Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|3522
Gene name
LocationContig_222:17830..18199
Strand+
Gene length (bp)369
Transcript length (bp)369
Coding sequence length (bp)369
Protein length (aa) 123

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00083 Sugar_tr Sugar (and other) transporter 4.7E-06 3 50

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P54854|HXT15_YEAST Hexose transporter HXT15 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HXT15 PE=1 SV=1 1 73 2.0E-13
sp|P39924|HXT13_YEAST Hexose transporter HXT13 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HXT13 PE=1 SV=1 1 74 2.0E-13
sp|P53631|HXT17_YEAST Hexose transporter HXT17 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HXT17 PE=3 SV=1 1 67 3.0E-13
sp|P47185|HXT16_YEAST Hexose transporter HXT16 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HXT16 PE=3 SV=1 1 73 6.0E-13
sp|O74849|GHT6_SCHPO High-affinity fructose transporter ght6 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ght6 PE=1 SV=1 1 114 1.0E-10
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P54854|HXT15_YEAST Hexose transporter HXT15 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HXT15 PE=1 SV=1 1 73 2.0E-13
sp|P39924|HXT13_YEAST Hexose transporter HXT13 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HXT13 PE=1 SV=1 1 74 2.0E-13
sp|P53631|HXT17_YEAST Hexose transporter HXT17 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HXT17 PE=3 SV=1 1 67 3.0E-13
sp|P47185|HXT16_YEAST Hexose transporter HXT16 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HXT16 PE=3 SV=1 1 73 6.0E-13
sp|O74849|GHT6_SCHPO High-affinity fructose transporter ght6 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ght6 PE=1 SV=1 1 114 1.0E-10
sp|O74969|GHT2_SCHPO High-affinity glucose transporter ght2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ght2 PE=1 SV=1 1 98 4.0E-09
sp|P78831|GHT5_SCHPO High-affinity glucose transporter ght5 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ght5 PE=1 SV=2 1 77 8.0E-09
sp|Q9P3U7|GHT8_SCHPO Probable high-affinity hexose transporter ght8, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ght8 PE=1 SV=1 1 51 8.0E-09
sp|Q9P3U6|GHT1_SCHPO High-affinity glucose transporter ght1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ght1 PE=1 SV=1 1 102 2.0E-08
sp|Q8TFG1|GHT7_SCHPO Probable high-affinity hexose transporter ght7 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ght7 PE=3 SV=1 1 66 2.0E-08
sp|P53387|KHT2_KLULC Hexose transporter 2 OS=Kluyveromyces lactis GN=KHT2 PE=3 SV=1 3 66 2.0E-08
sp|P13181|GAL2_YEAST Galactose transporter OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GAL2 PE=1 SV=3 1 66 5.0E-08
sp|P39003|HXT6_YEAST High-affinity hexose transporter HXT6 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HXT6 PE=1 SV=2 1 67 5.0E-08
sp|P39004|HXT7_YEAST High-affinity hexose transporter HXT6 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HXT7 PE=1 SV=1 1 67 5.0E-08
sp|P43581|HXT10_YEAST Hexose transporter HXT10 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HXT10 PE=1 SV=1 1 66 3.0E-07
sp|Q92339|GHT3_SCHPO High-affinity gluconate transporter ght3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ght3 PE=3 SV=1 1 65 4.0E-07
sp|O59932|GHT4_SCHPO High-affinity hexose transporter ght4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ght4 PE=3 SV=2 1 65 7.0E-07
sp|P40441|HXT12_YEAST Putative hexose transporter 12 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HXT12 PE=5 SV=1 1 67 1.0E-06
sp|P54862|HXT11_YEAST Hexose transporter HXT11 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HXT11 PE=1 SV=1 1 67 1.0E-06
sp|P40885|HXT9_YEAST Hexose transporter HXT9 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HXT9 PE=1 SV=1 1 67 1.0E-06
sp|P38695|HXT5_YEAST Probable glucose transporter HXT5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HXT5 PE=1 SV=1 1 67 1.0E-06
sp|C7GWV6|HXT4_YEAS2 Low-affinity glucose transporter HXT4 OS=Saccharomyces cerevisiae (strain JAY291) GN=HXT4 PE=3 SV=1 1 67 3.0E-06
sp|P32466|HXT3_YEAST Low-affinity glucose transporter HXT3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HXT3 PE=1 SV=1 1 66 3.0E-06
sp|P18631|RAG1_KLULA Low-affinity glucose transporter OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=RAG1 PE=1 SV=1 1 66 4.0E-06
sp|P40886|HXT8_YEAST Hexose transporter HXT8 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HXT8 PE=1 SV=1 1 66 4.0E-06
sp|P23585|HXT2_YEAST High-affinity glucose transporter HXT2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HXT2 PE=1 SV=1 1 75 5.0E-06
sp|P32467|HXT4_YEAST Low-affinity glucose transporter HXT4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HXT4 PE=1 SV=1 1 67 6.0E-06
sp|P32465|HXT1_YEAST Low-affinity glucose transporter HXT1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HXT1 PE=1 SV=1 1 66 9.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0055085 transmembrane transport Yes
GO:0022857 transmembrane transporter activity Yes
GO:0016021 integral component of membrane Yes
GO:0110165 cellular anatomical entity No
GO:0009987 cellular process No
GO:0003674 molecular_function No
GO:0051179 localization No
GO:0005215 transporter activity No
GO:0008150 biological_process No
GO:0031224 intrinsic component of membrane No
GO:0051234 establishment of localization No
GO:0005575 cellular_component No
GO:0006810 transport No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.5

Transmembrane Domains

Domain # Start End Length
1 15 37 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|3522
MLGFITPVATDHIAYRYGFVFVGSNLVAAVIVFFFLYETRMLSLESVDILYNDMEVKAWNSAKWVPPGYITREER
DVGHFRRLSVAYNTQWNREDEGPSTENKRPTTERVQHGPEPKQEQDA*
Coding >OphauB2|3522
ATGCTTGGCTTCATCACACCCGTTGCTACGGATCACATTGCCTACCGATACGGATTTGTCTTTGTAGGCAGCAAT
CTCGTGGCGGCCGTCATTGTTTTCTTCTTTCTATATGAGACACGCATGCTCAGCCTGGAGAGTGTCGATATTCTG
TACAATGACATGGAAGTCAAGGCGTGGAACAGCGCCAAATGGGTGCCGCCAGGATACATCACGCGAGAGGAGAGA
GACGTTGGTCACTTTCGCCGGCTCAGTGTGGCATACAATACGCAGTGGAACAGGGAAGACGAGGGACCAAGTACG
GAAAACAAGAGGCCGACAACGGAGCGCGTGCAACATGGGCCCGAGCCAAAACAAGAACAAGATGCCTAG
Transcript >OphauB2|3522
ATGCTTGGCTTCATCACACCCGTTGCTACGGATCACATTGCCTACCGATACGGATTTGTCTTTGTAGGCAGCAAT
CTCGTGGCGGCCGTCATTGTTTTCTTCTTTCTATATGAGACACGCATGCTCAGCCTGGAGAGTGTCGATATTCTG
TACAATGACATGGAAGTCAAGGCGTGGAACAGCGCCAAATGGGTGCCGCCAGGATACATCACGCGAGAGGAGAGA
GACGTTGGTCACTTTCGCCGGCTCAGTGTGGCATACAATACGCAGTGGAACAGGGAAGACGAGGGACCAAGTACG
GAAAACAAGAGGCCGACAACGGAGCGCGTGCAACATGGGCCCGAGCCAAAACAAGAACAAGATGCCTAG
Gene >OphauB2|3522
ATGCTTGGCTTCATCACACCCGTTGCTACGGATCACATTGCCTACCGATACGGATTTGTCTTTGTAGGCAGCAAT
CTCGTGGCGGCCGTCATTGTTTTCTTCTTTCTATATGAGACACGCATGCTCAGCCTGGAGAGTGTCGATATTCTG
TACAATGACATGGAAGTCAAGGCGTGGAACAGCGCCAAATGGGTGCCGCCAGGATACATCACGCGAGAGGAGAGA
GACGTTGGTCACTTTCGCCGGCTCAGTGTGGCATACAATACGCAGTGGAACAGGGAAGACGAGGGACCAAGTACG
GAAAACAAGAGGCCGACAACGGAGCGCGTGCAACATGGGCCCGAGCCAAAACAAGAACAAGATGCCTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail