Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|3513
Gene name
LocationContig_222:843..1630
Strand+
Gene length (bp)787
Transcript length (bp)711
Coding sequence length (bp)711
Protein length (aa) 237

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01174 SNO SNO glutamine amidotransferase family 1.1E-53 13 233
PF07685 GATase_3 CobB/CobQ-like glutamine amidotransferase domain 4.2E-09 33 121
PF03575 Peptidase_S51 Peptidase family S51 2.3E-05 48 111

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q8LAD0|PDX2_ARATH Probable pyridoxal 5'-phosphate synthase subunit PDX2 OS=Arabidopsis thaliana GN=PDX2 PE=1 SV=1 9 231 4.0E-57
sp|Q54J48|PDX2_DICDI Probable pyridoxal 5'-phosphate synthase subunit pdx2 OS=Dictyostelium discoideum GN=pdx2 PE=1 SV=1 9 235 4.0E-47
sp|Q03144|SNO1_YEAST Pyridoxal 5'-phosphate synthase subunit SNO1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SNO1 PE=1 SV=1 2 234 1.0E-45
sp|P53823|SNO2_YEAST Probable pyridoxal 5'-phosphate synthase subunit SNO2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SNO2 PE=3 SV=1 9 234 5.0E-45
sp|P43544|SNO3_YEAST Probable pyridoxal 5'-phosphate synthase subunit SNO3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SNO3 PE=1 SV=1 9 234 7.0E-45
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q8LAD0|PDX2_ARATH Probable pyridoxal 5'-phosphate synthase subunit PDX2 OS=Arabidopsis thaliana GN=PDX2 PE=1 SV=1 9 231 4.0E-57
sp|Q54J48|PDX2_DICDI Probable pyridoxal 5'-phosphate synthase subunit pdx2 OS=Dictyostelium discoideum GN=pdx2 PE=1 SV=1 9 235 4.0E-47
sp|Q03144|SNO1_YEAST Pyridoxal 5'-phosphate synthase subunit SNO1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SNO1 PE=1 SV=1 2 234 1.0E-45
sp|P53823|SNO2_YEAST Probable pyridoxal 5'-phosphate synthase subunit SNO2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SNO2 PE=3 SV=1 9 234 5.0E-45
sp|P43544|SNO3_YEAST Probable pyridoxal 5'-phosphate synthase subunit SNO3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SNO3 PE=1 SV=1 9 234 7.0E-45
sp|B6YVQ8|PDXT_THEON Pyridoxal 5'-phosphate synthase subunit PdxT OS=Thermococcus onnurineus (strain NA1) GN=pdxT PE=3 SV=1 8 234 3.0E-43
sp|A5UK48|PDXT_METS3 Pyridoxal 5'-phosphate synthase subunit PdxT OS=Methanobrevibacter smithii (strain PS / ATCC 35061 / DSM 861) GN=pdxT PE=3 SV=1 8 235 3.0E-43
sp|Q9UTE4|YFM8_SCHPO Uncharacterized glutaminase C222.08c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC222.08c PE=3 SV=1 11 232 2.0E-42
sp|Q4JVD5|PDXT_CORJK Pyridoxal 5'-phosphate synthase subunit PdxT OS=Corynebacterium jeikeium (strain K411) GN=pdxT PE=3 SV=1 9 231 2.0E-42
sp|Q5WKW1|PDXT_BACSK Pyridoxal 5'-phosphate synthase subunit PdxT OS=Bacillus clausii (strain KSM-K16) GN=pdxT PE=3 SV=1 11 231 3.0E-42
sp|Q8TH23|PDXT_PYRFU Pyridoxal 5'-phosphate synthase subunit PdxT OS=Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1) GN=pdxT PE=3 SV=1 8 234 3.0E-42
sp|Q1AWE7|PDXT_RUBXD Pyridoxal 5'-phosphate synthase subunit PdxT OS=Rubrobacter xylanophilus (strain DSM 9941 / NBRC 16129) GN=pdxT PE=3 SV=1 11 233 2.0E-41
sp|Q929R8|PDXT_LISIN Pyridoxal 5'-phosphate synthase subunit PdxT OS=Listeria innocua serovar 6a (strain CLIP 11262) GN=pdxT PE=3 SV=1 11 234 5.0E-41
sp|Q3Z8V9|PDXT_DEHM1 Pyridoxal 5'-phosphate synthase subunit PdxT OS=Dehalococcoides mccartyi (strain ATCC BAA-2266 / KCTC 15142 / 195) GN=pdxT PE=3 SV=1 11 231 7.0E-41
sp|O59079|PDXT_PYRHO Pyridoxal 5'-phosphate synthase subunit PdxT OS=Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3) GN=pdxT PE=3 SV=1 11 234 4.0E-40
sp|A0LUK9|PDXT_ACIC1 Pyridoxal 5'-phosphate synthase subunit PdxT OS=Acidothermus cellulolyticus (strain ATCC 43068 / 11B) GN=pdxT PE=3 SV=1 1 230 4.0E-40
sp|Q81ZV5|PDXT_STRAW Pyridoxal 5'-phosphate synthase subunit PdxT OS=Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680) GN=pdxT PE=3 SV=1 10 231 1.0E-39
sp|Q6AFB8|PDXT_LEIXX Pyridoxal 5'-phosphate synthase subunit PdxT OS=Leifsonia xyli subsp. xyli (strain CTCB07) GN=pdxT PE=3 SV=1 11 230 2.0E-39
sp|B1W3G0|PDXT_STRGG Pyridoxal 5'-phosphate synthase subunit PdxT OS=Streptomyces griseus subsp. griseus (strain JCM 4626 / NBRC 13350) GN=pdxT PE=3 SV=1 10 231 2.0E-39
sp|Q4PJX5|PDX2_PLABE Pyridoxal 5'-phosphate synthase subunit Pdx2 OS=Plasmodium berghei GN=pdx2 PE=1 SV=1 9 233 4.0E-39
sp|Q8TQH7|PDXT_METAC Pyridoxal 5'-phosphate synthase subunit PdxT OS=Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A) GN=pdxT PE=3 SV=1 11 234 5.0E-39
sp|Q8PUA4|PDXT_METMA Pyridoxal 5'-phosphate synthase subunit PdxT OS=Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88) GN=pdxT PE=3 SV=2 11 235 7.0E-39
sp|C5A4H0|PDXT_THEGJ Pyridoxal 5'-phosphate synthase subunit PdxT OS=Thermococcus gammatolerans (strain DSM 15229 / JCM 11827 / EJ3) GN=pdxT PE=3 SV=1 8 234 1.0E-38
sp|Q2RMI9|PDXT_MOOTA Pyridoxal 5'-phosphate synthase subunit PdxT OS=Moorella thermoacetica (strain ATCC 39073) GN=pdxT PE=3 SV=1 11 231 1.0E-38
sp|Q47N39|PDXT_THEFY Pyridoxal 5'-phosphate synthase subunit PdxT OS=Thermobifida fusca (strain YX) GN=pdxT PE=3 SV=1 11 231 1.0E-38
sp|Q9V0J6|PDXT_PYRAB Pyridoxal 5'-phosphate synthase subunit PdxT OS=Pyrococcus abyssi (strain GE5 / Orsay) GN=pdxT PE=3 SV=1 11 234 1.0E-38
sp|B8DH16|PDXT_LISMH Pyridoxal 5'-phosphate synthase subunit PdxT OS=Listeria monocytogenes serotype 4a (strain HCC23) GN=pdxT PE=3 SV=1 11 234 1.0E-38
sp|A1T876|PDXT_MYCVP Pyridoxal 5'-phosphate synthase subunit PdxT OS=Mycobacterium vanbaalenii (strain DSM 7251 / PYR-1) GN=pdxT PE=3 SV=1 11 233 2.0E-38
sp|Q8Y5G1|PDXT_LISMO Pyridoxal 5'-phosphate synthase subunit PdxT OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=pdxT PE=3 SV=1 11 234 3.0E-38
sp|Q3A8Q0|PDXT_CARHZ Pyridoxal 5'-phosphate synthase subunit PdxT OS=Carboxydothermus hydrogenoformans (strain ATCC BAA-161 / DSM 6008 / Z-2901) GN=pdxT PE=3 SV=1 11 233 4.0E-38
sp|A5FRL6|PDXT_DEHMB Pyridoxal 5'-phosphate synthase subunit PdxT OS=Dehalococcoides mccartyi (strain ATCC BAA-2100 / JCM 16839 / KCTC 5957 / BAV1) GN=pdxT PE=3 SV=1 11 231 7.0E-38
sp|A0JXB5|PDXT_ARTS2 Pyridoxal 5'-phosphate synthase subunit PdxT OS=Arthrobacter sp. (strain FB24) GN=pdxT PE=3 SV=1 11 231 7.0E-38
sp|Q5YTE0|PDXT_NOCFA Pyridoxal 5'-phosphate synthase subunit PdxT OS=Nocardia farcinica (strain IFM 10152) GN=pdxT PE=3 SV=2 11 231 8.0E-38
sp|Q0W8A8|PDXT_METAR Pyridoxal 5'-phosphate synthase subunit PdxT OS=Methanocella arvoryzae (strain DSM 22066 / NBRC 105507 / MRE50) GN=pdxT PE=3 SV=1 11 234 1.0E-37
sp|Q8L1A7|PDXT_BACCI Pyridoxal 5'-phosphate synthase subunit PdxT OS=Bacillus circulans GN=pdxT PE=1 SV=1 11 231 1.0E-37
sp|A0AKK9|PDXT_LISW6 Pyridoxal 5'-phosphate synthase subunit PdxT OS=Listeria welshimeri serovar 6b (strain ATCC 35897 / DSM 20650 / SLCC5334) GN=pdxT PE=3 SV=1 11 234 1.0E-37
sp|A7Z0D4|PDXT_BACMF Pyridoxal 5'-phosphate synthase subunit PdxT OS=Bacillus methylotrophicus (strain DSM 23117 / BGSC 10A6 / FZB42) GN=pdxT PE=3 SV=1 8 231 1.0E-37
sp|C1KX54|PDXT_LISMC Pyridoxal 5'-phosphate synthase subunit PdxT OS=Listeria monocytogenes serotype 4b (strain CLIP80459) GN=pdxT PE=3 SV=1 11 234 1.0E-37
sp|Q71XR2|PDXT_LISMF Pyridoxal 5'-phosphate synthase subunit PdxT OS=Listeria monocytogenes serotype 4b (strain F2365) GN=pdxT PE=3 SV=1 11 234 2.0E-37
sp|C1B4C5|PDXT_RHOOB Pyridoxal 5'-phosphate synthase subunit PdxT OS=Rhodococcus opacus (strain B4) GN=pdxT PE=3 SV=1 10 231 2.0E-37
sp|B8H9E0|PDXT_ARTCA Pyridoxal 5'-phosphate synthase subunit PdxT OS=Arthrobacter chlorophenolicus (strain ATCC 700700 / DSM 12829 / JCM 12360 / NCIMB 13794 / A6) GN=pdxT PE=3 SV=1 11 231 2.0E-37
sp|A1SJA2|PDXT_NOCSJ Pyridoxal 5'-phosphate synthase subunit PdxT OS=Nocardioides sp. (strain BAA-499 / JS614) GN=pdxT PE=3 SV=1 11 231 3.0E-37
sp|A1R728|PDXT_ARTAT Pyridoxal 5'-phosphate synthase subunit PdxT OS=Arthrobacter aurescens (strain TC1) GN=pdxT PE=3 SV=2 11 231 3.0E-37
sp|C5D338|PDXT_GEOSW Pyridoxal 5'-phosphate synthase subunit PdxT OS=Geobacillus sp. (strain WCH70) GN=pdxT PE=3 SV=1 8 231 3.0E-37
sp|O26292|PDXT_METTH Pyridoxal 5'-phosphate synthase subunit PdxT OS=Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H) GN=pdxT PE=3 SV=1 8 235 3.0E-37
sp|Q9L287|PDXT_STRCO Pyridoxal 5'-phosphate synthase subunit PdxT OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=pdxT PE=3 SV=1 10 226 3.0E-37
sp|A7GJS9|PDXT_BACCN Pyridoxal 5'-phosphate synthase subunit PdxT OS=Bacillus cytotoxicus (strain DSM 22905 / CIP 110041 / 391-98 / NVH 391-98) GN=pdxT PE=3 SV=1 8 231 3.0E-37
sp|Q83HM6|PDXT_TROW8 Pyridoxal 5'-phosphate synthase subunit PdxT OS=Tropheryma whipplei (strain TW08/27) GN=pdxT PE=3 SV=1 9 231 3.0E-37
sp|Q0S1D2|PDXT_RHOJR Pyridoxal 5'-phosphate synthase subunit PdxT OS=Rhodococcus jostii (strain RHA1) GN=pdxT PE=3 SV=1 10 231 4.0E-37
sp|Q83GK3|PDXT_TROWT Pyridoxal 5'-phosphate synthase subunit PdxT OS=Tropheryma whipplei (strain Twist) GN=pdxT PE=3 SV=1 9 231 4.0E-37
sp|Q5JFR2|PDXT_THEKO Pyridoxal 5'-phosphate synthase subunit PdxT OS=Thermococcus kodakarensis (strain ATCC BAA-918 / JCM 12380 / KOD1) GN=pdxT PE=3 SV=1 8 232 4.0E-37
sp|Q7VL87|PDXT_HAEDU Pyridoxal 5'-phosphate synthase subunit PdxT OS=Haemophilus ducreyi (strain 35000HP / ATCC 700724) GN=pdxT PE=3 SV=1 11 233 5.0E-37
sp|A8A8T7|PDXT_IGNH4 Pyridoxal 5'-phosphate synthase subunit PdxT OS=Ignicoccus hospitalis (strain KIN4/I / DSM 18386 / JCM 14125) GN=pdxT PE=3 SV=2 11 232 5.0E-37
sp|Q12YR6|PDXT_METBU Pyridoxal 5'-phosphate synthase subunit PdxT OS=Methanococcoides burtonii (strain DSM 6242 / NBRC 107633 / OCM 468 / ACE-M) GN=pdxT PE=3 SV=1 11 235 6.0E-37
sp|Q465J4|PDXT_METBF Pyridoxal 5'-phosphate synthase subunit PdxT OS=Methanosarcina barkeri (strain Fusaro / DSM 804) GN=pdxT PE=3 SV=1 11 234 9.0E-37
sp|A8KZF0|PDXT_FRASN Pyridoxal 5'-phosphate synthase subunit PdxT OS=Frankia sp. (strain EAN1pec) GN=pdxT PE=3 SV=1 11 231 1.0E-36
sp|Q3ZX06|PDXT_DEHMC Pyridoxal 5'-phosphate synthase subunit PdxT OS=Dehalococcoides mccartyi (strain CBDB1) GN=pdxT PE=3 SV=1 11 231 1.0E-36
sp|B0BUD1|PDXT_ACTPJ Pyridoxal 5'-phosphate synthase subunit PdxT OS=Actinobacillus pleuropneumoniae serotype 3 (strain JL03) GN=pdxT PE=3 SV=1 11 233 1.0E-36
sp|B3GXB7|PDXT_ACTP7 Pyridoxal 5'-phosphate synthase subunit PdxT OS=Actinobacillus pleuropneumoniae serotype 7 (strain AP76) GN=pdxT PE=3 SV=1 11 233 1.0E-36
sp|B8G664|PDXT_CHLAD Pyridoxal 5'-phosphate synthase subunit PdxT OS=Chloroflexus aggregans (strain MD-66 / DSM 9485) GN=pdxT PE=3 SV=1 9 231 3.0E-36
sp|Q04F27|PDXT_OENOB Pyridoxal 5'-phosphate synthase subunit PdxT OS=Oenococcus oeni (strain ATCC BAA-331 / PSU-1) GN=pdxT PE=3 SV=1 9 231 5.0E-36
sp|Q63HF7|PDXT_BACCZ Pyridoxal 5'-phosphate synthase subunit PdxT OS=Bacillus cereus (strain ZK / E33L) GN=pdxT PE=3 SV=1 8 231 6.0E-36
sp|A9VMA0|PDXT_BACWK Pyridoxal 5'-phosphate synthase subunit PdxT OS=Bacillus weihenstephanensis (strain KBAB4) GN=pdxT PE=3 SV=1 8 231 6.0E-36
sp|Q3IU60|PDXT_NATPD Pyridoxal 5'-phosphate synthase subunit PdxT OS=Natronomonas pharaonis (strain ATCC 35678 / DSM 2160) GN=pdxT PE=3 SV=1 8 226 8.0E-36
sp|B7GFL9|PDXT_ANOFW Pyridoxal 5'-phosphate synthase subunit PdxT OS=Anoxybacillus flavithermus (strain DSM 21510 / WK1) GN=pdxT PE=3 SV=1 8 231 9.0E-36
sp|Q6A947|PDXT_PROAC Pyridoxal 5'-phosphate synthase subunit PdxT OS=Propionibacterium acnes (strain KPA171202 / DSM 16379) GN=pdxT PE=3 SV=1 10 233 1.0E-35
sp|A3MZT9|PDXT_ACTP2 Pyridoxal 5'-phosphate synthase subunit PdxT OS=Actinobacillus pleuropneumoniae serotype 5b (strain L20) GN=pdxT PE=3 SV=1 11 233 1.0E-35
sp|A5CS10|PDXT_CLAM3 Pyridoxal 5'-phosphate synthase subunit PdxT OS=Clavibacter michiganensis subsp. michiganensis (strain NCPPB 382) GN=pdxT PE=3 SV=1 10 231 1.0E-35
sp|P37528|PDXT_BACSU Pyridoxal 5'-phosphate synthase subunit PdxT OS=Bacillus subtilis (strain 168) GN=pdxT PE=1 SV=1 8 231 2.0E-35
sp|B9IYH9|PDXT_BACCQ Pyridoxal 5'-phosphate synthase subunit PdxT OS=Bacillus cereus (strain Q1) GN=pdxT PE=3 SV=1 8 231 2.0E-35
sp|B7HPS7|PDXT_BACC7 Pyridoxal 5'-phosphate synthase subunit PdxT OS=Bacillus cereus (strain AH187) GN=pdxT PE=3 SV=1 8 231 2.0E-35
sp|Q73FJ4|PDXT_BACC1 Pyridoxal 5'-phosphate synthase subunit PdxT OS=Bacillus cereus (strain ATCC 10987 / NRS 248) GN=pdxT PE=3 SV=1 8 231 2.0E-35
sp|A0QWH0|PDXT_MYCS2 Pyridoxal 5'-phosphate synthase subunit PdxT OS=Mycobacterium smegmatis (strain ATCC 700084 / mc(2)155) GN=pdxT PE=1 SV=1 11 233 3.0E-35
sp|A9B890|PDXT_HERA2 Pyridoxal 5'-phosphate synthase subunit PdxT OS=Herpetosiphon aurantiacus (strain ATCC 23779 / DSM 785) GN=pdxT PE=3 SV=1 9 230 3.0E-35
sp|Q81JC5|PDXT_BACCR Pyridoxal 5'-phosphate synthase subunit PdxT OS=Bacillus cereus (strain ATCC 14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL B-3711) GN=pdxT PE=3 SV=1 8 231 3.0E-35
sp|Q9YFK4|PDXT_AERPE Pyridoxal 5'-phosphate synthase subunit PdxT OS=Aeropyrum pernix (strain ATCC 700893 / DSM 11879 / JCM 9820 / NBRC 100138 / K1) GN=pdxT PE=3 SV=2 11 231 3.0E-35
sp|B0REB6|PDXT_CLAMS Pyridoxal 5'-phosphate synthase subunit PdxT OS=Clavibacter michiganensis subsp. sepedonicus (strain ATCC 33113 / DSM 20744 / JCM 9667 / LMG 2889 / C-1) GN=pdxT PE=3 SV=1 10 231 3.0E-35
sp|B7HII4|PDXT_BACC4 Pyridoxal 5'-phosphate synthase subunit PdxT OS=Bacillus cereus (strain B4264) GN=pdxT PE=3 SV=1 8 231 4.0E-35
sp|Q9KGN5|PDXT_BACHD Pyridoxal 5'-phosphate synthase subunit PdxT OS=Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125) GN=pdxT PE=3 SV=1 8 231 4.0E-35
sp|B9LIK4|PDXT_CHLSY Pyridoxal 5'-phosphate synthase subunit PdxT OS=Chloroflexus aurantiacus (strain ATCC 29364 / DSM 637 / Y-400-fl) GN=pdxT PE=3 SV=1 9 231 5.0E-35
sp|A9WFU0|PDXT_CHLAA Pyridoxal 5'-phosphate synthase subunit PdxT OS=Chloroflexus aurantiacus (strain ATCC 29366 / DSM 635 / J-10-fl) GN=pdxT PE=3 SV=1 9 231 5.0E-35
sp|B7IS30|PDXT_BACC2 Pyridoxal 5'-phosphate synthase subunit PdxT OS=Bacillus cereus (strain G9842) GN=pdxT PE=3 SV=1 8 231 5.0E-35
sp|Q9CLJ5|PDXT_PASMU Pyridoxal 5'-phosphate synthase subunit PdxT OS=Pasteurella multocida (strain Pm70) GN=pdxT PE=3 SV=1 11 231 5.0E-35
sp|Q2NGI4|PDXT_METST Pyridoxal 5'-phosphate synthase subunit PdxT OS=Methanosphaera stadtmanae (strain ATCC 43021 / DSM 3091 / JCM 11832 / MCB-3) GN=pdxT PE=3 SV=1 8 233 7.0E-35
sp|O29741|PDXT_ARCFU Pyridoxal 5'-phosphate synthase subunit PdxT OS=Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126) GN=pdxT PE=3 SV=1 11 231 7.0E-35
sp|A7NQB7|PDXT_ROSCS Pyridoxal 5'-phosphate synthase subunit PdxT OS=Roseiflexus castenholzii (strain DSM 13941 / HLO8) GN=pdxT PE=3 SV=1 9 231 7.0E-35
sp|A9WSE8|PDXT_RENSM Pyridoxal 5'-phosphate synthase subunit PdxT OS=Renibacterium salmoninarum (strain ATCC 33209 / DSM 20767 / JCM 11484 / NBRC 15589 / NCIMB 2235) GN=pdxT PE=3 SV=1 7 233 1.0E-34
sp|Q9RUL8|PDXT_DEIRA Pyridoxal 5'-phosphate synthase subunit PdxT OS=Deinococcus radiodurans (strain ATCC 13939 / DSM 20539 / JCM 16871 / LMG 4051 / NBRC 15346 / NCIMB 9279 / R1 / VKM B-1422) GN=pdxT PE=3 SV=1 9 230 1.0E-34
sp|A8FAD6|PDXT_BACP2 Pyridoxal 5'-phosphate synthase subunit PdxT OS=Bacillus pumilus (strain SAFR-032) GN=pdxT PE=3 SV=1 8 231 1.0E-34
sp|A4IJ95|PDXT_GEOTN Pyridoxal 5'-phosphate synthase subunit PdxT OS=Geobacillus thermodenitrificans (strain NG80-2) GN=pdxT PE=3 SV=1 11 231 2.0E-34
sp|A5UY93|PDXT_ROSS1 Pyridoxal 5'-phosphate synthase subunit PdxT OS=Roseiflexus sp. (strain RS-1) GN=pdxT PE=3 SV=1 9 230 2.0E-34
sp|C5CG73|PDXT_KOSOT Pyridoxal 5'-phosphate synthase subunit PdxT OS=Kosmotoga olearia (strain TBF 19.5.1) GN=pdxT PE=3 SV=1 11 234 2.0E-34
sp|Q8IIK4|PDX2_PLAF7 Pyridoxal 5'-phosphate synthase subunit Pdx2 OS=Plasmodium falciparum (isolate 3D7) GN=pdx2 PE=1 SV=2 9 233 4.0E-34
sp|Q72KF8|PDXT_THET2 Pyridoxal 5'-phosphate synthase subunit PdxT OS=Thermus thermophilus (strain HB27 / ATCC BAA-163 / DSM 7039) GN=pdxT PE=3 SV=1 10 231 5.0E-34
sp|Q5HRN4|PDXT_STAEQ Pyridoxal 5'-phosphate synthase subunit PdxT OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=pdxT PE=3 SV=1 8 234 6.0E-34
sp|B1I158|PDXT_DESAP Pyridoxal 5'-phosphate synthase subunit PdxT OS=Desulforudis audaxviator (strain MP104C) GN=pdxT PE=3 SV=1 8 231 8.0E-34
sp|A5MZY0|PDXT_CLOK5 Pyridoxal 5'-phosphate synthase subunit PdxT OS=Clostridium kluyveri (strain ATCC 8527 / DSM 555 / NCIMB 10680) GN=pdxT PE=3 SV=1 11 231 9.0E-34
sp|B9E3V5|PDXT_CLOK1 Pyridoxal 5'-phosphate synthase subunit PdxT OS=Clostridium kluyveri (strain NBRC 12016) GN=pdxT PE=3 SV=1 11 231 9.0E-34
sp|Q1IZC9|PDXT_DEIGD Pyridoxal 5'-phosphate synthase subunit PdxT OS=Deinococcus geothermalis (strain DSM 11300) GN=pdxT PE=3 SV=1 11 234 1.0E-33
sp|A6WCI3|PDXT_KINRD Pyridoxal 5'-phosphate synthase subunit PdxT OS=Kineococcus radiotolerans (strain ATCC BAA-149 / DSM 14245 / SRS30216) GN=pdxT PE=3 SV=1 11 231 1.0E-33
sp|Q65PL1|PDXT_BACLD Pyridoxal 5'-phosphate synthase subunit PdxT OS=Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / NBRC 12200 / NCIMB 9375 / NRRL NRS-1264 / Gibson 46) GN=pdxT PE=3 SV=1 8 231 1.0E-33
sp|Q59055|PDXT_METJA Pyridoxal 5'-phosphate synthase subunit PdxT OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=pdxT PE=1 SV=1 9 231 1.0E-33
sp|Q5L3Y1|PDXT_GEOKA Pyridoxal 5'-phosphate synthase subunit PdxT OS=Geobacillus kaustophilus (strain HTA426) GN=pdxT PE=1 SV=1 11 231 1.0E-33
sp|A8F840|PDXT_PSELT Pyridoxal 5'-phosphate synthase subunit PdxT OS=Pseudothermotoga lettingae (strain ATCC BAA-301 / DSM 14385 / NBRC 107922 / TMO) GN=pdxT PE=3 SV=2 9 231 2.0E-33
sp|A3DM32|PDXT_STAMF Pyridoxal 5'-phosphate synthase subunit PdxT OS=Staphylothermus marinus (strain ATCC 43588 / DSM 3639 / JCM 9404 / F1) GN=pdxT PE=3 SV=1 11 234 2.0E-33
sp|Q18KL6|PDXT_HALWD Pyridoxal 5'-phosphate synthase subunit PdxT OS=Haloquadratum walsbyi (strain DSM 16790 / HBSQ001) GN=pdxT PE=3 SV=1 8 226 2.0E-33
sp|Q8CQV8|PDXT_STAES Pyridoxal 5'-phosphate synthase subunit PdxT OS=Staphylococcus epidermidis (strain ATCC 12228) GN=pdxT PE=3 SV=1 11 234 2.0E-33
sp|A7HNV0|PDXT_FERNB Pyridoxal 5'-phosphate synthase subunit PdxT OS=Fervidobacterium nodosum (strain ATCC 35602 / DSM 5306 / Rt17-B1) GN=pdxT PE=3 SV=1 9 231 2.0E-33
sp|A0RTP4|PDXT_CENSY Pyridoxal 5'-phosphate synthase subunit PdxT OS=Cenarchaeum symbiosum (strain A) GN=pdxT PE=3 SV=1 11 231 3.0E-33
sp|Q6HQ04|PDXT_BACHK Pyridoxal 5'-phosphate synthase subunit PdxT OS=Bacillus thuringiensis subsp. konkukian (strain 97-27) GN=pdxT PE=3 SV=1 8 231 3.0E-33
sp|C1ES18|PDXT_BACC3 Pyridoxal 5'-phosphate synthase subunit PdxT OS=Bacillus cereus (strain 03BB102) GN=pdxT PE=3 SV=1 8 231 3.0E-33
sp|B7JJC7|PDXT_BACC0 Pyridoxal 5'-phosphate synthase subunit PdxT OS=Bacillus cereus (strain AH820) GN=pdxT PE=3 SV=1 8 231 3.0E-33
sp|A0R890|PDXT_BACAH Pyridoxal 5'-phosphate synthase subunit PdxT OS=Bacillus thuringiensis (strain Al Hakam) GN=pdxT PE=3 SV=2 8 231 3.0E-33
sp|A4FBA2|PDXT_SACEN Pyridoxal 5'-phosphate synthase subunit PdxT OS=Saccharopolyspora erythraea (strain ATCC 11635 / DSM 40517 / JCM 4748 / NBRC 13426 / NCIMB 8594 / NRRL 2338) GN=pdxT PE=3 SV=1 10 231 3.0E-33
sp|Q9UWX4|PDXT_SULSO Pyridoxal 5'-phosphate synthase subunit PdxT OS=Sulfolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) GN=pdxT PE=3 SV=1 11 231 3.0E-33
sp|Q49V29|PDXT_STAS1 Pyridoxal 5'-phosphate synthase subunit PdxT OS=Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229) GN=pdxT PE=3 SV=1 11 234 3.0E-33
sp|Q6MEN7|PDXT_PARUW Pyridoxal 5'-phosphate synthase subunit PdxT OS=Protochlamydia amoebophila (strain UWE25) GN=pdxT PE=3 SV=1 9 231 4.0E-33
sp|A3MSM9|PDXT_PYRCJ Pyridoxal 5'-phosphate synthase subunit PdxT OS=Pyrobaculum calidifontis (strain JCM 11548 / VA1) GN=pdxT PE=3 SV=1 11 232 5.0E-33
sp|A5D6D2|PDXT_PELTS Pyridoxal 5'-phosphate synthase subunit PdxT OS=Pelotomaculum thermopropionicum (strain DSM 13744 / JCM 10971 / SI) GN=pdxT PE=3 SV=1 11 235 5.0E-33
sp|Q5UZW7|PDXT_HALMA Pyridoxal 5'-phosphate synthase subunit PdxT OS=Haloarcula marismortui (strain ATCC 43049 / DSM 3752 / JCM 8966 / VKM B-1809) GN=pdxT PE=3 SV=1 12 226 5.0E-33
sp|B6YQU3|PDXT_AZOPC Pyridoxal 5'-phosphate synthase subunit PdxT OS=Azobacteroides pseudotrichonymphae genomovar. CFP2 GN=pdxT PE=3 SV=1 11 234 7.0E-33
sp|Q8NS90|PDXT_CORGL Pyridoxal 5'-phosphate synthase subunit PdxT OS=Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / LMG 3730 / NCIMB 10025) GN=pdxT PE=3 SV=1 9 231 8.0E-33
sp|Q97CP5|PDXT_THEVO Pyridoxal 5'-phosphate synthase subunit PdxT OS=Thermoplasma volcanium (strain ATCC 51530 / DSM 4299 / JCM 9571 / NBRC 15438 / GSS1) GN=pdxT PE=3 SV=1 11 231 8.0E-33
sp|B1MCJ8|PDXT_MYCA9 Pyridoxal 5'-phosphate synthase subunit PdxT OS=Mycobacterium abscessus (strain ATCC 19977 / DSM 44196 / CIP 104536 / JCM 13569 / NCTC 13031 / TMC 1543) GN=pdxT PE=3 SV=1 10 231 9.0E-33
sp|Q1B9S6|PDXT_MYCSS Pyridoxal 5'-phosphate synthase subunit PdxT OS=Mycobacterium sp. (strain MCS) GN=pdxT PE=3 SV=1 10 231 9.0E-33
sp|A1UF87|PDXT_MYCSK Pyridoxal 5'-phosphate synthase subunit PdxT OS=Mycobacterium sp. (strain KMS) GN=pdxT PE=3 SV=1 10 231 9.0E-33
sp|Q81W26|PDXT_BACAN Pyridoxal 5'-phosphate synthase subunit PdxT OS=Bacillus anthracis GN=pdxT PE=3 SV=1 8 231 9.0E-33
sp|C3LIY8|PDXT_BACAC Pyridoxal 5'-phosphate synthase subunit PdxT OS=Bacillus anthracis (strain CDC 684 / NRRL 3495) GN=pdxT PE=3 SV=1 8 231 9.0E-33
sp|C3P8Q4|PDXT_BACAA Pyridoxal 5'-phosphate synthase subunit PdxT OS=Bacillus anthracis (strain A0248) GN=pdxT PE=3 SV=1 8 231 9.0E-33
sp|A0QIC6|PDXT_MYCA1 Pyridoxal 5'-phosphate synthase subunit PdxT OS=Mycobacterium avium (strain 104) GN=pdxT PE=3 SV=1 11 231 1.0E-32
sp|Q0RNV0|PDXT_FRAAA Pyridoxal 5'-phosphate synthase subunit PdxT OS=Frankia alni (strain ACN14a) GN=pdxT PE=3 SV=1 11 231 1.0E-32
sp|A4QCC4|PDXT_CORGB Pyridoxal 5'-phosphate synthase subunit PdxT OS=Corynebacterium glutamicum (strain R) GN=pdxT PE=3 SV=1 9 231 1.0E-32
sp|Q4L3H9|PDXT_STAHJ Pyridoxal 5'-phosphate synthase subunit PdxT OS=Staphylococcus haemolyticus (strain JCSC1435) GN=pdxT PE=3 SV=1 11 234 2.0E-32
sp|Q9HMD2|PDXT_HALSA Pyridoxal 5'-phosphate synthase subunit PdxT OS=Halobacterium salinarum (strain ATCC 700922 / JCM 11081 / NRC-1) GN=pdxT PE=3 SV=1 9 226 2.0E-32
sp|B0R879|PDXT_HALS3 Pyridoxal 5'-phosphate synthase subunit PdxT OS=Halobacterium salinarum (strain ATCC 29341 / DSM 671 / R1) GN=pdxT PE=3 SV=1 9 226 2.0E-32
sp|Q2JD98|PDXT_FRASC Pyridoxal 5'-phosphate synthase subunit PdxT OS=Frankia sp. (strain CcI3) GN=pdxT PE=3 SV=1 11 233 3.0E-32
sp|A3PYU8|PDXT_MYCSJ Pyridoxal 5'-phosphate synthase subunit PdxT OS=Mycobacterium sp. (strain JLS) GN=pdxT PE=3 SV=1 10 231 3.0E-32
sp|Q4J8L2|PDXT_SULAC Pyridoxal 5'-phosphate synthase subunit PdxT OS=Sulfolobus acidocaldarius (strain ATCC 33909 / DSM 639 / JCM 8929 / NBRC 15157 / NCIMB 11770) GN=pdxT PE=3 SV=1 11 233 4.0E-32
sp|B8I364|PDXT_CLOCE Pyridoxal 5'-phosphate synthase subunit PdxT OS=Clostridium cellulolyticum (strain ATCC 35319 / DSM 5812 / JCM 6584 / H10) GN=pdxT PE=3 SV=1 11 231 4.0E-32
sp|A4X5V4|PDXT_SALTO Pyridoxal 5'-phosphate synthase subunit PdxT OS=Salinispora tropica (strain ATCC BAA-916 / DSM 44818 / CNB-440) GN=pdxT PE=3 SV=1 10 229 6.0E-32
sp|A8LWZ5|PDXT_SALAI Pyridoxal 5'-phosphate synthase subunit PdxT OS=Salinispora arenicola (strain CNS-205) GN=pdxT PE=3 SV=1 10 229 6.0E-32
sp|Q5SKD6|PDXT_THET8 Pyridoxal 5'-phosphate synthase subunit PdxT OS=Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) GN=pdxT PE=1 SV=1 10 231 6.0E-32
sp|C0ZH53|PDXT_BREBN Pyridoxal 5'-phosphate synthase subunit PdxT OS=Brevibacillus brevis (strain 47 / JCM 6285 / NBRC 100599) GN=pdxT PE=3 SV=1 11 231 7.0E-32
sp|C3MW85|PDXT_SULIM Pyridoxal 5'-phosphate synthase subunit PdxT OS=Sulfolobus islandicus (strain M.14.25 / Kamchatka #1) GN=pdxT PE=3 SV=1 11 231 8.0E-32
sp|C4KHU2|PDXT_SULIK Pyridoxal 5'-phosphate synthase subunit PdxT OS=Sulfolobus islandicus (strain M.16.4 / Kamchatka #3) GN=pdxT PE=3 SV=1 11 231 8.0E-32
sp|C3N6C7|PDXT_SULIA Pyridoxal 5'-phosphate synthase subunit PdxT OS=Sulfolobus islandicus (strain M.16.27) GN=pdxT PE=3 SV=1 11 231 8.0E-32
sp|B9KBI1|PDXT_THENN Pyridoxal 5'-phosphate synthase subunit PdxT OS=Thermotoga neapolitana (strain ATCC 49049 / DSM 4359 / NS-E) GN=pdxT PE=3 SV=1 11 231 9.0E-32
sp|Q9WYU3|PDXT_THEMA Pyridoxal 5'-phosphate synthase subunit PdxT OS=Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099) GN=pdxT PE=1 SV=1 11 231 1.0E-31
sp|A2BLL6|PDXT_HYPBU Pyridoxal 5'-phosphate synthase subunit PdxT OS=Hyperthermus butylicus (strain DSM 5456 / JCM 9403 / PLM1-5) GN=pdxT PE=3 SV=1 8 226 1.0E-31
sp|A6M3G5|PDXT_CLOB8 Pyridoxal 5'-phosphate synthase subunit PdxT OS=Clostridium beijerinckii (strain ATCC 51743 / NCIMB 8052) GN=pdxT PE=3 SV=1 11 231 2.0E-31
sp|A9A4S0|PDXT_NITMS Pyridoxal 5'-phosphate synthase subunit PdxT OS=Nitrosopumilus maritimus (strain SCM1) GN=pdxT PE=3 SV=1 11 231 2.0E-31
sp|P83813|PDXT_GEOSE Pyridoxal 5'-phosphate synthase subunit PdxT OS=Geobacillus stearothermophilus GN=pdxT PE=1 SV=1 11 231 2.0E-31
sp|B7IEZ6|PDXT_THEAB Pyridoxal 5'-phosphate synthase subunit PdxT OS=Thermosipho africanus (strain TCF52B) GN=pdxT PE=3 SV=1 11 231 2.0E-31
sp|P9WII7|PDXT_MYCTU Pyridoxal 5'-phosphate synthase subunit PdxT OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=pdxT PE=1 SV=1 11 231 2.0E-31
sp|P9WII6|PDXT_MYCTO Pyridoxal 5'-phosphate synthase subunit PdxT OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=pdxT PE=3 SV=1 11 231 2.0E-31
sp|A5U5V5|PDXT_MYCTA Pyridoxal 5'-phosphate synthase subunit PdxT OS=Mycobacterium tuberculosis (strain ATCC 25177 / H37Ra) GN=pdxT PE=3 SV=1 11 231 2.0E-31
sp|C1AF75|PDXT_MYCBT Pyridoxal 5'-phosphate synthase subunit PdxT OS=Mycobacterium bovis (strain BCG / Tokyo 172 / ATCC 35737 / TMC 1019) GN=pdxT PE=3 SV=1 11 231 2.0E-31
sp|A1KLV4|PDXT_MYCBP Pyridoxal 5'-phosphate synthase subunit PdxT OS=Mycobacterium bovis (strain BCG / Pasteur 1173P2) GN=pdxT PE=3 SV=1 11 231 2.0E-31
sp|Q7TY92|PDXT_MYCBO Pyridoxal 5'-phosphate synthase subunit PdxT OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=pdxT PE=3 SV=1 11 231 2.0E-31
sp|C3MQK7|PDXT_SULIL Pyridoxal 5'-phosphate synthase subunit PdxT OS=Sulfolobus islandicus (strain L.S.2.15 / Lassen #1) GN=pdxT PE=3 SV=1 11 231 3.0E-31
sp|A5IJU9|PDXT_THEP1 Pyridoxal 5'-phosphate synthase subunit PdxT OS=Thermotoga petrophila (strain RKU-1 / ATCC BAA-488 / DSM 13995) GN=pdxT PE=3 SV=1 11 231 3.0E-31
sp|Q6NK10|PDXT_CORDI Pyridoxal 5'-phosphate synthase subunit PdxT OS=Corynebacterium diphtheriae (strain ATCC 700971 / NCTC 13129 / Biotype gravis) GN=pdxT PE=3 SV=1 9 233 3.0E-31
sp|B9DKX8|PDXT_STACT Pyridoxal 5'-phosphate synthase subunit PdxT OS=Staphylococcus carnosus (strain TM300) GN=pdxT PE=3 SV=1 11 234 3.0E-31
sp|Q1IQH8|PDXT_KORVE Pyridoxal 5'-phosphate synthase subunit PdxT OS=Koribacter versatilis (strain Ellin345) GN=pdxT PE=3 SV=1 11 231 4.0E-31
sp|Q7A1R6|PDXT_STAAW Pyridoxal 5'-phosphate synthase subunit PdxT OS=Staphylococcus aureus (strain MW2) GN=pdxT PE=3 SV=1 11 234 5.0E-31
sp|A8YZL6|PDXT_STAAT Pyridoxal 5'-phosphate synthase subunit PdxT OS=Staphylococcus aureus (strain USA300 / TCH1516) GN=pdxT PE=3 SV=1 11 234 5.0E-31
sp|Q6GBW8|PDXT_STAAS Pyridoxal 5'-phosphate synthase subunit PdxT OS=Staphylococcus aureus (strain MSSA476) GN=pdxT PE=3 SV=1 11 234 5.0E-31
sp|Q6GJE9|PDXT_STAAR Pyridoxal 5'-phosphate synthase subunit PdxT OS=Staphylococcus aureus (strain MRSA252) GN=pdxT PE=3 SV=1 11 234 5.0E-31
sp|Q7A7A1|PDXT_STAAN Pyridoxal 5'-phosphate synthase subunit PdxT OS=Staphylococcus aureus (strain N315) GN=pdxT PE=1 SV=1 11 234 5.0E-31
sp|Q99W83|PDXT_STAAM Pyridoxal 5'-phosphate synthase subunit PdxT OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=pdxT PE=3 SV=1 11 234 5.0E-31
sp|A6QEH2|PDXT_STAAE Pyridoxal 5'-phosphate synthase subunit PdxT OS=Staphylococcus aureus (strain Newman) GN=pdxT PE=3 SV=1 11 234 5.0E-31
sp|Q5HIF4|PDXT_STAAC Pyridoxal 5'-phosphate synthase subunit PdxT OS=Staphylococcus aureus (strain COL) GN=pdxT PE=3 SV=1 11 234 5.0E-31
sp|Q2YSE1|PDXT_STAAB Pyridoxal 5'-phosphate synthase subunit PdxT OS=Staphylococcus aureus (strain bovine RF122 / ET3-1) GN=pdxT PE=3 SV=1 11 234 5.0E-31
sp|A5IQ73|PDXT_STAA9 Pyridoxal 5'-phosphate synthase subunit PdxT OS=Staphylococcus aureus (strain JH9) GN=pdxT PE=3 SV=1 11 234 5.0E-31
sp|Q2G0Q0|PDXT_STAA8 Pyridoxal 5'-phosphate synthase subunit PdxT OS=Staphylococcus aureus (strain NCTC 8325) GN=pdxT PE=3 SV=1 11 234 5.0E-31
sp|Q2FJC0|PDXT_STAA3 Pyridoxal 5'-phosphate synthase subunit PdxT OS=Staphylococcus aureus (strain USA300) GN=pdxT PE=3 SV=1 11 234 5.0E-31
sp|A6TYZ6|PDXT_STAA2 Pyridoxal 5'-phosphate synthase subunit PdxT OS=Staphylococcus aureus (strain JH1) GN=pdxT PE=3 SV=1 11 234 5.0E-31
sp|A7WYT2|PDXT_STAA1 Pyridoxal 5'-phosphate synthase subunit PdxT OS=Staphylococcus aureus (strain Mu3 / ATCC 700698) GN=pdxT PE=3 SV=1 11 234 5.0E-31
sp|Q2FTH1|PDXT_METHJ Pyridoxal 5'-phosphate synthase subunit PdxT OS=Methanospirillum hungatei JF-1 (strain ATCC 27890 / DSM 864 / NBRC 100397 / JF-1) GN=pdxT PE=3 SV=1 11 234 5.0E-31
sp|B1L921|PDXT_THESQ Pyridoxal 5'-phosphate synthase subunit PdxT OS=Thermotoga sp. (strain RQ2) GN=pdxT PE=3 SV=1 11 231 5.0E-31
sp|Q8RBJ4|PDXT_CALS4 Pyridoxal 5'-phosphate synthase subunit PdxT OS=Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4) GN=pdxT PE=3 SV=1 11 231 6.0E-31
sp|A2SPK0|PDXT_METLZ Pyridoxal 5'-phosphate synthase subunit PdxT OS=Methanocorpusculum labreanum (strain ATCC 43576 / DSM 4855 / Z) GN=pdxT PE=3 SV=1 11 231 7.0E-31
sp|Q8G575|PDXT_BIFLO Pyridoxal 5'-phosphate synthase subunit PdxT OS=Bifidobacterium longum (strain NCC 2705) GN=pdxT PE=3 SV=2 10 231 7.0E-31
sp|C3NGV9|PDXT_SULIN Pyridoxal 5'-phosphate synthase subunit PdxT OS=Sulfolobus islandicus (strain Y.N.15.51 / Yellowstone #2) GN=pdxT PE=3 SV=1 11 231 7.0E-31
sp|B2IQT4|PDXT_STRPS Pyridoxal 5'-phosphate synthase subunit PdxT OS=Streptococcus pneumoniae (strain CGSP14) GN=pdxT PE=3 SV=1 11 231 8.0E-31
sp|C3NET5|PDXT_SULIY Pyridoxal 5'-phosphate synthase subunit PdxT OS=Sulfolobus islandicus (strain Y.G.57.14 / Yellowstone #1) GN=pdxT PE=3 SV=1 11 231 9.0E-31
sp|P0C036|PDXT_METMP Pyridoxal 5'-phosphate synthase subunit PdxT OS=Methanococcus maripaludis (strain S2 / LL) GN=pdxT PE=3 SV=1 10 235 1.0E-30
sp|A6LP41|PDXT_THEM4 Pyridoxal 5'-phosphate synthase subunit PdxT OS=Thermosipho melanesiensis (strain DSM 12029 / CIP 104789 / BI429) GN=pdxT PE=3 SV=1 11 230 1.0E-30
sp|B0TZ16|PDXT_FRAP2 Pyridoxal 5'-phosphate synthase subunit PdxT OS=Francisella philomiragia subsp. philomiragia (strain ATCC 25017) GN=pdxT PE=3 SV=1 9 231 1.0E-30
sp|Q9CCT5|PDXT_MYCLE Pyridoxal 5'-phosphate synthase subunit PdxT OS=Mycobacterium leprae (strain TN) GN=pdxT PE=3 SV=2 11 231 1.0E-30
sp|B8FZR4|PDXT_DESHD Pyridoxal 5'-phosphate synthase subunit PdxT OS=Desulfitobacterium hafniense (strain DCB-2 / DSM 10664) GN=pdxT PE=3 SV=1 11 233 2.0E-30
sp|A4WHH5|PDXT_PYRAR Pyridoxal 5'-phosphate synthase subunit PdxT OS=Pyrobaculum arsenaticum (strain DSM 13514 / JCM 11321) GN=pdxT PE=3 SV=1 11 223 2.0E-30
sp|A4J0G0|PDXT_DESRM Pyridoxal 5'-phosphate synthase subunit PdxT OS=Desulfotomaculum reducens (strain MI-1) GN=pdxT PE=3 SV=1 9 231 2.0E-30
sp|B0K4N6|PDXT_THEPX Pyridoxal 5'-phosphate synthase subunit PdxT OS=Thermoanaerobacter sp. (strain X514) GN=pdxT PE=3 SV=1 11 231 3.0E-30
sp|B0KAS0|PDXT_THEP3 Pyridoxal 5'-phosphate synthase subunit PdxT OS=Thermoanaerobacter pseudethanolicus (strain ATCC 33223 / 39E) GN=pdxT PE=3 SV=1 11 231 3.0E-30
sp|A7I472|PDXT_METB6 Pyridoxal 5'-phosphate synthase subunit PdxT OS=Methanoregula boonei (strain 6A8) GN=pdxT PE=3 SV=2 11 233 3.0E-30
sp|Q9HM60|PDXT_THEAC Pyridoxal 5'-phosphate synthase subunit PdxT OS=Thermoplasma acidophilum (strain ATCC 25905 / DSM 1728 / JCM 9062 / NBRC 15155 / AMRC-C165) GN=pdxT PE=3 SV=1 11 231 5.0E-30
sp|Q8TWH2|PDXT_METKA Pyridoxal 5'-phosphate synthase subunit PdxT OS=Methanopyrus kandleri (strain AV19 / DSM 6324 / JCM 9639 / NBRC 100938) GN=pdxT PE=3 SV=1 46 233 5.0E-30
sp|A9A909|PDXT_METM6 Pyridoxal 5'-phosphate synthase subunit PdxT OS=Methanococcus maripaludis (strain C6 / ATCC BAA-1332) GN=pdxT PE=3 SV=1 10 235 5.0E-30
sp|Q8EN04|PDXT_OCEIH Pyridoxal 5'-phosphate synthase subunit PdxT OS=Oceanobacillus iheyensis (strain DSM 14371 / JCM 11309 / KCTC 3954 / HTE831) GN=pdxT PE=3 SV=2 11 230 7.0E-30
sp|A4YI12|PDXT_METS5 Pyridoxal 5'-phosphate synthase subunit PdxT OS=Metallosphaera sedula (strain ATCC 51363 / DSM 5348) GN=pdxT PE=3 SV=1 11 231 9.0E-30
sp|Q24PK8|PDXT_DESHY Pyridoxal 5'-phosphate synthase subunit PdxT OS=Desulfitobacterium hafniense (strain Y51) GN=pdxT PE=3 SV=1 11 233 2.0E-29
sp|A0PSY6|PDXT_MYCUA Pyridoxal 5'-phosphate synthase subunit PdxT OS=Mycobacterium ulcerans (strain Agy99) GN=pdxT PE=3 SV=1 11 231 2.0E-29
sp|B2HN48|PDXT_MYCMM Pyridoxal 5'-phosphate synthase subunit PdxT OS=Mycobacterium marinum (strain ATCC BAA-535 / M) GN=pdxT PE=3 SV=1 11 231 2.0E-29
sp|B1KYX4|PDXT_CLOBM Pyridoxal 5'-phosphate synthase subunit PdxT OS=Clostridium botulinum (strain Loch Maree / Type A3) GN=pdxT PE=3 SV=1 8 234 2.0E-29
sp|A4G0R6|PDXT_METM5 Pyridoxal 5'-phosphate synthase subunit PdxT OS=Methanococcus maripaludis (strain C5 / ATCC BAA-1333) GN=pdxT PE=3 SV=1 10 235 2.0E-29
sp|A6VHR9|PDXT_METM7 Pyridoxal 5'-phosphate synthase subunit PdxT OS=Methanococcus maripaludis (strain C7 / ATCC BAA-1331) GN=pdxT PE=3 SV=1 10 235 3.0E-29
sp|Q97LG6|PDXT_CLOAB Pyridoxal 5'-phosphate synthase subunit PdxT OS=Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / LMG 5710 / VKM B-1787) GN=pdxT PE=3 SV=1 11 231 3.0E-29
sp|C1CQQ1|PDXT_STRZT Pyridoxal 5'-phosphate synthase subunit PdxT OS=Streptococcus pneumoniae (strain Taiwan19F-14) GN=pdxT PE=3 SV=1 11 231 5.0E-29
sp|C1CLG6|PDXT_STRZP Pyridoxal 5'-phosphate synthase subunit PdxT OS=Streptococcus pneumoniae (strain P1031) GN=pdxT PE=3 SV=1 11 231 5.0E-29
sp|C1CF49|PDXT_STRZJ Pyridoxal 5'-phosphate synthase subunit PdxT OS=Streptococcus pneumoniae (strain JJA) GN=pdxT PE=3 SV=1 11 231 5.0E-29
sp|Q97PX3|PDXT_STRPN Pyridoxal 5'-phosphate synthase subunit PdxT OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) GN=pdxT PE=3 SV=1 11 231 5.0E-29
sp|B8ZL13|PDXT_STRPJ Pyridoxal 5'-phosphate synthase subunit PdxT OS=Streptococcus pneumoniae (strain ATCC 700669 / Spain 23F-1) GN=pdxT PE=3 SV=1 11 231 5.0E-29
sp|B1ICP8|PDXT_STRPI Pyridoxal 5'-phosphate synthase subunit PdxT OS=Streptococcus pneumoniae (strain Hungary19A-6) GN=pdxT PE=3 SV=1 11 231 5.0E-29
sp|C1C862|PDXT_STRP7 Pyridoxal 5'-phosphate synthase subunit PdxT OS=Streptococcus pneumoniae (strain 70585) GN=pdxT PE=3 SV=1 11 231 5.0E-29
sp|B1YGC2|PDXT_EXIS2 Pyridoxal 5'-phosphate synthase subunit PdxT OS=Exiguobacterium sibiricum (strain DSM 17290 / JCM 13490 / 255-15) GN=pdxT PE=3 SV=1 9 233 5.0E-29
sp|A3CRE5|PDXT_METMJ Pyridoxal 5'-phosphate synthase subunit PdxT OS=Methanoculleus marisnigri (strain ATCC 35101 / DSM 1498 / JR1) GN=pdxT PE=3 SV=1 9 231 6.0E-29
sp|Q8DP72|PDXT_STRR6 Pyridoxal 5'-phosphate synthase subunit PdxT OS=Streptococcus pneumoniae (strain ATCC BAA-255 / R6) GN=pdxT PE=3 SV=1 11 231 9.0E-29
sp|Q04JN6|PDXT_STRP2 Pyridoxal 5'-phosphate synthase subunit PdxT OS=Streptococcus pneumoniae serotype 2 (strain D39 / NCTC 7466) GN=pdxT PE=3 SV=1 11 231 9.0E-29
sp|A0B7N4|PDXT_METTP Pyridoxal 5'-phosphate synthase subunit PdxT OS=Methanosaeta thermophila (strain DSM 6194 / JCM 14653 / NBRC 101360 / PT) GN=pdxT PE=3 SV=1 11 231 1.0E-28
sp|A5UF87|PDXT_HAEIG Pyridoxal 5'-phosphate synthase subunit PdxT OS=Haemophilus influenzae (strain PittGG) GN=pdxT PE=3 SV=1 11 230 2.0E-28
sp|B9LSC8|PDXT_HALLT Pyridoxal 5'-phosphate synthase subunit PdxT OS=Halorubrum lacusprofundi (strain ATCC 49239 / DSM 5036 / JCM 8891 / ACAM 34) GN=pdxT PE=3 SV=1 41 226 2.0E-28
sp|P45294|PDXT_HAEIN Pyridoxal 5'-phosphate synthase subunit PdxT OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=pdxT PE=3 SV=2 11 230 2.0E-28
sp|A5UBN1|PDXT_HAEIE Pyridoxal 5'-phosphate synthase subunit PdxT OS=Haemophilus influenzae (strain PittEE) GN=pdxT PE=3 SV=1 11 230 2.0E-28
sp|Q4QJU4|PDXT_HAEI8 Pyridoxal 5'-phosphate synthase subunit PdxT OS=Haemophilus influenzae (strain 86-028NP) GN=pdxT PE=3 SV=1 11 230 2.0E-28
sp|Q971B2|PDXT_SULTO Pyridoxal 5'-phosphate synthase subunit PdxT OS=Sulfolobus tokodaii (strain DSM 16993 / JCM 10545 / NBRC 100140 / 7) GN=pdxT PE=3 SV=1 11 231 3.0E-28
sp|B5E5W0|PDXT_STRP4 Pyridoxal 5'-phosphate synthase subunit PdxT OS=Streptococcus pneumoniae serotype 19F (strain G54) GN=pdxT PE=3 SV=1 11 231 3.0E-28
sp|A4IZB4|PDXT_FRATW Pyridoxal 5'-phosphate synthase subunit PdxT OS=Francisella tularensis subsp. tularensis (strain WY96-3418) GN=pdxT PE=3 SV=1 11 230 9.0E-28
sp|Q5NHE5|PDXT_FRATT Pyridoxal 5'-phosphate synthase subunit PdxT OS=Francisella tularensis subsp. tularensis (strain SCHU S4 / Schu 4) GN=pdxT PE=3 SV=2 11 230 9.0E-28
sp|B2SDL4|PDXT_FRATM Pyridoxal 5'-phosphate synthase subunit PdxT OS=Francisella tularensis subsp. mediasiatica (strain FSC147) GN=pdxT PE=3 SV=1 11 230 9.0E-28
sp|Q14IU7|PDXT_FRAT1 Pyridoxal 5'-phosphate synthase subunit PdxT OS=Francisella tularensis subsp. tularensis (strain FSC 198) GN=pdxT PE=3 SV=2 11 230 9.0E-28
sp|A6UQT7|PDXT_METVS Pyridoxal 5'-phosphate synthase subunit PdxT OS=Methanococcus vannielii (strain SB / ATCC 35089 / DSM 1224) GN=pdxT PE=3 SV=1 10 235 1.0E-27
sp|A0Q5I2|PDXT_FRATN Pyridoxal 5'-phosphate synthase subunit PdxT OS=Francisella tularensis subsp. novicida (strain U112) GN=pdxT PE=3 SV=1 11 230 2.0E-27
sp|Q0BKT3|PDXT_FRATO Pyridoxal 5'-phosphate synthase subunit PdxT OS=Francisella tularensis subsp. holarctica (strain OSU18) GN=pdxT PE=3 SV=2 11 230 2.0E-27
sp|Q2A261|PDXT_FRATH Pyridoxal 5'-phosphate synthase subunit PdxT OS=Francisella tularensis subsp. holarctica (strain LVS) GN=pdxT PE=3 SV=1 11 230 2.0E-27
sp|A7NDQ2|PDXT_FRATF Pyridoxal 5'-phosphate synthase subunit PdxT OS=Francisella tularensis subsp. holarctica (strain FTNF002-00 / FTA) GN=pdxT PE=3 SV=1 11 230 2.0E-27
sp|A1A3A4|PDXT_BIFAA Pyridoxal 5'-phosphate synthase subunit PdxT OS=Bifidobacterium adolescentis (strain ATCC 15703 / DSM 20083 / NCTC 11814 / E194a) GN=pdxT PE=3 SV=2 10 231 2.0E-27
sp|Q02CB5|PDXT_SOLUE Pyridoxal 5'-phosphate synthase subunit PdxT OS=Solibacter usitatus (strain Ellin6076) GN=pdxT PE=3 SV=1 11 233 3.0E-27
sp|A6UWZ3|PDXT_META3 Pyridoxal 5'-phosphate synthase subunit PdxT OS=Methanococcus aeolicus (strain Nankai-3 / ATCC BAA-1280) GN=pdxT PE=3 SV=1 11 234 3.0E-27
sp|B8E120|PDXT_DICTD Pyridoxal 5'-phosphate synthase subunit PdxT OS=Dictyoglomus turgidum (strain Z-1310 / DSM 6724) GN=pdxT PE=3 SV=1 11 231 5.0E-27
sp|B5YF84|PDXT_DICT6 Pyridoxal 5'-phosphate synthase subunit PdxT OS=Dictyoglomus thermophilum (strain ATCC 35947 / DSM 3960 / H-6-12) GN=pdxT PE=3 SV=1 11 231 2.0E-26
sp|Q6L1R3|PDXT_PICTO Pyridoxal 5'-phosphate synthase subunit PdxT OS=Picrophilus torridus (strain ATCC 700027 / DSM 9790 / JCM 10055 / NBRC 100828) GN=pdxT PE=3 SV=1 11 234 1.0E-25
sp|B9MKY8|PDXT_CALBD Pyridoxal 5'-phosphate synthase subunit PdxT OS=Caldicellulosiruptor bescii (strain ATCC BAA-1888 / DSM 6725 / Z-1320) GN=pdxT PE=3 SV=1 11 234 1.0E-25
sp|A4XIB6|PDXT_CALS8 Pyridoxal 5'-phosphate synthase subunit PdxT OS=Caldicellulosiruptor saccharolyticus (strain ATCC 43494 / DSM 8903 / Tp8T 6331) GN=pdxT PE=3 SV=1 11 234 2.0E-25
sp|A8MAY1|PDXT_CALMQ Pyridoxal 5'-phosphate synthase subunit PdxT OS=Caldivirga maquilingensis (strain ATCC 700844 / DSM 13496 / JCM 10307 / IC-167) GN=pdxT PE=3 SV=1 11 234 4.0E-25
sp|A1RU67|PDXT_PYRIL Pyridoxal 5'-phosphate synthase subunit PdxT OS=Pyrobaculum islandicum (strain DSM 4184 / JCM 9189 / GEO3) GN=pdxT PE=3 SV=1 12 231 5.0E-25
sp|B1YB90|PDXT_PYRNV Pyridoxal 5'-phosphate synthase subunit PdxT OS=Pyrobaculum neutrophilum (strain DSM 2338 / JCM 9278 / V24Sta) GN=pdxT PE=3 SV=1 12 231 3.0E-24
sp|Q73WF2|PDXT_MYCPA Pyridoxal 5'-phosphate synthase subunit PdxT OS=Mycobacterium paratuberculosis (strain ATCC BAA-968 / K-10) GN=pdxT PE=3 SV=1 11 183 3.0E-24
sp|B1L4Z3|PDXT_KORCO Pyridoxal 5'-phosphate synthase subunit PdxT OS=Korarchaeum cryptofilum (strain OPF8) GN=pdxT PE=3 SV=1 11 234 8.0E-24
sp|B8GE19|PDXT_METPE Pyridoxal 5'-phosphate synthase subunit PdxT OS=Methanosphaerula palustris (strain ATCC BAA-1556 / DSM 19958 / E1-9c) GN=pdxT PE=3 SV=1 11 230 2.0E-23
sp|Q8ZUE9|PDXT_PYRAE Pyridoxal 5'-phosphate synthase subunit PdxT OS=Pyrobaculum aerophilum (strain ATCC 51768 / IM2 / DSM 7523 / JCM 9630 / NBRC 100827) GN=pdxT PE=3 SV=1 11 234 2.0E-20
sp|Q2LXR3|PDXT_SYNAS Pyridoxal 5'-phosphate synthase subunit PdxT OS=Syntrophus aciditrophicus (strain SB) GN=pdxT PE=3 SV=1 4 220 1.0E-14
sp|Q9ZGM1|HIS5_LEPBO Imidazole glycerol phosphate synthase subunit HisH OS=Leptospira borgpetersenii GN=hisH PE=3 SV=1 45 218 3.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0042823 pyridoxal phosphate biosynthetic process Yes
GO:0008236 serine-type peptidase activity Yes
GO:0003824 catalytic activity Yes
GO:0004359 glutaminase activity Yes
GO:0006508 proteolysis Yes
GO:0042819 vitamin B6 biosynthetic process Yes
GO:1901576 organic substance biosynthetic process No
GO:1901360 organic cyclic compound metabolic process No
GO:0019637 organophosphate metabolic process No
GO:0006807 nitrogen compound metabolic process No
GO:0043170 macromolecule metabolic process No
GO:0018130 heterocycle biosynthetic process No
GO:0016811 hydrolase activity, acting on carbon-nitrogen (but not peptide) bonds, in linear amides No
GO:0006081 cellular aldehyde metabolic process No
GO:0006796 phosphate-containing compound metabolic process No
GO:0042816 vitamin B6 metabolic process No
GO:0140096 catalytic activity, acting on a protein No
GO:0008233 peptidase activity No
GO:0072525 pyridine-containing compound biosynthetic process No
GO:0006725 cellular aromatic compound metabolic process No
GO:0006766 vitamin metabolic process No
GO:0034641 cellular nitrogen compound metabolic process No
GO:0006793 phosphorus metabolic process No
GO:0042364 water-soluble vitamin biosynthetic process No
GO:0003674 molecular_function No
GO:0016787 hydrolase activity No
GO:0008150 biological_process No
GO:0090407 organophosphate biosynthetic process No
GO:0009987 cellular process No
GO:1901617 organic hydroxy compound biosynthetic process No
GO:0046184 aldehyde biosynthetic process No
GO:0006767 water-soluble vitamin metabolic process No
GO:0009110 vitamin biosynthetic process No
GO:0046483 heterocycle metabolic process No
GO:1901615 organic hydroxy compound metabolic process No
GO:1901564 organonitrogen compound metabolic process No
GO:0019538 protein metabolic process No
GO:0009058 biosynthetic process No
GO:0044238 primary metabolic process No
GO:0042822 pyridoxal phosphate metabolic process No
GO:0017171 serine hydrolase activity No
GO:0019438 aromatic compound biosynthetic process No
GO:1901362 organic cyclic compound biosynthetic process No
GO:0008152 metabolic process No
GO:1901566 organonitrogen compound biosynthetic process No
GO:0044237 cellular metabolic process No
GO:0044281 small molecule metabolic process No
GO:0071704 organic substance metabolic process No
GO:0044283 small molecule biosynthetic process No
GO:0044249 cellular biosynthetic process No
GO:0016810 hydrolase activity, acting on carbon-nitrogen (but not peptide) bonds No
GO:0044271 cellular nitrogen compound biosynthetic process No
GO:0072524 pyridine-containing compound metabolic process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 22 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|3513
MTVQSRRLIVVGVLALQGGFAEHVHLVRRAAQLLQLETRLKAIEVRTADELASCDGLIIPGGESTSMAFVAEESG
LLEPLRDFVKRQKKPVWGTCAGLILLSEQANATKQGGQQLIGGLGVRVHRNHFGRQIESFQTPLDLAFLSPSPKE
PPEPFAGIFIRAPVVEQVLHPDVVVLAKVPGRVHKARPGLSQASTESDSADIVAVRQGNVLGTSFHPELTTDARI
HVWWLQEMLHL*
Coding >OphauB2|3513
ATGACGGTCCAGTCGCGCCGCCTCATTGTTGTGGGAGTCTTGGCCCTCCAGGGTGGCTTTGCTGAGCATGTCCAT
CTGGTACGCCGGGCCGCTCAACTCCTGCAGCTCGAGACCAGACTCAAGGCCATCGAGGTGCGCACCGCAGACGAG
CTGGCTAGCTGCGATGGGCTCATCATTCCCGGTGGCGAGAGCACCAGCATGGCCTTTGTGGCGGAAGAGTCTGGG
CTGCTGGAGCCGCTGCGGGACTTTGTAAAACGGCAAAAGAAGCCCGTCTGGGGCACCTGTGCCGGTCTTATTCTC
TTGTCGGAGCAGGCCAACGCCACCAAGCAGGGCGGCCAGCAACTCATTGGCGGCCTGGGCGTGCGAGTCCACCGC
AACCACTTTGGCCGTCAGATTGAGAGCTTCCAGACGCCACTGGACCTAGCCTTTCTTTCCCCGTCGCCCAAGGAG
CCGCCGGAACCGTTTGCCGGCATCTTTATTCGCGCGCCCGTTGTCGAGCAAGTCTTGCACCCTGACGTGGTTGTC
TTGGCAAAGGTGCCCGGCCGTGTGCACAAGGCGCGCCCAGGCCTTTCACAGGCTAGTACTGAGAGTGATTCGGCC
GACATTGTTGCTGTGCGGCAGGGAAACGTGCTTGGCACCAGCTTTCATCCTGAACTGACTACCGACGCGCGCATT
CACGTTTGGTGGCTGCAAGAAATGCTACATCTTTGA
Transcript >OphauB2|3513
ATGACGGTCCAGTCGCGCCGCCTCATTGTTGTGGGAGTCTTGGCCCTCCAGGGTGGCTTTGCTGAGCATGTCCAT
CTGGTACGCCGGGCCGCTCAACTCCTGCAGCTCGAGACCAGACTCAAGGCCATCGAGGTGCGCACCGCAGACGAG
CTGGCTAGCTGCGATGGGCTCATCATTCCCGGTGGCGAGAGCACCAGCATGGCCTTTGTGGCGGAAGAGTCTGGG
CTGCTGGAGCCGCTGCGGGACTTTGTAAAACGGCAAAAGAAGCCCGTCTGGGGCACCTGTGCCGGTCTTATTCTC
TTGTCGGAGCAGGCCAACGCCACCAAGCAGGGCGGCCAGCAACTCATTGGCGGCCTGGGCGTGCGAGTCCACCGC
AACCACTTTGGCCGTCAGATTGAGAGCTTCCAGACGCCACTGGACCTAGCCTTTCTTTCCCCGTCGCCCAAGGAG
CCGCCGGAACCGTTTGCCGGCATCTTTATTCGCGCGCCCGTTGTCGAGCAAGTCTTGCACCCTGACGTGGTTGTC
TTGGCAAAGGTGCCCGGCCGTGTGCACAAGGCGCGCCCAGGCCTTTCACAGGCTAGTACTGAGAGTGATTCGGCC
GACATTGTTGCTGTGCGGCAGGGAAACGTGCTTGGCACCAGCTTTCATCCTGAACTGACTACCGACGCGCGCATT
CACGTTTGGTGGCTGCAAGAAATGCTACATCTTTGA
Gene >OphauB2|3513
ATGACGGTCCAGTCGCGCCGCCTCATTGTTGTGGGAGTCTTGGCCCTCCAGGGTGGCTTTGCTGAGCATGTCCAT
CTGGTACGCCGGGCCGCTCAACTCCTGCAGCTCGAGACCAGACTCAAGGCCATCGAGGTGCGCACCGCAGACGAG
CTGGCTAGCTGCGATGGGCTCATCATTCCCGGTGGCGAGAGCACCAGCATGGCCTTTGTGGCGGAAGAGTCTGGG
CTGCTGGAGCCGCTGCGGGACTTTGTAAAGTAAGTTGCTTGTTTCCCCTGCGAGATGCGACGAGTCAAGTTTTGT
TCTTCTTGTTTACCAAGGCATTGGCTGCAGACGGCAAAAGAAGCCCGTCTGGGGCACCTGTGCCGGTCTTATTCT
CTTGTCGGAGCAGGCCAACGCCACCAAGCAGGGCGGCCAGCAACTCATTGGCGGCCTGGGCGTGCGAGTCCACCG
CAACCACTTTGGCCGTCAGATTGAGAGCTTCCAGACGCCACTGGACCTAGCCTTTCTTTCCCCGTCGCCCAAGGA
GCCGCCGGAACCGTTTGCCGGCATCTTTATTCGCGCGCCCGTTGTCGAGCAAGTCTTGCACCCTGACGTGGTTGT
CTTGGCAAAGGTGCCCGGCCGTGTGCACAAGGCGCGCCCAGGCCTTTCACAGGCTAGTACTGAGAGTGATTCGGC
CGACATTGTTGCTGTGCGGCAGGGAAACGTGCTTGGCACCAGCTTTCATCCTGAACTGACTACCGACGCGCGCAT
TCACGTTTGGTGGCTGCAAGAAATGCTACATCTTTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail