Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|353
Gene name
LocationContig_103:14675..15827
Strand-
Gene length (bp)1152
Transcript length (bp)1014
Coding sequence length (bp)1014
Protein length (aa) 338

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01284 MARVEL Membrane-associating domain 4.1E-09 22 147

Swissprot hits

(None)

GO

GO Term Description Terminal node
GO:0016020 membrane Yes
GO:0005575 cellular_component No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 44 0.5

Transmembrane Domains

Domain # Start End Length
1 20 42 22
2 52 69 17
3 82 104 22
4 133 155 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|353
MEQPASRPDGSHVLATPVWFFGLRIAQMLLCFIILALSGAVVGNVYLDELGLTLAVSLLSMIALGYMIVSERAPA
CRAGYNVYAVLALDGLLTILWLAAFAAAAARRSRFAYTVVTTDANLYDSLAGMTSAVAGLGAFVWIMFIATFTWT
LISFLTGRKQGRFNFNMDALTATNTAGHAMEHKMDQQPPSNMAAPEQSQTPYQQQPPYMPPTAQSPPPQQMPHDY
PLHQAAQYPAQAQAPSQHAAQQQTFPYSPQHASPYPSSTQHPSTHHLAQQHTSSSQHLPHHNTSSTHHQTAQYSP
QGTPSPTQYPPQQYASQPHPQQYQVPVETRGSELSAQ*
Coding >OphauB2|353
ATGGAGCAGCCAGCATCGAGACCGGATGGAAGCCATGTGCTGGCCACTCCAGTCTGGTTTTTTGGACTGCGCATT
GCACAAATGCTGCTATGCTTCATCATCTTGGCGCTGTCGGGGGCCGTGGTTGGCAATGTCTATCTCGACGAGCTT
GGGCTCACGCTTGCAGTATCGCTGCTTAGCATGATTGCCCTGGGATACATGATTGTCAGTGAGCGCGCGCCCGCC
TGCCGTGCCGGCTACAATGTCTATGCCGTGCTGGCGCTCGATGGGCTCCTCACCATACTATGGCTGGCCGCCTTT
GCAGCTGCAGCGGCCAGGAGGTCGCGCTTTGCCTATACCGTCGTCACCACTGACGCCAACTTGTATGATAGCCTG
GCGGGCATGACGTCGGCTGTTGCTGGTCTAGGCGCCTTTGTGTGGATCATGTTTATTGCCACCTTTACCTGGACC
TTGATTAGCTTCCTCACCGGCCGCAAGCAGGGCCGATTCAACTTTAACATGGACGCCCTGACTGCCACCAACACG
GCTGGACATGCAATGGAACACAAGATGGATCAACAGCCTCCATCTAACATGGCCGCGCCGGAGCAGTCGCAGACG
CCCTACCAGCAACAGCCGCCCTACATGCCTCCCACGGCACAGTCGCCGCCTCCGCAGCAAATGCCGCATGACTAT
CCGCTCCATCAGGCCGCGCAGTATCCCGCCCAGGCCCAGGCGCCTTCTCAGCATGCAGCGCAACAACAGACTTTT
CCCTATTCACCACAGCACGCTTCTCCATATCCTTCATCGACACAGCATCCTTCGACTCATCACCTTGCTCAGCAG
CATACCTCTTCTTCCCAGCATCTTCCACATCACAATACTTCTTCTACTCACCATCAGACCGCTCAGTACTCTCCT
CAGGGCACACCCTCGCCCACACAGTATCCGCCTCAGCAGTATGCCTCGCAGCCGCATCCGCAGCAATATCAAGTC
CCAGTTGAGACTCGAGGGAGTGAGTTGTCGGCACAGTAG
Transcript >OphauB2|353
ATGGAGCAGCCAGCATCGAGACCGGATGGAAGCCATGTGCTGGCCACTCCAGTCTGGTTTTTTGGACTGCGCATT
GCACAAATGCTGCTATGCTTCATCATCTTGGCGCTGTCGGGGGCCGTGGTTGGCAATGTCTATCTCGACGAGCTT
GGGCTCACGCTTGCAGTATCGCTGCTTAGCATGATTGCCCTGGGATACATGATTGTCAGTGAGCGCGCGCCCGCC
TGCCGTGCCGGCTACAATGTCTATGCCGTGCTGGCGCTCGATGGGCTCCTCACCATACTATGGCTGGCCGCCTTT
GCAGCTGCAGCGGCCAGGAGGTCGCGCTTTGCCTATACCGTCGTCACCACTGACGCCAACTTGTATGATAGCCTG
GCGGGCATGACGTCGGCTGTTGCTGGTCTAGGCGCCTTTGTGTGGATCATGTTTATTGCCACCTTTACCTGGACC
TTGATTAGCTTCCTCACCGGCCGCAAGCAGGGCCGATTCAACTTTAACATGGACGCCCTGACTGCCACCAACACG
GCTGGACATGCAATGGAACACAAGATGGATCAACAGCCTCCATCTAACATGGCCGCGCCGGAGCAGTCGCAGACG
CCCTACCAGCAACAGCCGCCCTACATGCCTCCCACGGCACAGTCGCCGCCTCCGCAGCAAATGCCGCATGACTAT
CCGCTCCATCAGGCCGCGCAGTATCCCGCCCAGGCCCAGGCGCCTTCTCAGCATGCAGCGCAACAACAGACTTTT
CCCTATTCACCACAGCACGCTTCTCCATATCCTTCATCGACACAGCATCCTTCGACTCATCACCTTGCTCAGCAG
CATACCTCTTCTTCCCAGCATCTTCCACATCACAATACTTCTTCTACTCACCATCAGACCGCTCAGTACTCTCCT
CAGGGCACACCCTCGCCCACACAGTATCCGCCTCAGCAGTATGCCTCGCAGCCGCATCCGCAGCAATATCAAGTC
CCAGTTGAGACTCGAGGGAGTGAGTTGTCGGCACAGTAG
Gene >OphauB2|353
ATGGAGCAGCCAGCATCGAGACCGGATGGAAGCCATGTGCTGGCCACTCCAGTCTGGTTTTTTGGACTGCGCATT
GCACAAATGCTGCTATGCTTCATCATCTTGGCGCTGTCGGGGGCCGTGGTTGGCAATGTCTATCTCGACGAGCTT
GGGCTCACGCTTGCAGTAGTAAGTCGTCTTGCACTCTTTTCTCCACCCTCTGCCGCTTGGTAGGTGTCTTGAGCT
GCAGCTAACCAGACACAGTCGCTGCTTAGCATGATTGCCCTGGGATACATGATTGTCAGTGAGCGCGCGCCCGCC
TGCCGTGCCGGCTACAATGTCTATGCCGTGCTGGCGCTCGATGGGCTCCTCACCATACTATGGCTGGCCGCCTTT
GCAGCTGCAGCGGCCAGGAGGTCGCGCTTTGCCTATACCGTCGTCACCACTGACGCCAACTTGTATGATAGCCTG
GCGGGCATGACGTCGGCTGTTGCTGGTCTAGGCGCCTTTGTGTGGTGAGTCTTTGCTTGCTTGCTTGGCTGTCCT
TTATGCGTGAGCCTGCGCTGAGTAGGGCATAGGATCATGTTTATTGCCACCTTTACCTGGACCTTGATTAGCTTC
CTCACCGGCCGCAAGCAGGGCCGATTCAACTTTAACATGGACGCCCTGACTGCCACCAACACGGCTGGACATGCA
ATGGAACACAAGATGGATCAACAGCCTCCATCTAACATGGCCGCGCCGGAGCAGTCGCAGACGCCCTACCAGCAA
CAGCCGCCCTACATGCCTCCCACGGCACAGTCGCCGCCTCCGCAGCAAATGCCGCATGACTATCCGCTCCATCAG
GCCGCGCAGTATCCCGCCCAGGCCCAGGCGCCTTCTCAGCATGCAGCGCAACAACAGACTTTTCCCTATTCACCA
CAGCACGCTTCTCCATATCCTTCATCGACACAGCATCCTTCGACTCATCACCTTGCTCAGCAGCATACCTCTTCT
TCCCAGCATCTTCCACATCACAATACTTCTTCTACTCACCATCAGACCGCTCAGTACTCTCCTCAGGGCACACCC
TCGCCCACACAGTATCCGCCTCAGCAGTATGCCTCGCAGCCGCATCCGCAGCAATATCAAGTCCCAGTTGAGACT
CGAGGGAGTGAGTTGTCGGCACAGTAG

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail