Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|3522
Gene name
LocationContig_222:17830..18199
Strand+
Gene length (bp)369
Transcript length (bp)369
Coding sequence length (bp)369
Protein length (aa) 123

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00083 Sugar_tr Sugar (and other) transporter 4.7E-06 3 50

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P54854|HXT15_YEAST Hexose transporter HXT15 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HXT15 PE=1 SV=1 1 73 2.0E-13
sp|P39924|HXT13_YEAST Hexose transporter HXT13 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HXT13 PE=1 SV=1 1 74 2.0E-13
sp|P53631|HXT17_YEAST Hexose transporter HXT17 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HXT17 PE=3 SV=1 1 67 3.0E-13
sp|P47185|HXT16_YEAST Hexose transporter HXT16 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HXT16 PE=3 SV=1 1 73 6.0E-13
sp|O74849|GHT6_SCHPO High-affinity fructose transporter ght6 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ght6 PE=1 SV=1 1 114 1.0E-10
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P54854|HXT15_YEAST Hexose transporter HXT15 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HXT15 PE=1 SV=1 1 73 2.0E-13
sp|P39924|HXT13_YEAST Hexose transporter HXT13 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HXT13 PE=1 SV=1 1 74 2.0E-13
sp|P53631|HXT17_YEAST Hexose transporter HXT17 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HXT17 PE=3 SV=1 1 67 3.0E-13
sp|P47185|HXT16_YEAST Hexose transporter HXT16 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HXT16 PE=3 SV=1 1 73 6.0E-13
sp|O74849|GHT6_SCHPO High-affinity fructose transporter ght6 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ght6 PE=1 SV=1 1 114 1.0E-10
sp|O74969|GHT2_SCHPO High-affinity glucose transporter ght2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ght2 PE=1 SV=1 1 98 4.0E-09
sp|P78831|GHT5_SCHPO High-affinity glucose transporter ght5 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ght5 PE=1 SV=2 1 77 8.0E-09
sp|Q9P3U7|GHT8_SCHPO Probable high-affinity hexose transporter ght8, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ght8 PE=1 SV=1 1 51 8.0E-09
sp|Q9P3U6|GHT1_SCHPO High-affinity glucose transporter ght1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ght1 PE=1 SV=1 1 102 2.0E-08
sp|Q8TFG1|GHT7_SCHPO Probable high-affinity hexose transporter ght7 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ght7 PE=3 SV=1 1 66 2.0E-08
sp|P53387|KHT2_KLULC Hexose transporter 2 OS=Kluyveromyces lactis GN=KHT2 PE=3 SV=1 3 66 2.0E-08
sp|P13181|GAL2_YEAST Galactose transporter OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GAL2 PE=1 SV=3 1 66 5.0E-08
sp|P39003|HXT6_YEAST High-affinity hexose transporter HXT6 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HXT6 PE=1 SV=2 1 67 5.0E-08
sp|P39004|HXT7_YEAST High-affinity hexose transporter HXT6 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HXT7 PE=1 SV=1 1 67 5.0E-08
sp|P43581|HXT10_YEAST Hexose transporter HXT10 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HXT10 PE=1 SV=1 1 66 3.0E-07
sp|Q92339|GHT3_SCHPO High-affinity gluconate transporter ght3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ght3 PE=3 SV=1 1 65 4.0E-07
sp|O59932|GHT4_SCHPO High-affinity hexose transporter ght4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ght4 PE=3 SV=2 1 65 7.0E-07
sp|P40441|HXT12_YEAST Putative hexose transporter 12 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HXT12 PE=5 SV=1 1 67 1.0E-06
sp|P54862|HXT11_YEAST Hexose transporter HXT11 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HXT11 PE=1 SV=1 1 67 1.0E-06
sp|P40885|HXT9_YEAST Hexose transporter HXT9 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HXT9 PE=1 SV=1 1 67 1.0E-06
sp|P38695|HXT5_YEAST Probable glucose transporter HXT5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HXT5 PE=1 SV=1 1 67 1.0E-06
sp|C7GWV6|HXT4_YEAS2 Low-affinity glucose transporter HXT4 OS=Saccharomyces cerevisiae (strain JAY291) GN=HXT4 PE=3 SV=1 1 67 3.0E-06
sp|P32466|HXT3_YEAST Low-affinity glucose transporter HXT3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HXT3 PE=1 SV=1 1 66 3.0E-06
sp|P18631|RAG1_KLULA Low-affinity glucose transporter OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=RAG1 PE=1 SV=1 1 66 4.0E-06
sp|P40886|HXT8_YEAST Hexose transporter HXT8 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HXT8 PE=1 SV=1 1 66 4.0E-06
sp|P23585|HXT2_YEAST High-affinity glucose transporter HXT2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HXT2 PE=1 SV=1 1 75 5.0E-06
sp|P32467|HXT4_YEAST Low-affinity glucose transporter HXT4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HXT4 PE=1 SV=1 1 67 6.0E-06
sp|P32465|HXT1_YEAST Low-affinity glucose transporter HXT1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HXT1 PE=1 SV=1 1 66 9.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0055085 transmembrane transport Yes
GO:0022857 transmembrane transporter activity Yes
GO:0016021 integral component of membrane Yes
GO:0110165 cellular anatomical entity No
GO:0009987 cellular process No
GO:0003674 molecular_function No
GO:0051179 localization No
GO:0005215 transporter activity No
GO:0008150 biological_process No
GO:0031224 intrinsic component of membrane No
GO:0051234 establishment of localization No
GO:0005575 cellular_component No
GO:0006810 transport No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

Domain # Start End Length
1 15 37 22

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup11190
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis map64 (Brazil) OphauB2|3522 (this protein)

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|3522
MLGFITPVATDHIAYRYGFVFVGSNLVAAVIVFFFLYETRMLSLESVDILYNDMEVKAWNSAKWVPPGYITREER
DVGHFRRLSVAYNTQWNREDEGPSTENKRPTTERVQHGPEPKQEQDA*
Coding >OphauB2|3522
ATGCTTGGCTTCATCACACCCGTTGCTACGGATCACATTGCCTACCGATACGGATTTGTCTTTGTAGGCAGCAAT
CTCGTGGCGGCCGTCATTGTTTTCTTCTTTCTATATGAGACACGCATGCTCAGCCTGGAGAGTGTCGATATTCTG
TACAATGACATGGAAGTCAAGGCGTGGAACAGCGCCAAATGGGTGCCGCCAGGATACATCACGCGAGAGGAGAGA
GACGTTGGTCACTTTCGCCGGCTCAGTGTGGCATACAATACGCAGTGGAACAGGGAAGACGAGGGACCAAGTACG
GAAAACAAGAGGCCGACAACGGAGCGCGTGCAACATGGGCCCGAGCCAAAACAAGAACAAGATGCCTAG
Transcript >OphauB2|3522
ATGCTTGGCTTCATCACACCCGTTGCTACGGATCACATTGCCTACCGATACGGATTTGTCTTTGTAGGCAGCAAT
CTCGTGGCGGCCGTCATTGTTTTCTTCTTTCTATATGAGACACGCATGCTCAGCCTGGAGAGTGTCGATATTCTG
TACAATGACATGGAAGTCAAGGCGTGGAACAGCGCCAAATGGGTGCCGCCAGGATACATCACGCGAGAGGAGAGA
GACGTTGGTCACTTTCGCCGGCTCAGTGTGGCATACAATACGCAGTGGAACAGGGAAGACGAGGGACCAAGTACG
GAAAACAAGAGGCCGACAACGGAGCGCGTGCAACATGGGCCCGAGCCAAAACAAGAACAAGATGCCTAG
Gene >OphauB2|3522
ATGCTTGGCTTCATCACACCCGTTGCTACGGATCACATTGCCTACCGATACGGATTTGTCTTTGTAGGCAGCAAT
CTCGTGGCGGCCGTCATTGTTTTCTTCTTTCTATATGAGACACGCATGCTCAGCCTGGAGAGTGTCGATATTCTG
TACAATGACATGGAAGTCAAGGCGTGGAACAGCGCCAAATGGGTGCCGCCAGGATACATCACGCGAGAGGAGAGA
GACGTTGGTCACTTTCGCCGGCTCAGTGTGGCATACAATACGCAGTGGAACAGGGAAGACGAGGGACCAAGTACG
GAAAACAAGAGGCCGACAACGGAGCGCGTGCAACATGGGCCCGAGCCAAAACAAGAACAAGATGCCTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail