Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|3530
Gene name
LocationContig_223:10348..10993
Strand+
Gene length (bp)645
Transcript length (bp)645
Coding sequence length (bp)645
Protein length (aa) 215

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF08609 Fes1 Nucleotide exchange factor Fes1 1.1E-27 6 92

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q4I624|FES1_GIBZE Hsp70 nucleotide exchange factor FES1 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=FES1 PE=3 SV=1 1 210 4.0E-100
sp|Q0CH70|FES1_ASPTN Hsp70 nucleotide exchange factor fes1 OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=fes1 PE=3 SV=1 3 208 1.0E-72
sp|Q9C239|FES1_NEUCR Hsp70 nucleotide exchange factor fes-1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=fes-1 PE=3 SV=1 3 214 1.0E-71
sp|Q2U9E2|FES1_ASPOR Hsp70 nucleotide exchange factor fes1 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=fes1 PE=3 SV=1 3 208 5.0E-71
sp|Q5AYT7|FES1_EMENI Hsp70 nucleotide exchange factor fes1 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=fes1 PE=3 SV=1 3 208 2.0E-70
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q4I624|FES1_GIBZE Hsp70 nucleotide exchange factor FES1 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=FES1 PE=3 SV=1 1 210 4.0E-100
sp|Q0CH70|FES1_ASPTN Hsp70 nucleotide exchange factor fes1 OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=fes1 PE=3 SV=1 3 208 1.0E-72
sp|Q9C239|FES1_NEUCR Hsp70 nucleotide exchange factor fes-1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=fes-1 PE=3 SV=1 3 214 1.0E-71
sp|Q2U9E2|FES1_ASPOR Hsp70 nucleotide exchange factor fes1 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=fes1 PE=3 SV=1 3 208 5.0E-71
sp|Q5AYT7|FES1_EMENI Hsp70 nucleotide exchange factor fes1 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=fes1 PE=3 SV=1 3 208 2.0E-70
sp|Q4WDH3|FES1_ASPFU Hsp70 nucleotide exchange factor fes1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=fes1 PE=3 SV=1 3 208 2.0E-70
sp|Q2GXZ7|FES1_CHAGB Hsp70 nucleotide exchange factor FES1 OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=FES1 PE=3 SV=1 3 212 3.0E-68
sp|A1DLW4|FES1_NEOFI Hsp70 nucleotide exchange factor fes1 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=fes1 PE=3 SV=1 3 176 2.0E-64
sp|A2R4I6|FES1_ASPNC Hsp70 nucleotide exchange factor fes1 OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=fes1 PE=3 SV=1 3 208 1.0E-61
sp|Q1E3S4|FES1_COCIM Hsp70 nucleotide exchange factor FES1 OS=Coccidioides immitis (strain RS) GN=FES1 PE=3 SV=2 3 209 2.0E-59
sp|Q0V4C4|FES1_PHANO Hsp70 nucleotide exchange factor FES1 OS=Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) GN=FES1 PE=3 SV=1 1 209 4.0E-58
sp|Q6FM01|FES1_CANGA Hsp70 nucleotide exchange factor FES1 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=FES1 PE=3 SV=1 9 174 1.0E-35
sp|Q6C239|FES1_YARLI Hsp70 nucleotide exchange factor FES1 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=FES1 PE=3 SV=1 6 170 1.0E-32
sp|A3LUY1|FES1_PICST Hsp70 nucleotide exchange factor FES1 OS=Scheffersomyces stipitis (strain ATCC 58785 / CBS 6054 / NBRC 10063 / NRRL Y-11545) GN=FES1 PE=3 SV=1 6 174 2.0E-32
sp|P38260|FES1_YEAST Hsp70 nucleotide exchange factor FES1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=FES1 PE=1 SV=1 9 172 7.0E-32
sp|Q75B89|FES1_ASHGO Hsp70 nucleotide exchange factor FES1 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=FES1 PE=3 SV=1 6 180 1.0E-31
sp|Q6CNM7|FES1_KLULA Hsp70 nucleotide exchange factor FES1 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=FES1 PE=3 SV=1 9 170 4.0E-28
sp|Q59NN8|FES1_CANAL Hsp70 nucleotide exchange factor FES1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=FES1 PE=3 SV=1 39 175 7.0E-27
sp|Q6BLA1|FES1_DEBHA Hsp70 nucleotide exchange factor FES1 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=FES1 PE=3 SV=2 36 172 1.0E-26
sp|O43030|FES1_SCHPO Hsp70 nucleotide exchange factor fes1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=fes1 PE=1 SV=1 33 169 7.0E-26
sp|Q4P7F2|FES1_USTMA Hsp70 nucleotide exchange factor FES1 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=FES1 PE=3 SV=2 3 175 4.0E-24
sp|P0CN68|FES1_CRYNJ Hsp70 nucleotide exchange factor FES1 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=FES1 PE=3 SV=1 6 171 7.0E-16
sp|P0CN69|FES1_CRYNB Hsp70 nucleotide exchange factor FES1 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=FES1 PE=3 SV=1 6 171 7.0E-16
[Show less]

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup3663
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|2697
Ophiocordyceps australis map64 (Brazil) OphauB2|3530 (this protein)
Ophiocordyceps camponoti-floridani Ophcf2|00628
Ophiocordyceps camponoti-rufipedis Ophun1|7022
Ophiocordyceps kimflemingae Ophio5|5180
Ophiocordyceps subramaniannii Hirsu2|7077

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|3530
MEDKRLNDLLRWGIENSDATRNDAPSGQASSTNLTPEVMSALMGGPSDADLMKASMDIISAPLGDGVTLSDKLVA
FDNFEQLIENLDNANNMSNLGLWTPLLHQLHSDEADLRKMAAWCIGTAVQNNQRTQERLLAVGGLPTLVAMALDT
QNKEDVRRKAVYALSSACRNYQPAMDVCSDELTKAGQPTDAVDAADMEAVDKVMNALREKAQAA*
Coding >OphauB2|3530
ATGGAGGACAAACGACTCAACGATCTTCTCCGATGGGGCATCGAAAACTCTGACGCGACGCGCAACGATGCTCCA
TCAGGCCAAGCTTCCAGCACAAACCTCACGCCCGAGGTCATGTCGGCTCTCATGGGCGGGCCGTCAGACGCGGAT
CTAATGAAGGCCTCAATGGACATCATTTCGGCTCCCCTCGGAGATGGCGTCACGCTCAGCGATAAGCTCGTTGCC
TTTGACAACTTTGAGCAGCTCATTGAAAACCTCGACAATGCCAACAACATGAGCAACCTCGGTCTCTGGACTCCG
CTGCTCCATCAGCTGCACAGCGACGAAGCAGACTTGCGCAAAATGGCTGCCTGGTGCATTGGCACCGCCGTTCAG
AACAATCAGCGGACCCAGGAACGCCTCCTCGCTGTCGGCGGCTTGCCCACCCTCGTTGCAATGGCCCTAGACACA
CAGAACAAGGAGGATGTGAGGAGAAAGGCCGTCTATGCTCTCAGCTCGGCCTGCAGGAATTACCAACCTGCCATG
GATGTCTGTTCTGACGAACTGACAAAAGCTGGTCAGCCCACTGACGCCGTCGACGCCGCCGACATGGAGGCTGTG
GACAAGGTTATGAACGCCTTGAGAGAAAAGGCACAAGCTGCTTAA
Transcript >OphauB2|3530
ATGGAGGACAAACGACTCAACGATCTTCTCCGATGGGGCATCGAAAACTCTGACGCGACGCGCAACGATGCTCCA
TCAGGCCAAGCTTCCAGCACAAACCTCACGCCCGAGGTCATGTCGGCTCTCATGGGCGGGCCGTCAGACGCGGAT
CTAATGAAGGCCTCAATGGACATCATTTCGGCTCCCCTCGGAGATGGCGTCACGCTCAGCGATAAGCTCGTTGCC
TTTGACAACTTTGAGCAGCTCATTGAAAACCTCGACAATGCCAACAACATGAGCAACCTCGGTCTCTGGACTCCG
CTGCTCCATCAGCTGCACAGCGACGAAGCAGACTTGCGCAAAATGGCTGCCTGGTGCATTGGCACCGCCGTTCAG
AACAATCAGCGGACCCAGGAACGCCTCCTCGCTGTCGGCGGCTTGCCCACCCTCGTTGCAATGGCCCTAGACACA
CAGAACAAGGAGGATGTGAGGAGAAAGGCCGTCTATGCTCTCAGCTCGGCCTGCAGGAATTACCAACCTGCCATG
GATGTCTGTTCTGACGAACTGACAAAAGCTGGTCAGCCCACTGACGCCGTCGACGCCGCCGACATGGAGGCTGTG
GACAAGGTTATGAACGCCTTGAGAGAAAAGGCACAAGCTGCTTAA
Gene >OphauB2|3530
ATGGAGGACAAACGACTCAACGATCTTCTCCGATGGGGCATCGAAAACTCTGACGCGACGCGCAACGATGCTCCA
TCAGGCCAAGCTTCCAGCACAAACCTCACGCCCGAGGTCATGTCGGCTCTCATGGGCGGGCCGTCAGACGCGGAT
CTAATGAAGGCCTCAATGGACATCATTTCGGCTCCCCTCGGAGATGGCGTCACGCTCAGCGATAAGCTCGTTGCC
TTTGACAACTTTGAGCAGCTCATTGAAAACCTCGACAATGCCAACAACATGAGCAACCTCGGTCTCTGGACTCCG
CTGCTCCATCAGCTGCACAGCGACGAAGCAGACTTGCGCAAAATGGCTGCCTGGTGCATTGGCACCGCCGTTCAG
AACAATCAGCGGACCCAGGAACGCCTCCTCGCTGTCGGCGGCTTGCCCACCCTCGTTGCAATGGCCCTAGACACA
CAGAACAAGGAGGATGTGAGGAGAAAGGCCGTCTATGCTCTCAGCTCGGCCTGCAGGAATTACCAACCTGCCATG
GATGTCTGTTCTGACGAACTGACAAAAGCTGGTCAGCCCACTGACGCCGTCGACGCCGCCGACATGGAGGCTGTG
GACAAGGTTATGAACGCCTTGAGAGAAAAGGCACAAGCTGCTTAA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail