAGCTCGTGGC TGACTTGTGCTCTTCTTCATTCTAGATGTATCCTACAAAGCTGATACCTGGCTGTTACATCTATATCAAAACCAC CGCCACATCTGATAGACAAGGCAAGCTGCTTCTACAGTCGCTGGGATTGCCCTTTTACTACAAGCTCAACCGCCA CACTTGA |