Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|352
Gene name
LocationContig_103:10294..13330
Strand-
Gene length (bp)3036
Transcript length (bp)3036
Coding sequence length (bp)3036
Protein length (aa) 1012

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00501 AMP-binding AMP-binding enzyme 5.9E-65 10 411
PF07993 NAD_binding_4 Male sterility protein 5.7E-61 637 880
PF01370 Epimerase NAD dependent epimerase/dehydratase family 4.3E-11 635 887
PF13193 AMP-binding_C AMP-binding enzyme C-terminal domain 6.2E-09 420 497
PF01073 3Beta_HSD 3-beta hydroxysteroid dehydrogenase/isomerase family 2.2E-07 637 818
PF00550 PP-binding Phosphopantetheine attachment site 2.6E-06 534 595

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q70LM4|LGRD_BREPA Linear gramicidin synthase subunit D OS=Brevibacillus parabrevis GN=lgrD PE=1 SV=1 11 942 2.0E-92
sp|O68006|BACA_BACLI Bacitracin synthase 1 OS=Bacillus licheniformis GN=bacA PE=3 SV=1 12 601 1.0E-71
sp|O68008|BACC_BACLI Bacitracin synthase 3 OS=Bacillus licheniformis GN=bacC PE=3 SV=1 11 602 1.0E-70
sp|Q04747|SRFAB_BACSU Surfactin synthase subunit 2 OS=Bacillus subtilis (strain 168) GN=srfAB PE=1 SV=3 12 601 7.0E-70
sp|P39847|PPSC_BACSU Plipastatin synthase subunit C OS=Bacillus subtilis (strain 168) GN=ppsC PE=1 SV=2 10 602 4.0E-68
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q70LM4|LGRD_BREPA Linear gramicidin synthase subunit D OS=Brevibacillus parabrevis GN=lgrD PE=1 SV=1 11 942 2.0E-92
sp|O68006|BACA_BACLI Bacitracin synthase 1 OS=Bacillus licheniformis GN=bacA PE=3 SV=1 12 601 1.0E-71
sp|O68008|BACC_BACLI Bacitracin synthase 3 OS=Bacillus licheniformis GN=bacC PE=3 SV=1 11 602 1.0E-70
sp|Q04747|SRFAB_BACSU Surfactin synthase subunit 2 OS=Bacillus subtilis (strain 168) GN=srfAB PE=1 SV=3 12 601 7.0E-70
sp|P39847|PPSC_BACSU Plipastatin synthase subunit C OS=Bacillus subtilis (strain 168) GN=ppsC PE=1 SV=2 10 602 4.0E-68
sp|P0C063|GRSB_ANEMI Gramicidin S synthase 2 OS=Aneurinibacillus migulanus GN=grsB PE=3 SV=2 1 595 1.0E-67
sp|P0C064|GRSB_BREBE Gramicidin S synthase 2 OS=Brevibacillus brevis GN=grsB PE=1 SV=2 1 595 7.0E-67
sp|O30409|TYCC_BREPA Tyrocidine synthase 3 OS=Brevibacillus parabrevis GN=tycC PE=1 SV=1 11 569 5.0E-66
sp|O68006|BACA_BACLI Bacitracin synthase 1 OS=Bacillus licheniformis GN=bacA PE=3 SV=1 12 610 1.0E-64
sp|O74298|LYS2_PENCH L-2-aminoadipate reductase large subunit OS=Penicillium chrysogenum GN=lys2 PE=3 SV=1 25 1008 7.0E-64
sp|O31827|PPSE_BACSU Plipastatin synthase subunit E OS=Bacillus subtilis (strain 168) GN=ppsE PE=1 SV=1 12 603 1.0E-63
sp|P07702|LYS2_YEAST L-2-aminoadipate reductase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=LYS2 PE=1 SV=2 20 1008 2.0E-62
sp|P27206|SRFAA_BACSU Surfactin synthase subunit 1 OS=Bacillus subtilis (strain 168) GN=srfAA PE=1 SV=4 11 616 9.0E-62
sp|Q08787|SRFAC_BACSU Surfactin synthase subunit 3 OS=Bacillus subtilis (strain 168) GN=srfAC PE=1 SV=2 12 574 5.0E-61
sp|P09095|TYCA_BREPA Tyrocidine synthase 1 OS=Brevibacillus parabrevis GN=tycA PE=1 SV=2 13 599 6.0E-60
sp|P39846|PPSB_BACSU Plipastatin synthase subunit B OS=Bacillus subtilis (strain 168) GN=ppsB PE=1 SV=1 13 591 9.0E-60
sp|P27206|SRFAA_BACSU Surfactin synthase subunit 1 OS=Bacillus subtilis (strain 168) GN=srfAA PE=1 SV=4 17 591 1.0E-59
sp|Q75BB3|LYS2_ASHGO L-2-aminoadipate reductase large subunit OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=LYS2 PE=3 SV=2 146 1008 5.0E-59
sp|P40976|LYS2_SCHPO L-2-aminoadipate reductase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=lys1 PE=1 SV=3 12 981 7.0E-59
sp|Q70LM5|LGRC_BREPA Linear gramicidin synthase subunit C OS=Brevibacillus parabrevis GN=lgrC PE=3 SV=1 13 568 2.0E-58
sp|Q70LM5|LGRC_BREPA Linear gramicidin synthase subunit C OS=Brevibacillus parabrevis GN=lgrC PE=3 SV=1 13 585 5.0E-58
sp|O30409|TYCC_BREPA Tyrocidine synthase 3 OS=Brevibacillus parabrevis GN=tycC PE=1 SV=1 1 609 5.0E-57
sp|O30408|TYCB_BREPA Tyrocidine synthase 2 OS=Brevibacillus parabrevis GN=tycB PE=3 SV=1 13 601 2.0E-56
sp|O68008|BACC_BACLI Bacitracin synthase 3 OS=Bacillus licheniformis GN=bacC PE=3 SV=1 12 601 5.0E-56
sp|Q6FMI5|LYS2_CANGA L-2-aminoadipate reductase large subunit OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=LYS2 PE=3 SV=1 24 1008 6.0E-56
sp|P0C064|GRSB_BREBE Gramicidin S synthase 2 OS=Brevibacillus brevis GN=grsB PE=1 SV=2 1 595 2.0E-55
sp|O30409|TYCC_BREPA Tyrocidine synthase 3 OS=Brevibacillus parabrevis GN=tycC PE=1 SV=1 11 596 5.0E-55
sp|P0C063|GRSB_ANEMI Gramicidin S synthase 2 OS=Aneurinibacillus migulanus GN=grsB PE=3 SV=2 1 595 9.0E-55
sp|P27206|SRFAA_BACSU Surfactin synthase subunit 1 OS=Bacillus subtilis (strain 168) GN=srfAA PE=1 SV=4 11 599 3.0E-54
sp|Q04747|SRFAB_BACSU Surfactin synthase subunit 2 OS=Bacillus subtilis (strain 168) GN=srfAB PE=1 SV=3 11 599 4.0E-54
sp|P0C061|GRSA_ANEMI Gramicidin S synthase 1 OS=Aneurinibacillus migulanus GN=grsA PE=1 SV=1 13 599 4.0E-54
sp|O68008|BACC_BACLI Bacitracin synthase 3 OS=Bacillus licheniformis GN=bacC PE=3 SV=1 10 608 2.0E-53
sp|P0C062|GRSA_BREBE Gramicidin S synthase 1 OS=Brevibacillus brevis GN=grsA PE=3 SV=1 13 599 3.0E-53
sp|P0C063|GRSB_ANEMI Gramicidin S synthase 2 OS=Aneurinibacillus migulanus GN=grsB PE=3 SV=2 9 604 4.0E-53
sp|P0C064|GRSB_BREBE Gramicidin S synthase 2 OS=Brevibacillus brevis GN=grsB PE=1 SV=2 9 601 5.0E-53
sp|O68008|BACC_BACLI Bacitracin synthase 3 OS=Bacillus licheniformis GN=bacC PE=3 SV=1 12 600 8.0E-53
sp|Q70LM6|LGRB_BREPA Linear gramicidin synthase subunit B OS=Brevibacillus parabrevis GN=lgrB PE=1 SV=1 1 572 1.0E-52
sp|P94459|PPSD_BACSU Plipastatin synthase subunit D OS=Bacillus subtilis (strain 168) GN=ppsD PE=1 SV=2 12 622 2.0E-52
sp|O30408|TYCB_BREPA Tyrocidine synthase 2 OS=Brevibacillus parabrevis GN=tycB PE=3 SV=1 10 569 1.0E-51
sp|P37693|HETM_NOSS1 Polyketide synthase HetM OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=hetM PE=3 SV=1 635 1011 2.0E-51
sp|Q70LM5|LGRC_BREPA Linear gramicidin synthase subunit C OS=Brevibacillus parabrevis GN=lgrC PE=3 SV=1 13 600 4.0E-51
sp|Q70LM6|LGRB_BREPA Linear gramicidin synthase subunit B OS=Brevibacillus parabrevis GN=lgrB PE=1 SV=1 13 568 5.0E-51
sp|Q70LM5|LGRC_BREPA Linear gramicidin synthase subunit C OS=Brevibacillus parabrevis GN=lgrC PE=3 SV=1 13 568 1.0E-50
sp|Q9R9J0|MYCB_BACIU Mycosubtilin synthase subunit B OS=Bacillus subtilis GN=mycB PE=3 SV=1 12 596 1.0E-50
sp|O68006|BACA_BACLI Bacitracin synthase 1 OS=Bacillus licheniformis GN=bacA PE=3 SV=1 12 599 2.0E-50
sp|Q70LM7|LGRA_BREPA Linear gramicidin synthase subunit A OS=Brevibacillus parabrevis GN=lgrA PE=1 SV=1 1 599 3.0E-50
sp|P45745|DHBF_BACSU Dimodular nonribosomal peptide synthase OS=Bacillus subtilis (strain 168) GN=dhbF PE=1 SV=4 12 583 3.0E-50
sp|Q70LM4|LGRD_BREPA Linear gramicidin synthase subunit D OS=Brevibacillus parabrevis GN=lgrD PE=1 SV=1 10 600 4.0E-50
sp|Q9R9I9|MYCC_BACIU Mycosubtilin synthase subunit C OS=Bacillus subtilis GN=mycC PE=3 SV=1 12 584 1.0E-49
sp|Q70LM4|LGRD_BREPA Linear gramicidin synthase subunit D OS=Brevibacillus parabrevis GN=lgrD PE=1 SV=1 11 599 2.0E-49
sp|Q70LM5|LGRC_BREPA Linear gramicidin synthase subunit C OS=Brevibacillus parabrevis GN=lgrC PE=3 SV=1 9 585 3.0E-49
sp|Q4WAZ9|NRP14_ASPFU Nonribosomal peptide synthetase 14 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS14 PE=2 SV=2 7 836 5.0E-49
sp|O68008|BACC_BACLI Bacitracin synthase 3 OS=Bacillus licheniformis GN=bacC PE=3 SV=1 11 604 1.0E-48
sp|O30408|TYCB_BREPA Tyrocidine synthase 2 OS=Brevibacillus parabrevis GN=tycB PE=3 SV=1 11 601 1.0E-48
sp|P45745|DHBF_BACSU Dimodular nonribosomal peptide synthase OS=Bacillus subtilis (strain 168) GN=dhbF PE=1 SV=4 13 584 2.0E-48
sp|O68006|BACA_BACLI Bacitracin synthase 1 OS=Bacillus licheniformis GN=bacA PE=3 SV=1 13 593 3.0E-48
sp|O30409|TYCC_BREPA Tyrocidine synthase 3 OS=Brevibacillus parabrevis GN=tycC PE=1 SV=1 1 600 3.0E-48
sp|O68007|BACB_BACLI Bacitracin synthase 2 OS=Bacillus licheniformis GN=bacB PE=3 SV=1 10 636 4.0E-48
sp|Q70LM5|LGRC_BREPA Linear gramicidin synthase subunit C OS=Brevibacillus parabrevis GN=lgrC PE=3 SV=1 9 585 2.0E-47
sp|P94459|PPSD_BACSU Plipastatin synthase subunit D OS=Bacillus subtilis (strain 168) GN=ppsD PE=1 SV=2 11 604 2.0E-47
sp|P0C064|GRSB_BREBE Gramicidin S synthase 2 OS=Brevibacillus brevis GN=grsB PE=1 SV=2 9 598 3.0E-47
sp|P94459|PPSD_BACSU Plipastatin synthase subunit D OS=Bacillus subtilis (strain 168) GN=ppsD PE=1 SV=2 11 601 3.0E-47
sp|Q70LM4|LGRD_BREPA Linear gramicidin synthase subunit D OS=Brevibacillus parabrevis GN=lgrD PE=1 SV=1 11 605 4.0E-47
sp|Q9R9I9|MYCC_BACIU Mycosubtilin synthase subunit C OS=Bacillus subtilis GN=mycC PE=3 SV=1 12 596 5.0E-47
sp|O30409|TYCC_BREPA Tyrocidine synthase 3 OS=Brevibacillus parabrevis GN=tycC PE=1 SV=1 12 570 7.0E-47
sp|O30409|TYCC_BREPA Tyrocidine synthase 3 OS=Brevibacillus parabrevis GN=tycC PE=1 SV=1 12 601 8.0E-47
sp|P39845|PPSA_BACSU Plipastatin synthase subunit A OS=Bacillus subtilis (strain 168) GN=ppsA PE=1 SV=2 12 601 9.0E-47
sp|Q12572|LYS2_CANAX L-2-aminoadipate reductase large subunit OS=Candida albicans GN=LYS2 PE=3 SV=2 337 981 2.0E-46
sp|P39847|PPSC_BACSU Plipastatin synthase subunit C OS=Bacillus subtilis (strain 168) GN=ppsC PE=1 SV=2 12 601 1.0E-45
sp|P39846|PPSB_BACSU Plipastatin synthase subunit B OS=Bacillus subtilis (strain 168) GN=ppsB PE=1 SV=1 10 585 1.0E-45
sp|Q9R9J0|MYCB_BACIU Mycosubtilin synthase subunit B OS=Bacillus subtilis GN=mycB PE=3 SV=1 1 601 1.0E-45
sp|P0C063|GRSB_ANEMI Gramicidin S synthase 2 OS=Aneurinibacillus migulanus GN=grsB PE=3 SV=2 9 598 2.0E-45
sp|P27742|ACVS_EMENI N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=acvA PE=1 SV=2 17 610 4.0E-45
sp|P40806|PKSJ_BACSU Polyketide synthase PksJ OS=Bacillus subtilis (strain 168) GN=pksJ PE=1 SV=3 11 691 8.0E-45
sp|Q70LM6|LGRB_BREPA Linear gramicidin synthase subunit B OS=Brevibacillus parabrevis GN=lgrB PE=1 SV=1 17 591 1.0E-44
sp|Q70LM7|LGRA_BREPA Linear gramicidin synthase subunit A OS=Brevibacillus parabrevis GN=lgrA PE=1 SV=1 12 605 1.0E-44
sp|Q04747|SRFAB_BACSU Surfactin synthase subunit 2 OS=Bacillus subtilis (strain 168) GN=srfAB PE=1 SV=3 10 601 2.0E-44
sp|Q4WMJ7|NRP10_ASPFU Nonribosomal peptide synthetase 10 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS10 PE=1 SV=1 24 608 2.0E-44
sp|Q9R9J0|MYCB_BACIU Mycosubtilin synthase subunit B OS=Bacillus subtilis GN=mycB PE=3 SV=1 2 606 2.0E-43
sp|O31782|PKSN_BACSU Polyketide synthase PksN OS=Bacillus subtilis (strain 168) GN=pksN PE=1 SV=3 12 595 2.0E-43
sp|Q70LM6|LGRB_BREPA Linear gramicidin synthase subunit B OS=Brevibacillus parabrevis GN=lgrB PE=1 SV=1 12 591 9.0E-43
sp|P25464|ACVS_ACRCH N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Acremonium chrysogenum GN=PCBAB PE=1 SV=1 13 584 3.0E-42
sp|P27742|ACVS_EMENI N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=acvA PE=1 SV=2 13 595 6.0E-42
sp|P19787|ACVS1_PENCH N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Penicillium chrysogenum GN=PCBAB PE=3 SV=1 17 636 2.0E-41
sp|Q0VZ70|CHSAD_CHOCO Chondramide synthase cmdD OS=Chondromyces crocatus GN=cmdD PE=1 SV=1 11 598 4.0E-41
sp|Q9R9J0|MYCB_BACIU Mycosubtilin synthase subunit B OS=Bacillus subtilis GN=mycB PE=3 SV=1 11 599 8.0E-41
sp|A1CLY8|CCSA_ASPCL Polyketide synthase-nonribosomal peptide synthetase OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=ccsA PE=3 SV=1 4 837 2.0E-40
sp|P68878|DLTA_STAAW D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain MW2) GN=dltA PE=3 SV=1 3 507 2.0E-40
sp|A8Z1J1|DLTA_STAAT D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain USA300 / TCH1516) GN=dltA PE=3 SV=1 3 507 2.0E-40
sp|Q6GAZ4|DLTA_STAAS D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain MSSA476) GN=dltA PE=3 SV=1 3 507 2.0E-40
sp|A6QFE3|DLTA_STAAE D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain Newman) GN=dltA PE=3 SV=1 3 507 2.0E-40
sp|Q5HHF2|DLTA_STAAC D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain COL) GN=dltA PE=3 SV=1 3 507 2.0E-40
sp|Q2FZW6|DLTA_STAA8 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain NCTC 8325) GN=dltA PE=3 SV=1 3 507 2.0E-40
sp|Q2FIE3|DLTA_STAA3 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain USA300) GN=dltA PE=3 SV=1 3 507 2.0E-40
sp|P0DJH0|ANGR_VIBAN Anguibactin system regulator OS=Vibrio anguillarum GN=angR PE=3 SV=1 1 586 2.0E-40
sp|P27743|ACVS_AMYLA N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Amycolatopsis lactamdurans GN=pcbAB PE=3 SV=1 13 607 2.0E-40
sp|Q6W4T3|ANGR_VIBA7 Anguibactin system regulator OS=Vibrio anguillarum (strain ATCC 68554 / 775) GN=angR PE=1 SV=1 1 586 2.0E-40
sp|Q2YWQ8|DLTA_STAAB D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain bovine RF122 / ET3-1) GN=dltA PE=3 SV=1 3 505 3.0E-40
sp|P0C397|DLTA_STAAU D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus GN=dltA PE=3 SV=1 3 505 3.0E-40
sp|P99107|DLTA_STAAN D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain N315) GN=dltA PE=1 SV=1 3 505 3.0E-40
sp|P68876|DLTA_STAAM D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=dltA PE=3 SV=1 3 505 3.0E-40
sp|A5IRB0|DLTA_STAA9 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain JH9) GN=dltA PE=3 SV=1 3 505 3.0E-40
sp|A6U039|DLTA_STAA2 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain JH1) GN=dltA PE=3 SV=1 3 505 3.0E-40
sp|A7X0D6|DLTA_STAA1 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain Mu3 / ATCC 700698) GN=dltA PE=3 SV=1 3 505 3.0E-40
sp|P19787|ACVS1_PENCH N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Penicillium chrysogenum GN=PCBAB PE=3 SV=1 13 667 4.0E-40
sp|P26046|ACVS2_PENCH N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Penicillium chrysogenum GN=PCBAB PE=3 SV=1 13 667 6.0E-40
sp|P26046|ACVS2_PENCH N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Penicillium chrysogenum GN=PCBAB PE=3 SV=1 17 636 8.0E-40
sp|Q9R9J1|MYCA_BACIU Mycosubtilin synthase subunit A OS=Bacillus subtilis GN=mycA PE=3 SV=1 13 591 1.0E-39
sp|Q6GIF6|DLTA_STAAR D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain MRSA252) GN=dltA PE=3 SV=1 3 505 2.0E-39
sp|O68006|BACA_BACLI Bacitracin synthase 1 OS=Bacillus licheniformis GN=bacA PE=3 SV=1 13 655 2.0E-38
sp|P39845|PPSA_BACSU Plipastatin synthase subunit A OS=Bacillus subtilis (strain 168) GN=ppsA PE=1 SV=2 11 591 2.0E-38
sp|Q88VM6|DLTA_LACPL D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Lactobacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1) GN=dltA PE=3 SV=1 23 507 2.0E-38
sp|Q00869|ESYN_FUSEQ Enniatin synthase OS=Fusarium equiseti GN=ESYN1 PE=1 SV=2 13 459 2.0E-38
sp|P25464|ACVS_ACRCH N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Acremonium chrysogenum GN=PCBAB PE=1 SV=1 13 602 4.0E-38
sp|B3WC77|DLTA_LACCB D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Lactobacillus casei (strain BL23) GN=dltA PE=3 SV=1 41 504 1.0E-37
sp|P11454|ENTF_ECOLI Enterobactin synthase component F OS=Escherichia coli (strain K12) GN=entF PE=1 SV=3 11 601 2.0E-37
sp|Q03AZ2|DLTA_LACC3 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Lactobacillus casei (strain ATCC 334) GN=dltA PE=3 SV=1 41 504 2.0E-37
sp|P27743|ACVS_AMYLA N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Amycolatopsis lactamdurans GN=pcbAB PE=3 SV=1 9 583 4.0E-37
sp|P27743|ACVS_AMYLA N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Amycolatopsis lactamdurans GN=pcbAB PE=3 SV=1 13 599 4.0E-37
sp|P19787|ACVS1_PENCH N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Penicillium chrysogenum GN=PCBAB PE=3 SV=1 17 601 5.0E-37
sp|P26046|ACVS2_PENCH N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Penicillium chrysogenum GN=PCBAB PE=3 SV=1 17 601 6.0E-37
sp|Q73BD2|DLTA_BACC1 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus cereus (strain ATCC 10987 / NRS 248) GN=dltA PE=3 SV=1 3 507 1.0E-36
sp|P29698|ENTF_SHIFL Enterobactin synthase component F OS=Shigella flexneri GN=entF PE=3 SV=2 11 601 1.0E-36
sp|Q8XBV9|ENTF_ECO57 Enterobactin synthase component F OS=Escherichia coli O157:H7 GN=entF PE=3 SV=1 11 601 1.0E-36
sp|Q9L9G0|NOVH_STRNV Novobiocin biosynthesis protein H OS=Streptomyces niveus GN=novH PE=1 SV=2 9 591 1.0E-36
sp|Q81G39|DLTA_BACCR D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus cereus (strain ATCC 14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL B-3711) GN=dltA PE=1 SV=1 3 507 2.0E-36
sp|B7HHC6|DLTA_BACC4 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus cereus (strain B4264) GN=dltA PE=3 SV=1 3 507 2.0E-36
sp|Q4WVN4|NRPS8_ASPFU Nonribosomal peptide synthetase 8 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS8 PE=3 SV=1 10 607 2.0E-36
sp|Q4WVN4|NRPS8_ASPFU Nonribosomal peptide synthetase 8 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS8 PE=3 SV=1 8 584 2.0E-36
sp|P35854|DLTA_LACRH D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Lactobacillus rhamnosus GN=dltA PE=1 SV=1 41 504 2.0E-36
sp|Q5HQN0|DLTA_STAEQ D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=dltA PE=3 SV=1 8 503 2.0E-36
sp|B7HK95|DLTA_BACC7 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus cereus (strain AH187) GN=dltA PE=3 SV=1 3 507 3.0E-36
sp|B7IN64|DLTA_BACC2 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus cereus (strain G9842) GN=dltA PE=3 SV=1 8 507 3.0E-36
sp|B9IUW2|DLTA_BACCQ D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus cereus (strain Q1) GN=dltA PE=3 SV=1 3 507 3.0E-36
sp|Q63E02|DLTA_BACCZ D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus cereus (strain ZK / E33L) GN=dltA PE=3 SV=1 3 507 4.0E-36
sp|A7GMR0|DLTA_BACCN D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus cytotoxicus (strain DSM 22905 / CIP 110041 / 391-98 / NVH 391-98) GN=dltA PE=3 SV=1 4 507 5.0E-36
sp|Q81T97|DLTA_BACAN D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus anthracis GN=dltA PE=3 SV=1 3 507 5.0E-36
sp|C3LAH8|DLTA_BACAC D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus anthracis (strain CDC 684 / NRRL 3495) GN=dltA PE=3 SV=1 3 507 5.0E-36
sp|C3P4I7|DLTA_BACAA D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus anthracis (strain A0248) GN=dltA PE=3 SV=1 3 507 5.0E-36
sp|Q4WZ44|NRPS7_ASPFU Nonribosomal peptide synthetase 7 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS7 PE=3 SV=1 13 508 6.0E-36
sp|Q6HLH7|DLTA_BACHK D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus thuringiensis subsp. konkukian (strain 97-27) GN=dltA PE=3 SV=1 3 507 7.0E-36
sp|C1EM80|DLTA_BACC3 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus cereus (strain 03BB102) GN=dltA PE=3 SV=1 3 507 7.0E-36
sp|B7JFV5|DLTA_BACC0 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus cereus (strain AH820) GN=dltA PE=3 SV=1 3 507 7.0E-36
sp|A0RBJ0|DLTA_BACAH D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus thuringiensis (strain Al Hakam) GN=dltA PE=3 SV=1 3 507 7.0E-36
sp|Q8CT93|DLTA_STAES D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus epidermidis (strain ATCC 12228) GN=dltA PE=3 SV=1 8 503 1.0E-35
sp|A9VKV6|DLTA_BACWK D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus weihenstephanensis (strain KBAB4) GN=dltA PE=3 SV=1 3 507 1.0E-35
sp|Q4WYG2|NRPS5_ASPFU Nonribosomal peptide synthetase 5 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS5 PE=3 SV=2 25 591 1.0E-35
sp|P0DA65|DLTA_STRPQ D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M3 (strain SSI-1) GN=dltA PE=3 SV=1 26 507 2.0E-35
sp|P0DA64|DLTA_STRP3 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M3 (strain ATCC BAA-595 / MGAS315) GN=dltA PE=3 SV=1 26 507 2.0E-35
sp|Q1JLB7|DLTA_STRPC D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M12 (strain MGAS9429) GN=dltA PE=3 SV=1 26 507 2.0E-35
sp|Q5XBN5|DLTA_STRP6 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M6 (strain ATCC BAA-946 / MGAS10394) GN=dltA PE=1 SV=1 26 507 2.0E-35
sp|Q99ZA6|DLTA_STRP1 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M1 GN=dltA PE=1 SV=1 26 507 2.0E-35
sp|Q48SZ3|DLTA_STRPM D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M28 (strain MGAS6180) GN=dltA PE=3 SV=1 26 507 2.0E-35
sp|A2RE45|DLTA_STRPG D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M5 (strain Manfredo) GN=dltA PE=3 SV=1 26 507 2.0E-35
sp|Q1JGF0|DLTA_STRPD D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M2 (strain MGAS10270) GN=dltA PE=3 SV=1 26 507 2.0E-35
sp|Q8P0J9|DLTA_STRP8 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M18 (strain MGAS8232) GN=dltA PE=3 SV=1 26 507 2.0E-35
sp|P25464|ACVS_ACRCH N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Acremonium chrysogenum GN=PCBAB PE=1 SV=1 11 585 3.0E-35
sp|Q0VZ70|CHSAD_CHOCO Chondramide synthase cmdD OS=Chondromyces crocatus GN=cmdD PE=1 SV=1 25 456 3.0E-35
sp|B5XLX5|DLTA_STRPZ D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M49 (strain NZ131) GN=dltA PE=3 SV=1 26 507 3.0E-35
sp|Q1J667|DLTA_STRPF D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M4 (strain MGAS10750) GN=dltA PE=3 SV=1 26 507 3.0E-35
sp|Q65DH1|DLTA_BACLD D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / NBRC 12200 / NCIMB 9375 / NRRL NRS-1264 / Gibson 46) GN=dltA PE=3 SV=1 8 507 4.0E-35
sp|B9WZX0|FTMA_ASPFM Nonribosomal peptide synthetase 13 OS=Neosartorya fumigata GN=NRPS13 PE=1 SV=1 1 591 6.0E-35
sp|Q4WAW3|FTMA_ASPFU Nonribosomal peptide synthetase 13 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS13 PE=2 SV=1 1 591 7.0E-35
sp|C1L1P5|DLTA_LISMC D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Listeria monocytogenes serotype 4b (strain CLIP80459) GN=dltA PE=3 SV=1 3 503 8.0E-35
sp|A1DA59|FTMA_NEOFI Nonribosomal peptide synthetase 13 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=NRPS13 PE=3 SV=1 1 594 1.0E-34
sp|A0AH92|DLTA_LISW6 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Listeria welshimeri serovar 6b (strain ATCC 35897 / DSM 20650 / SLCC5334) GN=dltA PE=3 SV=1 3 509 1.0E-34
sp|Q01886|HTS1_COCCA HC-toxin synthetase OS=Cochliobolus carbonum GN=HTS1 PE=1 SV=2 10 601 1.0E-34
sp|P27742|ACVS_EMENI N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=acvA PE=1 SV=2 13 585 5.0E-34
sp|Q4WT66|NRPS1_ASPFU Nonribosomal peptide synthetase 1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS1 PE=1 SV=1 13 603 9.0E-34
sp|Q721J2|DLTA_LISMF D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Listeria monocytogenes serotype 4b (strain F2365) GN=dltA PE=3 SV=1 3 503 1.0E-33
sp|Q53526|DLTA_STRMU D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus mutans serotype c (strain ATCC 700610 / UA159) GN=dltA PE=3 SV=4 26 509 1.0E-33
sp|B8DEG2|DLTA_LISMH D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Listeria monocytogenes serotype 4a (strain HCC23) GN=dltA PE=3 SV=1 3 503 1.0E-33
sp|Q4WVN4|NRPS8_ASPFU Nonribosomal peptide synthetase 8 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS8 PE=3 SV=1 13 605 1.0E-33
sp|C1CB20|DLTA_STRP7 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pneumoniae (strain 70585) GN=dltA PE=3 SV=1 26 509 2.0E-33
sp|C0MBD6|DLTA_STRE4 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus equi subsp. equi (strain 4047) GN=dltA PE=3 SV=1 26 507 2.0E-33
sp|Q8Y8D4|DLTA_LISMO D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=dltA PE=3 SV=1 3 503 2.0E-33
sp|O68007|BACB_BACLI Bacitracin synthase 2 OS=Bacillus licheniformis GN=bacB PE=3 SV=1 10 601 2.0E-33
sp|C1CNE9|DLTA_STRZP D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pneumoniae (strain P1031) GN=dltA PE=3 SV=1 26 509 3.0E-33
sp|P0A399|DLTA_STRR6 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pneumoniae (strain ATCC BAA-255 / R6) GN=dltA PE=3 SV=1 26 509 3.0E-33
sp|P0A398|DLTA_STRPN D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) GN=dltA PE=3 SV=1 26 509 3.0E-33
sp|Q04HZ7|DLTA_STRP2 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pneumoniae serotype 2 (strain D39 / NCTC 7466) GN=dltA PE=3 SV=1 26 509 3.0E-33
sp|Q4WF61|NRPS3_ASPFU Nonribosomal peptide synthetase 3 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS3 PE=2 SV=2 25 599 4.0E-33
sp|Q4L4U5|DLTA_STAHJ D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus haemolyticus (strain JCSC1435) GN=dltA PE=3 SV=1 10 507 7.0E-33
sp|P59591|DLTA_STRA5 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus agalactiae serotype V (strain ATCC BAA-611 / 2603 V/R) GN=dltA PE=3 SV=1 26 509 8.0E-33
sp|Q3JZ94|DLTA_STRA1 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus agalactiae serotype Ia (strain ATCC 27591 / A909 / CDC SS700) GN=dltA PE=3 SV=1 26 509 8.0E-33
sp|Q92D47|DLTA_LISIN D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Listeria innocua serovar 6a (strain CLIP 11262) GN=dltA PE=3 SV=1 3 503 9.0E-33
sp|Q8VM67|DLTA_STRA3 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus agalactiae serotype III (strain NEM316) GN=dltA PE=3 SV=2 26 509 1.0E-32
sp|Q01757|ACVS_STRCL N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase (Fragment) OS=Streptomyces clavuligerus GN=pcbAB PE=3 SV=1 9 503 1.0E-32
sp|Q4WT66|NRPS1_ASPFU Nonribosomal peptide synthetase 1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS1 PE=1 SV=1 13 612 2.0E-32
sp|Q4WLW8|NRP11_ASPFU Nonribosomal peptide synthetase 11 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS11 PE=2 SV=1 13 570 4.0E-32
sp|C1CU95|DLTA_STRZT D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pneumoniae (strain Taiwan19F-14) GN=dltA PE=3 SV=1 26 509 5.0E-32
sp|B8ZQ14|DLTA_STRPJ D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pneumoniae (strain ATCC 700669 / Spain 23F-1) GN=dltA PE=3 SV=1 26 509 5.0E-32
sp|Q01886|HTS1_COCCA HC-toxin synthetase OS=Cochliobolus carbonum GN=HTS1 PE=1 SV=2 10 570 7.0E-32
sp|Q4WT66|NRPS1_ASPFU Nonribosomal peptide synthetase 1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS1 PE=1 SV=1 13 591 9.0E-32
sp|Q4WR82|NRPS2_ASPFU Nonribosomal peptide synthetase 2 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS2 PE=2 SV=1 6 623 9.0E-32
sp|Q4WF53|NRPS4_ASPFU Nonribosomal peptide synthetase 4 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS4 PE=2 SV=1 13 595 2.0E-31
sp|B9WZX0|FTMA_ASPFM Nonribosomal peptide synthetase 13 OS=Neosartorya fumigata GN=NRPS13 PE=1 SV=1 11 567 6.0E-31
sp|Q4WAW3|FTMA_ASPFU Nonribosomal peptide synthetase 13 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS13 PE=2 SV=1 11 567 7.0E-31
sp|P39581|DLTA_BACSU D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus subtilis (strain 168) GN=dltA PE=1 SV=1 13 499 1.0E-30
sp|E2JA29|DDAD_ENTAG Dapdiamide synthesis protein DdaD OS=Enterobacter agglomerans GN=ddaD PE=1 SV=1 20 599 1.0E-29
sp|A1DA59|FTMA_NEOFI Nonribosomal peptide synthetase 13 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=NRPS13 PE=3 SV=1 11 571 4.0E-29
sp|Q4WLW5|NRP12_ASPFU Nonribosomal peptide synthetase 12 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS12 PE=1 SV=1 13 607 8.0E-29
sp|Q4WYG2|NRPS5_ASPFU Nonribosomal peptide synthetase 5 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS5 PE=3 SV=2 41 582 2.0E-28
sp|P48633|HMWP2_YERE8 High-molecular-weight protein 2 OS=Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081) GN=irp2 PE=3 SV=1 13 460 4.0E-28
sp|Q4WLW5|NRP12_ASPFU Nonribosomal peptide synthetase 12 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS12 PE=1 SV=1 11 591 6.0E-28
sp|Q4WVN4|NRPS8_ASPFU Nonribosomal peptide synthetase 8 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS8 PE=3 SV=1 13 570 7.0E-28
sp|A7ZA74|DLTA_BACMF D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus methylotrophicus (strain DSM 23117 / BGSC 10A6 / FZB42) GN=dltA PE=3 SV=1 13 499 8.0E-28
sp|Q4WLW5|NRP12_ASPFU Nonribosomal peptide synthetase 12 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS12 PE=1 SV=1 17 605 1.0E-27
sp|Q73XY1|MBTB_MYCPA Phenyloxazoline synthase MbtB OS=Mycobacterium paratuberculosis (strain ATCC BAA-968 / K-10) GN=mbtB PE=3 SV=1 1 570 2.0E-27
sp|Q4WZ44|NRPS7_ASPFU Nonribosomal peptide synthetase 7 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS7 PE=3 SV=1 48 570 2.0E-27
sp|Q9CG49|DLTA_LACLA D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Lactococcus lactis subsp. lactis (strain IL1403) GN=dltA PE=3 SV=1 25 510 4.0E-27
sp|F4K1G2|AEE19_ARATH Putative acyl-activating enzyme 19 OS=Arabidopsis thaliana GN=At5g35930 PE=2 SV=1 136 596 5.0E-27
sp|Q00868|ESYN_GIBPU Enniatin synthase (Fragment) OS=Gibberella pulicaris PE=3 SV=2 68 455 6.0E-27
sp|Q9P7T1|SIB1_SCHPO Hydroxamate-type ferrichrome siderophore peptide synthetase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sib1 PE=1 SV=1 23 509 1.0E-26
sp|P9WQ62|MBTB_MYCTO Phenyloxazoline synthase MbtB OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=mbtB PE=1 SV=1 10 570 1.0E-26
sp|P9WQ63|MBTB_MYCTU Phenyloxazoline synthase MbtB OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=mbtB PE=1 SV=1 10 570 1.0E-26
sp|Q7TYQ4|MBTB_MYCBO Phenyloxazoline synthase MbtB OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=mbtB PE=3 SV=1 10 570 1.0E-26
sp|Q01886|HTS1_COCCA HC-toxin synthetase OS=Cochliobolus carbonum GN=HTS1 PE=1 SV=2 10 508 2.0E-26
sp|Q4WMJ7|NRP10_ASPFU Nonribosomal peptide synthetase 10 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS10 PE=1 SV=1 12 606 3.0E-26
sp|Q01886|HTS1_COCCA HC-toxin synthetase OS=Cochliobolus carbonum GN=HTS1 PE=1 SV=2 13 591 4.0E-26
sp|Q4WMK2|NRPS9_ASPFU Nonribosomal peptide syntethase 9 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS9 PE=3 SV=1 13 572 5.0E-26
sp|O43103|SID2_USTMA Ferrichrome siderophore peptide synthetase OS=Ustilago maydis (strain 521 / FGSC 9021) GN=SID2 PE=3 SV=2 24 527 5.0E-26
sp|Q1B6A7|MBTB_MYCSS Phenyloxazoline synthase MbtB OS=Mycobacterium sp. (strain MCS) GN=mbtB PE=3 SV=1 11 570 2.0E-25
sp|B0G138|PKS21_DICDI Probable polyketide synthase 21 OS=Dictyostelium discoideum GN=pks21 PE=3 SV=1 611 869 4.0E-25
sp|Q9X2N4|DLTA_STAXY D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus xylosus GN=dltA PE=3 SV=1 1 507 5.0E-25
sp|Q4WF61|NRPS3_ASPFU Nonribosomal peptide synthetase 3 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS3 PE=2 SV=2 57 621 3.0E-24
sp|Q54T36|PKS19_DICDI Probable polyketide synthase 19 OS=Dictyostelium discoideum GN=pks19 PE=3 SV=1 611 869 8.0E-24
sp|Q6RKB1|CAR_NOCIO Carboxylic acid reductase OS=Nocardia iowensis GN=car PE=1 SV=1 635 932 7.0E-23
sp|Q4WVN4|NRPS8_ASPFU Nonribosomal peptide synthetase 8 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS8 PE=3 SV=1 63 560 2.0E-22
sp|Q4WVN4|NRPS8_ASPFU Nonribosomal peptide synthetase 8 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS8 PE=3 SV=1 1 605 3.0E-22
sp|Q9P7T1|SIB1_SCHPO Hydroxamate-type ferrichrome siderophore peptide synthetase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sib1 PE=1 SV=1 31 571 7.0E-22
sp|O43103|SID2_USTMA Ferrichrome siderophore peptide synthetase OS=Ustilago maydis (strain 521 / FGSC 9021) GN=SID2 PE=3 SV=2 3 503 2.0E-21
sp|Q4WYP0|NRPS6_ASPFU Nonribosomal peptide synthetase 6 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS6 PE=3 SV=1 13 591 5.0E-21
sp|B2HN69|CAR_MYCMM Carboxylic acid reductase OS=Mycobacterium marinum (strain ATCC BAA-535 / M) GN=car PE=1 SV=1 635 932 2.0E-20
sp|O43103|SID2_USTMA Ferrichrome siderophore peptide synthetase OS=Ustilago maydis (strain 521 / FGSC 9021) GN=SID2 PE=3 SV=2 22 503 4.0E-20
sp|Q00869|ESYN_FUSEQ Enniatin synthase OS=Fusarium equiseti GN=ESYN1 PE=1 SV=2 1 503 1.0E-19
sp|Q54TW0|PKS18_DICDI Probable polyketide synthase 18 OS=Dictyostelium discoideum GN=pks18 PE=2 SV=1 631 866 2.0E-19
sp|Q86AE3|PKS9_DICDI Probable polyketide synthase 9/36 OS=Dictyostelium discoideum GN=pks9 PE=2 SV=1 518 864 3.0E-19
sp|B0G0Z9|PKS6_DICDI Probable polyketide synthase 6 OS=Dictyostelium discoideum GN=pks6 PE=3 SV=1 518 864 4.0E-19
sp|O74419|YQ52_SCHPO Uncharacterized protein C162.02c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC162.02c PE=2 SV=1 487 957 7.0E-19
sp|Q4WR82|NRPS2_ASPFU Nonribosomal peptide synthetase 2 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS2 PE=2 SV=1 142 605 3.0E-18
sp|Q4WR82|NRPS2_ASPFU Nonribosomal peptide synthetase 2 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS2 PE=2 SV=1 22 605 7.0E-18
sp|Q4R4Z9|ACSF2_MACFA Acyl-CoA synthetase family member 2, mitochondrial OS=Macaca fascicularis GN=ACSF2 PE=2 SV=1 10 509 8.0E-18
sp|B7JDD6|MENE_BACC0 2-succinylbenzoate--CoA ligase OS=Bacillus cereus (strain AH820) GN=menE PE=3 SV=1 1 509 1.0E-17
sp|Q6HC29|MENE_BACHK 2-succinylbenzoate--CoA ligase OS=Bacillus thuringiensis subsp. konkukian (strain 97-27) GN=menE PE=3 SV=1 1 509 2.0E-17
sp|Q632I5|MENE_BACCZ 2-succinylbenzoate--CoA ligase OS=Bacillus cereus (strain ZK / E33L) GN=menE PE=3 SV=1 1 509 3.0E-17
sp|Q558Y6|PKS14_DICDI Probable polyketide synthase 14 OS=Dictyostelium discoideum GN=pks14 PE=3 SV=2 635 863 6.0E-17
sp|A0RK73|MENE_BACAH 2-succinylbenzoate--CoA ligase OS=Bacillus thuringiensis (strain Al Hakam) GN=menE PE=3 SV=1 1 509 6.0E-17
sp|C3LB87|MENE_BACAC 2-succinylbenzoate--CoA ligase OS=Bacillus anthracis (strain CDC 684 / NRRL 3495) GN=menE PE=3 SV=1 1 509 9.0E-17
sp|C3PCK3|MENE_BACAA 2-succinylbenzoate--CoA ligase OS=Bacillus anthracis (strain A0248) GN=menE PE=3 SV=1 1 509 9.0E-17
sp|Q54FP8|PKS32_DICDI Probable polyketide synthase 32 OS=Dictyostelium discoideum GN=pks32 PE=3 SV=1 636 942 1.0E-16
sp|Q54B49|PKS45_DICDI Probable polyketide synthase 45 OS=Dictyostelium discoideum GN=pks45 PE=3 SV=2 635 863 2.0E-16
sp|Q81K97|MENE_BACAN 2-succinylbenzoate--CoA ligase OS=Bacillus anthracis GN=menE PE=3 SV=1 7 509 3.0E-16
sp|Q54FC8|PKS39_DICDI Probable polyketide synthase 39 OS=Dictyostelium discoideum GN=pks39 PE=3 SV=1 636 869 4.0E-16
sp|Q84P24|4CLL6_ARATH 4-coumarate--CoA ligase-like 6 OS=Arabidopsis thaliana GN=4CLL6 PE=2 SV=2 144 498 5.0E-16
sp|Q5R9G9|ACSF2_PONAB Acyl-CoA synthetase family member 2, mitochondrial OS=Pongo abelii GN=ACSF2 PE=2 SV=1 15 509 6.0E-16
sp|Q54FQ3|PKS29_DICDI Probable polyketide synthase 29 OS=Dictyostelium discoideum GN=pks29 PE=3 SV=1 635 940 7.0E-16
sp|B9J2F2|MENE_BACCQ 2-succinylbenzoate--CoA ligase OS=Bacillus cereus (strain Q1) GN=menE PE=3 SV=1 7 509 9.0E-16
sp|Q816I1|MENE_BACCR 2-succinylbenzoate--CoA ligase OS=Bacillus cereus (strain ATCC 14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL B-3711) GN=menE PE=3 SV=1 1 509 1.0E-15
sp|Q72YK9|MENE_BACC1 2-succinylbenzoate--CoA ligase OS=Bacillus cereus (strain ATCC 10987 / NRS 248) GN=menE PE=3 SV=1 7 509 1.0E-15
sp|Q54FQ2|PKS30_DICDI Probable polyketide synthase 30 OS=Dictyostelium discoideum GN=pks30 PE=3 SV=1 636 942 2.0E-15
sp|Q54B51|PKS44_DICDI Probable polyketide synthase 44 OS=Dictyostelium discoideum GN=pks44 PE=3 SV=1 635 863 5.0E-15
sp|Q54FN2|PKS34_DICDI Probable polyketide synthase 34 OS=Dictyostelium discoideum GN=pks34 PE=3 SV=1 636 869 6.0E-15
sp|Q17QJ1|ACSF2_BOVIN Acyl-CoA synthetase family member 2, mitochondrial OS=Bos taurus GN=ACSF2 PE=2 SV=1 143 509 6.0E-15
sp|B7HTW3|MENE_BACC7 2-succinylbenzoate--CoA ligase OS=Bacillus cereus (strain AH187) GN=menE PE=3 SV=1 7 509 9.0E-15
sp|Q71YZ5|MENE_LISMF 2-succinylbenzoate--CoA ligase OS=Listeria monocytogenes serotype 4b (strain F2365) GN=menE PE=3 SV=1 5 503 9.0E-15
sp|P58730|MENE_LISMO 2-succinylbenzoate--CoA ligase OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=menE PE=3 SV=2 5 503 1.0E-14
sp|Q96CM8|ACSF2_HUMAN Acyl-CoA synthetase family member 2, mitochondrial OS=Homo sapiens GN=ACSF2 PE=1 SV=2 15 509 2.0E-14
sp|Q499N5|ACSF2_RAT Acyl-CoA synthetase family member 2, mitochondrial OS=Rattus norvegicus GN=Acsf2 PE=2 SV=1 15 509 2.0E-14
sp|Q80WC9|ACSF4_MOUSE Acyl-CoA synthetase family member 4 OS=Mus musculus GN=Aasdh PE=2 SV=1 93 607 3.0E-14
sp|Q8VCW8|ACSF2_MOUSE Acyl-CoA synthetase family member 2, mitochondrial OS=Mus musculus GN=Acsf2 PE=1 SV=1 15 509 3.0E-14
sp|Q54FD2|PKS38_DICDI Probable polyketide synthase 38 OS=Dictyostelium discoideum GN=pks38 PE=3 SV=1 635 869 2.0E-13
sp|Q0S7V5|FAD3_RHOJR 3-[(3aS,4S,7aS)-7a-methyl-1,5-dioxo-octahydro-1H-inden-4-yl]propanoyl:CoA ligase OS=Rhodococcus jostii (strain RHA1) GN=fadD3 PE=1 SV=1 16 498 2.0E-13
sp|Q55CN6|PKS3_DICDI Probable polyketide synthase 3 OS=Dictyostelium discoideum GN=pks3 PE=3 SV=1 635 849 4.0E-13
sp|Q54FN7|PKS33_DICDI Probable polyketide synthase 33 OS=Dictyostelium discoideum GN=pks33 PE=3 SV=2 636 869 3.0E-12
sp|P23971|MENE_BACSU 2-succinylbenzoate--CoA ligase OS=Bacillus subtilis (strain 168) GN=menE PE=1 SV=2 12 498 1.0E-11
sp|O07610|LCFB_BACSU Long-chain-fatty-acid--CoA ligase OS=Bacillus subtilis (strain 168) GN=lcfB PE=2 SV=2 5 509 1.0E-11
sp|Q9SMT7|4CLLA_ARATH Oxalate--CoA ligase OS=Arabidopsis thaliana GN=AAE3 PE=1 SV=1 281 511 2.0E-11
sp|A8FGK6|MENE_BACP2 2-succinylbenzoate--CoA ligase OS=Bacillus pumilus (strain SAFR-032) GN=menE PE=3 SV=1 12 503 2.0E-11
sp|Q7WSH3|FADD3_COMTE 3-[(3aS,4S,7aS)-7a-methyl-1,5-dioxo-octahydro-1H-inden-4-yl]propanoyl:CoA ligase OS=Comamonas testosteroni GN=fadD3 PE=3 SV=1 17 505 3.0E-11
sp|P40871|DHBE_BACSU 2,3-dihydroxybenzoate-AMP ligase OS=Bacillus subtilis (strain 168) GN=dhbE PE=1 SV=2 200 509 4.0E-11
sp|A7Z809|MENE_BACMF 2-succinylbenzoate--CoA ligase OS=Bacillus methylotrophicus (strain DSM 23117 / BGSC 10A6 / FZB42) GN=menE PE=3 SV=1 12 498 4.0E-11
sp|Q92AY8|MENE_LISIN 2-succinylbenzoate--CoA ligase OS=Listeria innocua serovar 6a (strain CLIP 11262) GN=menE PE=3 SV=2 5 503 7.0E-11
sp|Q0DV32|4CLL1_ORYSJ 4-coumarate--CoA ligase-like 1 OS=Oryza sativa subsp. japonica GN=4CLL1 PE=2 SV=2 111 498 2.0E-10
sp|Q838K1|MENE_ENTFA 2-succinylbenzoate--CoA ligase OS=Enterococcus faecalis (strain ATCC 700802 / V583) GN=menE PE=3 SV=1 42 498 2.0E-10
sp|P94547|LCFA_BACSU Long-chain-fatty-acid--CoA ligase OS=Bacillus subtilis (strain 168) GN=lcfA PE=3 SV=1 335 506 3.0E-10
sp|Q65FT5|MENE_BACLD 2-succinylbenzoate--CoA ligase OS=Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / NBRC 12200 / NCIMB 9375 / NRRL NRS-1264 / Gibson 46) GN=menE PE=3 SV=1 7 498 3.0E-10
sp|Q9AJS8|3HBCL_THAAR 3-hydroxybenzoate--CoA/4-hydroxybenzoate--CoA ligase OS=Thauera aromatica GN=hcl PE=1 SV=1 16 508 3.0E-10
sp|Q5RG49|ACSF4_DANRE Acyl-CoA synthetase family member 4 OS=Danio rerio GN=aasdh PE=3 SV=1 136 603 3.0E-10
sp|A7GU88|MENE_BACCN 2-succinylbenzoate--CoA ligase OS=Bacillus cytotoxicus (strain DSM 22905 / CIP 110041 / 391-98 / NVH 391-98) GN=menE PE=3 SV=1 7 497 4.0E-10
sp|Q84P21|4CLL5_ARATH 4-coumarate--CoA ligase-like 5 OS=Arabidopsis thaliana GN=4CLL5 PE=1 SV=2 144 505 6.0E-10
sp|Q8ZES9|LCFA_YERPE Long-chain-fatty-acid--CoA ligase OS=Yersinia pestis GN=fadD PE=3 SV=1 17 498 8.0E-10
sp|P41636|4CL_PINTA 4-coumarate--CoA ligase OS=Pinus taeda GN=4CL PE=2 SV=1 146 498 9.0E-10
sp|O31826|YNGI_BACSU Putative acyl-CoA synthetase YngI OS=Bacillus subtilis (strain 168) GN=yngI PE=3 SV=1 146 506 1.0E-09
sp|Q84P25|4CLL2_ARATH 4-coumarate--CoA ligase-like 2 OS=Arabidopsis thaliana GN=4CLL2 PE=2 SV=2 144 498 2.0E-09
sp|A1ZAI5|FACR1_DROME Putative fatty acyl-CoA reductase CG5065 OS=Drosophila melanogaster GN=CG5065 PE=3 SV=1 618 834 2.0E-09
sp|Q91VA0|ACSM1_MOUSE Acyl-coenzyme A synthetase ACSM1, mitochondrial OS=Mus musculus GN=Acsm1 PE=1 SV=1 52 503 4.0E-09
sp|P69451|LCFA_ECOLI Long-chain-fatty-acid--CoA ligase OS=Escherichia coli (strain K12) GN=fadD PE=1 SV=1 279 498 4.0E-09
sp|P69452|LCFA_ECOL6 Long-chain-fatty-acid--CoA ligase OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=fadD PE=3 SV=1 279 498 4.0E-09
sp|Q8VZF1|AEE7_ARATH Acetate/butyrate--CoA ligase AAE7, peroxisomal OS=Arabidopsis thaliana GN=AAE7 PE=1 SV=1 13 513 4.0E-09
sp|Q0P4F7|ACSF2_DANRE Acyl-CoA synthetase family member 2, mitochondrial OS=Danio rerio GN=acsf2 PE=2 SV=1 143 509 5.0E-09
sp|Q8XDR6|LCFA_ECO57 Long-chain-fatty-acid--CoA ligase OS=Escherichia coli O157:H7 GN=fadD PE=3 SV=1 279 498 5.0E-09
sp|P96843|FAD3_MYCTU 3-[(3aS,4S,7aS)-7a-methyl-1,5-dioxo-octahydro-1H-inden-4-yl]propanoyl:CoA ligase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=fadD3 PE=1 SV=1 142 498 5.0E-09
sp|Q960W6|FACR3_DROME Putative fatty acyl-CoA reductase CG8306 OS=Drosophila melanogaster GN=CG8306 PE=2 SV=1 625 756 9.0E-09
sp|O07899|VIBE_VIBCH Vibriobactin-specific 2,3-dihydroxybenzoate-AMP ligase OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=vibE PE=3 SV=1 146 503 1.0E-08
sp|O74976|FAT2_SCHPO Putative peroxisomal-coenzyme A synthetase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC1827.03c PE=1 SV=1 144 498 1.0E-08
sp|P63521|LCFA_SALTY Long-chain-fatty-acid--CoA ligase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=fadD PE=3 SV=1 279 498 1.0E-08
sp|P63522|LCFA_SALTI Long-chain-fatty-acid--CoA ligase OS=Salmonella typhi GN=fadD PE=3 SV=1 279 498 1.0E-08
sp|O24145|4CL1_TOBAC 4-coumarate--CoA ligase 1 OS=Nicotiana tabacum GN=4CL1 PE=2 SV=1 146 510 1.0E-08
sp|Q9BEA2|ACSM1_BOVIN Acyl-coenzyme A synthetase ACSM1, mitochondrial OS=Bos taurus GN=ACSM1 PE=1 SV=2 144 503 2.0E-08
sp|C6DE43|AAS_PECCP Bifunctional protein Aas OS=Pectobacterium carotovorum subsp. carotovorum (strain PC1) GN=aas PE=3 SV=1 144 509 2.0E-08
sp|P40806|PKSJ_BACSU Polyketide synthase PksJ OS=Bacillus subtilis (strain 168) GN=pksJ PE=1 SV=3 26 600 2.0E-08
sp|Q7TN78|ACSM4_RAT Acyl-coenzyme A synthetase ACSM4, mitochondrial OS=Rattus norvegicus GN=Acsm4 PE=2 SV=1 144 503 3.0E-08
sp|P38137|FAT2_YEAST Peroxisomal-coenzyme A synthetase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PCS60 PE=1 SV=1 88 509 3.0E-08
sp|Q9C8D4|AAE11_ARATH Butyrate--CoA ligase AAE11, peroxisomal OS=Arabidopsis thaliana GN=AAE11 PE=1 SV=1 146 498 3.0E-08
sp|P14913|4CL2_PETCR 4-coumarate--CoA ligase 1 OS=Petroselinum crispum GN=4CL2 PE=2 SV=1 146 513 4.0E-08
sp|B2VFS7|AAS_ERWT9 Bifunctional protein Aas OS=Erwinia tasmaniensis (strain DSM 17950 / Et1/99) GN=aas PE=3 SV=1 135 509 5.0E-08
sp|Q96K12|FACR2_HUMAN Fatty acyl-CoA reductase 2 OS=Homo sapiens GN=FAR2 PE=2 SV=1 635 758 5.0E-08
sp|Q10S72|4CLL4_ORYSJ 4-coumarate--CoA ligase-like 4 OS=Oryza sativa subsp. japonica GN=4CLL4 PE=2 SV=1 144 505 5.0E-08
sp|Q9FFE9|AAE6_ARATH Probable acyl-activating enzyme 6 OS=Arabidopsis thaliana GN=AAE6 PE=2 SV=1 315 498 5.0E-08
sp|P14912|4CL1_PETCR 4-coumarate--CoA ligase 1 OS=Petroselinum crispum GN=4CL1 PE=2 SV=1 16 513 6.0E-08
sp|Q0VZ70|CHSAD_CHOCO Chondramide synthase cmdD OS=Chondromyces crocatus GN=cmdD PE=1 SV=1 466 616 8.0E-08
sp|Q6NUN0|ACSM5_HUMAN Acyl-coenzyme A synthetase ACSM5, mitochondrial OS=Homo sapiens GN=ACSM5 PE=1 SV=2 72 510 1.0E-07
sp|A1ZAI3|FACR2_DROME Putative fatty acyl-CoA reductase CG8303 OS=Drosophila melanogaster GN=CG8303 PE=2 SV=2 624 757 1.0E-07
sp|Q84P26|4CLL8_ARATH 4-coumarate--CoA ligase-like 8 OS=Arabidopsis thaliana GN=4CLL8 PE=2 SV=2 124 505 1.0E-07
sp|Q9S777|4CL3_ARATH 4-coumarate--CoA ligase 3 OS=Arabidopsis thaliana GN=4CL3 PE=1 SV=1 100 498 1.0E-07
sp|A4WE11|AAS_ENT38 Bifunctional protein Aas OS=Enterobacter sp. (strain 638) GN=aas PE=3 SV=1 141 509 2.0E-07
sp|Q55DM7|PKS2_DICDI Probable polyketide synthase 2 OS=Dictyostelium discoideum GN=pks2 PE=3 SV=1 635 863 2.0E-07
sp|F4HUK6|AAE1_ARATH Probable acyl-activating enzyme 1, peroxisomal OS=Arabidopsis thaliana GN=AAE1 PE=2 SV=1 337 498 2.0E-07
sp|Q8WVX9|FACR1_HUMAN Fatty acyl-CoA reductase 1 OS=Homo sapiens GN=FAR1 PE=1 SV=1 635 757 2.0E-07
sp|Q8BGA8|ACSM5_MOUSE Acyl-coenzyme A synthetase ACSM5, mitochondrial OS=Mus musculus GN=Acsm5 PE=1 SV=1 144 498 3.0E-07
sp|Q5R834|FACR1_PONAB Fatty acyl-CoA reductase 1 OS=Pongo abelii GN=FAR1 PE=2 SV=1 635 757 3.0E-07
sp|Q9C9G2|AEE22_ARATH Probable acyl-activating enzyme 22 OS=Arabidopsis thaliana GN=AEE22 PE=3 SV=1 256 498 3.0E-07
sp|Q9LXN3|FACR4_ARATH Probable fatty acyl-CoA reductase 4 OS=Arabidopsis thaliana GN=FAR4 PE=2 SV=1 630 795 3.0E-07
sp|Q6ETN3|4CL3_ORYSJ Probable 4-coumarate--CoA ligase 3 OS=Oryza sativa subsp. japonica GN=4CL3 PE=2 SV=1 146 510 4.0E-07
sp|Q42982|4CL2_ORYSJ Probable 4-coumarate--CoA ligase 2 OS=Oryza sativa subsp. japonica GN=4CL2 PE=2 SV=2 146 498 5.0E-07
sp|Q42524|4CL1_ARATH 4-coumarate--CoA ligase 1 OS=Arabidopsis thaliana GN=4CL1 PE=1 SV=1 18 510 5.0E-07
sp|Q7ZXF5|FACR1_XENLA Fatty acyl-CoA reductase 1 OS=Xenopus laevis GN=far1 PE=2 SV=1 635 757 6.0E-07
sp|Q8Z406|AAS_SALTI Bifunctional protein Aas OS=Salmonella typhi GN=aas PE=3 SV=1 144 499 7.0E-07
sp|Q26304|LUCI_LUCMI Luciferin 4-monooxygenase OS=Luciola mingrelica PE=1 SV=1 129 509 7.0E-07
sp|C0PXJ8|AAS_SALPC Bifunctional protein Aas OS=Salmonella paratyphi C (strain RKS4594) GN=aas PE=3 SV=1 144 499 8.0E-07
sp|Q57KA7|AAS_SALCH Bifunctional protein Aas OS=Salmonella choleraesuis (strain SC-B67) GN=aas PE=3 SV=1 144 499 8.0E-07
sp|B5BFH6|AAS_SALPK Bifunctional protein Aas OS=Salmonella paratyphi A (strain AKU_12601) GN=aas PE=3 SV=1 144 499 9.0E-07
sp|Q5PEN7|AAS_SALPA Bifunctional protein Aas OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=aas PE=3 SV=1 144 499 9.0E-07
sp|B4TUM9|AAS_SALSV Bifunctional protein Aas OS=Salmonella schwarzengrund (strain CVM19633) GN=aas PE=3 SV=1 144 499 9.0E-07
sp|B5RDY6|AAS_SALG2 Bifunctional protein Aas OS=Salmonella gallinarum (strain 287/91 / NCTC 13346) GN=aas PE=3 SV=1 144 499 9.0E-07
sp|B5F4V4|AAS_SALA4 Bifunctional protein Aas OS=Salmonella agona (strain SL483) GN=aas PE=3 SV=1 144 499 9.0E-07
sp|A9N3H8|AAS_SALPB Bifunctional protein Aas OS=Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7) GN=aas PE=3 SV=1 144 499 9.0E-07
sp|B4TGR5|AAS_SALHS Bifunctional protein Aas OS=Salmonella heidelberg (strain SL476) GN=aas PE=3 SV=1 144 499 9.0E-07
sp|B5QWU2|AAS_SALEP Bifunctional protein Aas OS=Salmonella enteritidis PT4 (strain P125109) GN=aas PE=3 SV=1 144 499 9.0E-07
sp|Q4WT66|NRPS1_ASPFU Nonribosomal peptide synthetase 1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS1 PE=1 SV=1 13 521 1.0E-06
sp|Q3E6Y4|4CLL3_ARATH 4-coumarate--CoA ligase-like 3 OS=Arabidopsis thaliana GN=4CLL3 PE=2 SV=2 144 505 1.0E-06
sp|P13129|LUCI_LUCCR Luciferin 4-monooxygenase OS=Luciola cruciata PE=1 SV=1 144 509 1.0E-06
sp|Q8VYJ1|MENE_ARATH 2-succinylbenzoate--CoA ligase, chloroplastic/peroxisomal OS=Arabidopsis thaliana GN=AAE14 PE=1 SV=1 144 498 1.0E-06
sp|Q0P5J1|FACR2_BOVIN Fatty acyl-CoA reductase 2 OS=Bos taurus GN=FAR2 PE=2 SV=1 635 758 2.0E-06
sp|B4T503|AAS_SALNS Bifunctional protein Aas OS=Salmonella newport (strain SL254) GN=aas PE=3 SV=1 144 499 2.0E-06
sp|B5FUB9|AAS_SALDC Bifunctional protein Aas OS=Salmonella dublin (strain CT_02021853) GN=aas PE=3 SV=1 144 499 2.0E-06
sp|A7MR36|AAS_CROS8 Bifunctional protein Aas OS=Cronobacter sakazakii (strain ATCC BAA-894) GN=aas PE=3 SV=1 144 509 2.0E-06
sp|Q8ZMA4|AAS_SALTY Bifunctional protein Aas OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=aas PE=3 SV=1 144 499 2.0E-06
sp|P38135|FADK_ECOLI Short-chain-fatty-acid--CoA ligase OS=Escherichia coli (strain K12) GN=fadK PE=1 SV=3 144 498 2.0E-06
sp|Q7TNT2|FACR2_MOUSE Fatty acyl-CoA reductase 2 OS=Mus musculus GN=Far2 PE=2 SV=1 635 758 3.0E-06
sp|Q9M0X9|4CLL7_ARATH 4-coumarate--CoA ligase-like 7 OS=Arabidopsis thaliana GN=4CLL7 PE=1 SV=1 2 507 3.0E-06
sp|A6TDH2|AAS_KLEP7 Bifunctional protein Aas OS=Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578) GN=aas PE=3 SV=1 141 499 4.0E-06
sp|A8AP56|AAS_CITK8 Bifunctional protein Aas OS=Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696) GN=aas PE=3 SV=1 141 499 4.0E-06
sp|B5XUP2|AAS_KLEP3 Bifunctional protein Aas OS=Klebsiella pneumoniae (strain 342) GN=aas PE=3 SV=1 141 499 5.0E-06
sp|Q01158|LUCI_LUCLA Luciferin 4-monooxygenase OS=Luciola lateralis PE=2 SV=1 144 509 6.0E-06
sp|P80436|TRS1_STRTI Triostin synthetase I OS=Streptomyces triostinicus GN=trsA PE=1 SV=2 320 503 7.0E-06
sp|P31687|4CL2_SOYBN 4-coumarate--CoA ligase 2 OS=Glycine max PE=2 SV=2 21 508 8.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0003824 catalytic activity Yes
GO:0006694 steroid biosynthetic process Yes
GO:0003854 3-beta-hydroxy-delta5-steroid dehydrogenase activity Yes
GO:0055114 oxidation-reduction process Yes
GO:0016616 oxidoreductase activity, acting on the CH-OH group of donors, NAD or NADP as acceptor Yes
GO:0050662 coenzyme binding Yes
GO:0006629 lipid metabolic process No
GO:0003674 molecular_function No
GO:0005488 binding No
GO:1901360 organic cyclic compound metabolic process No
GO:0048037 cofactor binding No
GO:0009058 biosynthetic process No
GO:0044238 primary metabolic process No
GO:1901576 organic substance biosynthetic process No
GO:0016491 oxidoreductase activity No
GO:0008152 metabolic process No
GO:0008610 lipid biosynthetic process No
GO:0033764 steroid dehydrogenase activity, acting on the CH-OH group of donors, NAD or NADP as acceptor No
GO:0016229 steroid dehydrogenase activity No
GO:0008150 biological_process No
GO:0071704 organic substance metabolic process No
GO:1901362 organic cyclic compound biosynthetic process No
GO:0016614 oxidoreductase activity, acting on CH-OH group of donors No
GO:0008202 steroid metabolic process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 18 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|352
MQSRLVSWLHNTPAATAIVNGSITLSYRDLFNKAKAIAWDLYQSGLAQNEPVGIIYDASHEQIIAQVGVLVAGGT
CVSISLASPLSRIVAMLHDIKVKRVIADKNGPFKSDEFSILYLNDVLSGNCEQVHFDIPARQGVYCSHILFTSGT
TGKPKAVQISNQGILHLATKTPVTPFCPGDRLAAFNDTGFDLSLFETWATLLSGASIVLTPKATVTDASGLQAFF
TREKISITIIPTALFNIIASACPGTFGSLKHVVVTGEPASRAALRAVLESNPPQHLWNAYGPTEGTTFATMHEMT
MQETRRDRLTIGGAIGQMRVCLVDEQLKVIEESQQRGEICIAGPQVSLGYLNAADQNESSFIHLTEAALTGARGP
GSQAMVRLYRSGDMAEWRSGERLLDFIGRADSQVKLGGFRVELGEVEETLFLSRLLKSISVVVQPATRQGSTAQL
VAFVVPENEASFRADDLLAFARARLPHYMVPRRVQIISKLPISARGKIDGQALLQSLEQGPSPCHSVTRLENGAD
KNGNAHLLGQIWSNVLGISCIADHDNLVSLGASSLQNAALIAQIKTRMGRLISMHDLYRHAHFSQLLDFINSSSE
SIAAPDDCARWIQDTHLADDIQLVPSWDAHDQGYIFLTGATGFLGAYLLQQFLLLPCVKQVACLVRASSCAEAAQ
RIEQNMRQYDLWPADAAQTSKIKALHGDVARHDLGLGQETFTWLSNWASAIFHAAAKVNFCDSYHEHYASNVCGT
RNILRLAALGRRKILHYLSSIDVWGQTGYFLGTKTVLEDEPIAPHIQGLRHDIGYAQSKWTAEGMVRRMRHRGLP
VIIYRPGFIMGHSKTGASNPKDYMSRHIIGCIQLGLWPNINMRVEYVTVDYVVSALLHISRSSSNIGRSFSLLSP
ILDDSVRFNDTCAVIKDAGFNMLLADYKTWLNALIEKADANNPLLPIMPMLQEQVFGKLTRTEVSENCPFYDSRN
TVQALKGRDDIRYVPLTPDLVKRYIAFWDRKGFYSV*
Coding >OphauB2|352
ATGCAAAGTCGACTCGTTTCGTGGTTACACAACACACCCGCAGCTACAGCCATAGTCAATGGCTCCATCACTCTA
TCCTACCGCGACCTCTTCAACAAGGCCAAAGCCATTGCCTGGGACCTCTATCAAAGCGGCCTGGCGCAAAATGAG
CCCGTGGGAATCATTTACGACGCGAGCCATGAGCAAATCATTGCCCAAGTTGGCGTACTTGTTGCCGGCGGCACC
TGCGTTTCCATATCGCTAGCTAGCCCACTGTCACGCATCGTTGCTATGCTTCATGACATCAAGGTCAAGCGCGTC
ATTGCCGACAAGAACGGCCCGTTTAAAAGTGACGAATTTTCCATATTGTATTTAAATGACGTGCTGAGTGGAAAC
TGTGAGCAAGTCCATTTCGATATTCCTGCACGACAGGGCGTCTATTGCTCTCATATCCTCTTCACTTCTGGCACC
ACTGGAAAGCCAAAGGCTGTGCAAATCAGCAACCAAGGCATTCTTCATCTTGCTACAAAGACTCCAGTGACGCCA
TTTTGTCCTGGGGACCGTCTAGCCGCGTTTAATGACACGGGCTTTGATCTCAGCCTGTTTGAGACTTGGGCTACG
CTGTTGTCGGGAGCCAGCATTGTCTTGACGCCAAAAGCAACAGTGACAGATGCTTCCGGCTTGCAGGCCTTTTTC
ACTCGTGAAAAGATATCCATCACCATTATCCCTACTGCGCTCTTCAACATCATTGCAAGTGCTTGCCCTGGGACC
TTTGGCAGCCTCAAACATGTCGTGGTGACGGGTGAGCCTGCTAGCAGAGCAGCCCTGCGTGCCGTGCTCGAGAGC
AACCCACCACAGCACTTGTGGAACGCATACGGGCCCACAGAGGGCACCACTTTTGCCACCATGCACGAAATGACC
ATGCAAGAGACTCGGCGTGACCGGCTCACTATTGGAGGTGCAATAGGCCAAATGAGGGTATGTCTCGTGGATGAG
CAGCTCAAGGTCATTGAGGAGAGCCAACAAAGGGGTGAAATTTGCATTGCCGGCCCGCAAGTGTCTTTGGGATAC
TTGAACGCTGCTGACCAGAATGAATCGAGCTTTATCCACCTCACCGAGGCAGCATTGACTGGGGCTCGCGGACCC
GGCTCTCAAGCAATGGTTCGCCTCTACCGCTCGGGTGACATGGCGGAATGGCGGTCTGGCGAGCGCCTTCTTGAT
TTTATCGGAAGAGCGGATAGCCAGGTCAAGCTTGGCGGCTTCCGCGTCGAACTGGGCGAGGTTGAAGAGACGCTT
TTCCTCAGCAGGCTGCTAAAGTCCATCAGCGTGGTTGTCCAACCAGCAACACGGCAAGGCTCCACGGCACAGCTG
GTTGCCTTTGTCGTGCCCGAGAATGAAGCCAGCTTTAGGGCAGACGACTTGCTCGCTTTTGCTCGTGCAAGGCTC
CCTCACTACATGGTGCCGCGGCGCGTGCAAATCATATCAAAACTGCCCATTAGCGCTCGGGGAAAAATTGATGGT
CAAGCGCTGCTACAGAGCTTGGAACAAGGCCCGAGCCCCTGTCATTCAGTAACCCGACTTGAAAATGGCGCCGAC
AAGAATGGAAATGCCCACCTTCTTGGGCAAATTTGGAGCAACGTGCTCGGCATCTCTTGCATCGCTGACCATGAC
AACCTCGTGTCGCTAGGAGCCAGCTCGCTGCAAAACGCAGCCCTCATTGCCCAAATCAAGACTCGCATGGGCCGC
CTCATCTCCATGCACGACTTGTACCGCCATGCCCACTTCTCACAGCTGCTCGACTTTATCAACAGCAGCAGCGAG
TCCATTGCCGCCCCTGACGACTGCGCAAGATGGATCCAGGATACCCATCTCGCCGACGACATTCAACTAGTGCCC
AGCTGGGATGCCCACGATCAAGGCTATATATTCCTCACGGGCGCCACGGGCTTCCTGGGAGCCTACCTCTTGCAG
CAGTTTCTCCTCCTCCCCTGCGTCAAGCAAGTCGCCTGCCTCGTCCGCGCGAGCAGTTGCGCCGAGGCAGCGCAG
CGCATCGAGCAAAACATGAGACAATACGACTTGTGGCCAGCCGATGCCGCCCAGACGAGCAAAATCAAAGCCCTC
CATGGCGATGTCGCTCGCCACGACCTCGGCCTCGGCCAAGAGACCTTTACCTGGCTATCCAACTGGGCCAGTGCC
ATTTTCCACGCAGCGGCAAAAGTCAACTTTTGCGACTCCTATCATGAGCACTATGCTTCCAACGTTTGCGGCACC
CGCAACATTCTCCGTCTTGCTGCCCTTGGCCGCCGCAAGATACTGCACTACCTGTCCAGCATTGACGTCTGGGGC
CAGACGGGCTACTTCCTCGGCACAAAGACTGTCCTCGAAGACGAGCCCATTGCACCGCACATTCAAGGCCTGCGC
CACGACATTGGCTATGCTCAGAGCAAGTGGACGGCCGAGGGCATGGTCCGCCGCATGCGCCACCGCGGCCTTCCC
GTCATCATCTACCGCCCCGGCTTCATCATGGGCCACTCAAAAACGGGCGCCAGCAATCCCAAGGACTACATGAGC
CGCCACATCATCGGCTGCATCCAGCTCGGCCTCTGGCCAAACATCAACATGCGCGTCGAGTACGTCACTGTCGAC
TATGTAGTCAGCGCCCTGCTGCACATTTCTCGCTCCAGCAGCAATATAGGCCGTTCATTCAGCCTCCTCTCACCC
ATCCTCGACGACTCGGTCCGGTTCAACGATACCTGTGCTGTAATCAAGGATGCCGGCTTCAACATGCTCTTGGCT
GACTACAAGACTTGGCTCAACGCCCTCATCGAAAAAGCCGACGCCAACAACCCTCTTTTGCCCATCATGCCAATG
CTCCAAGAACAAGTCTTTGGCAAGTTGACTCGCACAGAGGTTAGCGAAAATTGTCCCTTTTATGACTCGCGCAAT
ACTGTCCAAGCCTTGAAGGGGAGAGACGACATTCGCTACGTGCCCTTGACCCCTGACCTGGTGAAGCGATACATT
GCATTTTGGGACAGAAAGGGCTTTTACTCGGTGTAG
Transcript >OphauB2|352
ATGCAAAGTCGACTCGTTTCGTGGTTACACAACACACCCGCAGCTACAGCCATAGTCAATGGCTCCATCACTCTA
TCCTACCGCGACCTCTTCAACAAGGCCAAAGCCATTGCCTGGGACCTCTATCAAAGCGGCCTGGCGCAAAATGAG
CCCGTGGGAATCATTTACGACGCGAGCCATGAGCAAATCATTGCCCAAGTTGGCGTACTTGTTGCCGGCGGCACC
TGCGTTTCCATATCGCTAGCTAGCCCACTGTCACGCATCGTTGCTATGCTTCATGACATCAAGGTCAAGCGCGTC
ATTGCCGACAAGAACGGCCCGTTTAAAAGTGACGAATTTTCCATATTGTATTTAAATGACGTGCTGAGTGGAAAC
TGTGAGCAAGTCCATTTCGATATTCCTGCACGACAGGGCGTCTATTGCTCTCATATCCTCTTCACTTCTGGCACC
ACTGGAAAGCCAAAGGCTGTGCAAATCAGCAACCAAGGCATTCTTCATCTTGCTACAAAGACTCCAGTGACGCCA
TTTTGTCCTGGGGACCGTCTAGCCGCGTTTAATGACACGGGCTTTGATCTCAGCCTGTTTGAGACTTGGGCTACG
CTGTTGTCGGGAGCCAGCATTGTCTTGACGCCAAAAGCAACAGTGACAGATGCTTCCGGCTTGCAGGCCTTTTTC
ACTCGTGAAAAGATATCCATCACCATTATCCCTACTGCGCTCTTCAACATCATTGCAAGTGCTTGCCCTGGGACC
TTTGGCAGCCTCAAACATGTCGTGGTGACGGGTGAGCCTGCTAGCAGAGCAGCCCTGCGTGCCGTGCTCGAGAGC
AACCCACCACAGCACTTGTGGAACGCATACGGGCCCACAGAGGGCACCACTTTTGCCACCATGCACGAAATGACC
ATGCAAGAGACTCGGCGTGACCGGCTCACTATTGGAGGTGCAATAGGCCAAATGAGGGTATGTCTCGTGGATGAG
CAGCTCAAGGTCATTGAGGAGAGCCAACAAAGGGGTGAAATTTGCATTGCCGGCCCGCAAGTGTCTTTGGGATAC
TTGAACGCTGCTGACCAGAATGAATCGAGCTTTATCCACCTCACCGAGGCAGCATTGACTGGGGCTCGCGGACCC
GGCTCTCAAGCAATGGTTCGCCTCTACCGCTCGGGTGACATGGCGGAATGGCGGTCTGGCGAGCGCCTTCTTGAT
TTTATCGGAAGAGCGGATAGCCAGGTCAAGCTTGGCGGCTTCCGCGTCGAACTGGGCGAGGTTGAAGAGACGCTT
TTCCTCAGCAGGCTGCTAAAGTCCATCAGCGTGGTTGTCCAACCAGCAACACGGCAAGGCTCCACGGCACAGCTG
GTTGCCTTTGTCGTGCCCGAGAATGAAGCCAGCTTTAGGGCAGACGACTTGCTCGCTTTTGCTCGTGCAAGGCTC
CCTCACTACATGGTGCCGCGGCGCGTGCAAATCATATCAAAACTGCCCATTAGCGCTCGGGGAAAAATTGATGGT
CAAGCGCTGCTACAGAGCTTGGAACAAGGCCCGAGCCCCTGTCATTCAGTAACCCGACTTGAAAATGGCGCCGAC
AAGAATGGAAATGCCCACCTTCTTGGGCAAATTTGGAGCAACGTGCTCGGCATCTCTTGCATCGCTGACCATGAC
AACCTCGTGTCGCTAGGAGCCAGCTCGCTGCAAAACGCAGCCCTCATTGCCCAAATCAAGACTCGCATGGGCCGC
CTCATCTCCATGCACGACTTGTACCGCCATGCCCACTTCTCACAGCTGCTCGACTTTATCAACAGCAGCAGCGAG
TCCATTGCCGCCCCTGACGACTGCGCAAGATGGATCCAGGATACCCATCTCGCCGACGACATTCAACTAGTGCCC
AGCTGGGATGCCCACGATCAAGGCTATATATTCCTCACGGGCGCCACGGGCTTCCTGGGAGCCTACCTCTTGCAG
CAGTTTCTCCTCCTCCCCTGCGTCAAGCAAGTCGCCTGCCTCGTCCGCGCGAGCAGTTGCGCCGAGGCAGCGCAG
CGCATCGAGCAAAACATGAGACAATACGACTTGTGGCCAGCCGATGCCGCCCAGACGAGCAAAATCAAAGCCCTC
CATGGCGATGTCGCTCGCCACGACCTCGGCCTCGGCCAAGAGACCTTTACCTGGCTATCCAACTGGGCCAGTGCC
ATTTTCCACGCAGCGGCAAAAGTCAACTTTTGCGACTCCTATCATGAGCACTATGCTTCCAACGTTTGCGGCACC
CGCAACATTCTCCGTCTTGCTGCCCTTGGCCGCCGCAAGATACTGCACTACCTGTCCAGCATTGACGTCTGGGGC
CAGACGGGCTACTTCCTCGGCACAAAGACTGTCCTCGAAGACGAGCCCATTGCACCGCACATTCAAGGCCTGCGC
CACGACATTGGCTATGCTCAGAGCAAGTGGACGGCCGAGGGCATGGTCCGCCGCATGCGCCACCGCGGCCTTCCC
GTCATCATCTACCGCCCCGGCTTCATCATGGGCCACTCAAAAACGGGCGCCAGCAATCCCAAGGACTACATGAGC
CGCCACATCATCGGCTGCATCCAGCTCGGCCTCTGGCCAAACATCAACATGCGCGTCGAGTACGTCACTGTCGAC
TATGTAGTCAGCGCCCTGCTGCACATTTCTCGCTCCAGCAGCAATATAGGCCGTTCATTCAGCCTCCTCTCACCC
ATCCTCGACGACTCGGTCCGGTTCAACGATACCTGTGCTGTAATCAAGGATGCCGGCTTCAACATGCTCTTGGCT
GACTACAAGACTTGGCTCAACGCCCTCATCGAAAAAGCCGACGCCAACAACCCTCTTTTGCCCATCATGCCAATG
CTCCAAGAACAAGTCTTTGGCAAGTTGACTCGCACAGAGGTTAGCGAAAATTGTCCCTTTTATGACTCGCGCAAT
ACTGTCCAAGCCTTGAAGGGGAGAGACGACATTCGCTACGTGCCCTTGACCCCTGACCTGGTGAAGCGATACATT
GCATTTTGGGACAGAAAGGGCTTTTACTCGGTGTAG
Gene >OphauB2|352
ATGCAAAGTCGACTCGTTTCGTGGTTACACAACACACCCGCAGCTACAGCCATAGTCAATGGCTCCATCACTCTA
TCCTACCGCGACCTCTTCAACAAGGCCAAAGCCATTGCCTGGGACCTCTATCAAAGCGGCCTGGCGCAAAATGAG
CCCGTGGGAATCATTTACGACGCGAGCCATGAGCAAATCATTGCCCAAGTTGGCGTACTTGTTGCCGGCGGCACC
TGCGTTTCCATATCGCTAGCTAGCCCACTGTCACGCATCGTTGCTATGCTTCATGACATCAAGGTCAAGCGCGTC
ATTGCCGACAAGAACGGCCCGTTTAAAAGTGACGAATTTTCCATATTGTATTTAAATGACGTGCTGAGTGGAAAC
TGTGAGCAAGTCCATTTCGATATTCCTGCACGACAGGGCGTCTATTGCTCTCATATCCTCTTCACTTCTGGCACC
ACTGGAAAGCCAAAGGCTGTGCAAATCAGCAACCAAGGCATTCTTCATCTTGCTACAAAGACTCCAGTGACGCCA
TTTTGTCCTGGGGACCGTCTAGCCGCGTTTAATGACACGGGCTTTGATCTCAGCCTGTTTGAGACTTGGGCTACG
CTGTTGTCGGGAGCCAGCATTGTCTTGACGCCAAAAGCAACAGTGACAGATGCTTCCGGCTTGCAGGCCTTTTTC
ACTCGTGAAAAGATATCCATCACCATTATCCCTACTGCGCTCTTCAACATCATTGCAAGTGCTTGCCCTGGGACC
TTTGGCAGCCTCAAACATGTCGTGGTGACGGGTGAGCCTGCTAGCAGAGCAGCCCTGCGTGCCGTGCTCGAGAGC
AACCCACCACAGCACTTGTGGAACGCATACGGGCCCACAGAGGGCACCACTTTTGCCACCATGCACGAAATGACC
ATGCAAGAGACTCGGCGTGACCGGCTCACTATTGGAGGTGCAATAGGCCAAATGAGGGTATGTCTCGTGGATGAG
CAGCTCAAGGTCATTGAGGAGAGCCAACAAAGGGGTGAAATTTGCATTGCCGGCCCGCAAGTGTCTTTGGGATAC
TTGAACGCTGCTGACCAGAATGAATCGAGCTTTATCCACCTCACCGAGGCAGCATTGACTGGGGCTCGCGGACCC
GGCTCTCAAGCAATGGTTCGCCTCTACCGCTCGGGTGACATGGCGGAATGGCGGTCTGGCGAGCGCCTTCTTGAT
TTTATCGGAAGAGCGGATAGCCAGGTCAAGCTTGGCGGCTTCCGCGTCGAACTGGGCGAGGTTGAAGAGACGCTT
TTCCTCAGCAGGCTGCTAAAGTCCATCAGCGTGGTTGTCCAACCAGCAACACGGCAAGGCTCCACGGCACAGCTG
GTTGCCTTTGTCGTGCCCGAGAATGAAGCCAGCTTTAGGGCAGACGACTTGCTCGCTTTTGCTCGTGCAAGGCTC
CCTCACTACATGGTGCCGCGGCGCGTGCAAATCATATCAAAACTGCCCATTAGCGCTCGGGGAAAAATTGATGGT
CAAGCGCTGCTACAGAGCTTGGAACAAGGCCCGAGCCCCTGTCATTCAGTAACCCGACTTGAAAATGGCGCCGAC
AAGAATGGAAATGCCCACCTTCTTGGGCAAATTTGGAGCAACGTGCTCGGCATCTCTTGCATCGCTGACCATGAC
AACCTCGTGTCGCTAGGAGCCAGCTCGCTGCAAAACGCAGCCCTCATTGCCCAAATCAAGACTCGCATGGGCCGC
CTCATCTCCATGCACGACTTGTACCGCCATGCCCACTTCTCACAGCTGCTCGACTTTATCAACAGCAGCAGCGAG
TCCATTGCCGCCCCTGACGACTGCGCAAGATGGATCCAGGATACCCATCTCGCCGACGACATTCAACTAGTGCCC
AGCTGGGATGCCCACGATCAAGGCTATATATTCCTCACGGGCGCCACGGGCTTCCTGGGAGCCTACCTCTTGCAG
CAGTTTCTCCTCCTCCCCTGCGTCAAGCAAGTCGCCTGCCTCGTCCGCGCGAGCAGTTGCGCCGAGGCAGCGCAG
CGCATCGAGCAAAACATGAGACAATACGACTTGTGGCCAGCCGATGCCGCCCAGACGAGCAAAATCAAAGCCCTC
CATGGCGATGTCGCTCGCCACGACCTCGGCCTCGGCCAAGAGACCTTTACCTGGCTATCCAACTGGGCCAGTGCC
ATTTTCCACGCAGCGGCAAAAGTCAACTTTTGCGACTCCTATCATGAGCACTATGCTTCCAACGTTTGCGGCACC
CGCAACATTCTCCGTCTTGCTGCCCTTGGCCGCCGCAAGATACTGCACTACCTGTCCAGCATTGACGTCTGGGGC
CAGACGGGCTACTTCCTCGGCACAAAGACTGTCCTCGAAGACGAGCCCATTGCACCGCACATTCAAGGCCTGCGC
CACGACATTGGCTATGCTCAGAGCAAGTGGACGGCCGAGGGCATGGTCCGCCGCATGCGCCACCGCGGCCTTCCC
GTCATCATCTACCGCCCCGGCTTCATCATGGGCCACTCAAAAACGGGCGCCAGCAATCCCAAGGACTACATGAGC
CGCCACATCATCGGCTGCATCCAGCTCGGCCTCTGGCCAAACATCAACATGCGCGTCGAGTACGTCACTGTCGAC
TATGTAGTCAGCGCCCTGCTGCACATTTCTCGCTCCAGCAGCAATATAGGCCGTTCATTCAGCCTCCTCTCACCC
ATCCTCGACGACTCGGTCCGGTTCAACGATACCTGTGCTGTAATCAAGGATGCCGGCTTCAACATGCTCTTGGCT
GACTACAAGACTTGGCTCAACGCCCTCATCGAAAAAGCCGACGCCAACAACCCTCTTTTGCCCATCATGCCAATG
CTCCAAGAACAAGTCTTTGGCAAGTTGACTCGCACAGAGGTTAGCGAAAATTGTCCCTTTTATGACTCGCGCAAT
ACTGTCCAAGCCTTGAAGGGGAGAGACGACATTCGCTACGTGCCCTTGACCCCTGACCTGGTGAAGCGATACATT
GCATTTTGGGACAGAAAGGGCTTTTACTCGGTGTAG

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail