Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|3513
Gene name
LocationContig_222:843..1630
Strand+
Gene length (bp)787
Transcript length (bp)711
Coding sequence length (bp)711
Protein length (aa) 237

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01174 SNO SNO glutamine amidotransferase family 1.1E-53 13 233
PF07685 GATase_3 CobB/CobQ-like glutamine amidotransferase domain 4.2E-09 33 121
PF03575 Peptidase_S51 Peptidase family S51 2.3E-05 48 111

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q8LAD0|PDX2_ARATH Probable pyridoxal 5'-phosphate synthase subunit PDX2 OS=Arabidopsis thaliana GN=PDX2 PE=1 SV=1 9 231 4.0E-57
sp|Q54J48|PDX2_DICDI Probable pyridoxal 5'-phosphate synthase subunit pdx2 OS=Dictyostelium discoideum GN=pdx2 PE=1 SV=1 9 235 4.0E-47
sp|Q03144|SNO1_YEAST Pyridoxal 5'-phosphate synthase subunit SNO1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SNO1 PE=1 SV=1 2 234 1.0E-45
sp|P53823|SNO2_YEAST Probable pyridoxal 5'-phosphate synthase subunit SNO2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SNO2 PE=3 SV=1 9 234 5.0E-45
sp|P43544|SNO3_YEAST Probable pyridoxal 5'-phosphate synthase subunit SNO3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SNO3 PE=1 SV=1 9 234 7.0E-45
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q8LAD0|PDX2_ARATH Probable pyridoxal 5'-phosphate synthase subunit PDX2 OS=Arabidopsis thaliana GN=PDX2 PE=1 SV=1 9 231 4.0E-57
sp|Q54J48|PDX2_DICDI Probable pyridoxal 5'-phosphate synthase subunit pdx2 OS=Dictyostelium discoideum GN=pdx2 PE=1 SV=1 9 235 4.0E-47
sp|Q03144|SNO1_YEAST Pyridoxal 5'-phosphate synthase subunit SNO1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SNO1 PE=1 SV=1 2 234 1.0E-45
sp|P53823|SNO2_YEAST Probable pyridoxal 5'-phosphate synthase subunit SNO2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SNO2 PE=3 SV=1 9 234 5.0E-45
sp|P43544|SNO3_YEAST Probable pyridoxal 5'-phosphate synthase subunit SNO3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SNO3 PE=1 SV=1 9 234 7.0E-45
sp|B6YVQ8|PDXT_THEON Pyridoxal 5'-phosphate synthase subunit PdxT OS=Thermococcus onnurineus (strain NA1) GN=pdxT PE=3 SV=1 8 234 3.0E-43
sp|A5UK48|PDXT_METS3 Pyridoxal 5'-phosphate synthase subunit PdxT OS=Methanobrevibacter smithii (strain PS / ATCC 35061 / DSM 861) GN=pdxT PE=3 SV=1 8 235 3.0E-43
sp|Q9UTE4|YFM8_SCHPO Uncharacterized glutaminase C222.08c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC222.08c PE=3 SV=1 11 232 2.0E-42
sp|Q4JVD5|PDXT_CORJK Pyridoxal 5'-phosphate synthase subunit PdxT OS=Corynebacterium jeikeium (strain K411) GN=pdxT PE=3 SV=1 9 231 2.0E-42
sp|Q5WKW1|PDXT_BACSK Pyridoxal 5'-phosphate synthase subunit PdxT OS=Bacillus clausii (strain KSM-K16) GN=pdxT PE=3 SV=1 11 231 3.0E-42
sp|Q8TH23|PDXT_PYRFU Pyridoxal 5'-phosphate synthase subunit PdxT OS=Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1) GN=pdxT PE=3 SV=1 8 234 3.0E-42
sp|Q1AWE7|PDXT_RUBXD Pyridoxal 5'-phosphate synthase subunit PdxT OS=Rubrobacter xylanophilus (strain DSM 9941 / NBRC 16129) GN=pdxT PE=3 SV=1 11 233 2.0E-41
sp|Q929R8|PDXT_LISIN Pyridoxal 5'-phosphate synthase subunit PdxT OS=Listeria innocua serovar 6a (strain CLIP 11262) GN=pdxT PE=3 SV=1 11 234 5.0E-41
sp|Q3Z8V9|PDXT_DEHM1 Pyridoxal 5'-phosphate synthase subunit PdxT OS=Dehalococcoides mccartyi (strain ATCC BAA-2266 / KCTC 15142 / 195) GN=pdxT PE=3 SV=1 11 231 7.0E-41
sp|O59079|PDXT_PYRHO Pyridoxal 5'-phosphate synthase subunit PdxT OS=Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3) GN=pdxT PE=3 SV=1 11 234 4.0E-40
sp|A0LUK9|PDXT_ACIC1 Pyridoxal 5'-phosphate synthase subunit PdxT OS=Acidothermus cellulolyticus (strain ATCC 43068 / 11B) GN=pdxT PE=3 SV=1 1 230 4.0E-40
sp|Q81ZV5|PDXT_STRAW Pyridoxal 5'-phosphate synthase subunit PdxT OS=Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680) GN=pdxT PE=3 SV=1 10 231 1.0E-39
sp|Q6AFB8|PDXT_LEIXX Pyridoxal 5'-phosphate synthase subunit PdxT OS=Leifsonia xyli subsp. xyli (strain CTCB07) GN=pdxT PE=3 SV=1 11 230 2.0E-39
sp|B1W3G0|PDXT_STRGG Pyridoxal 5'-phosphate synthase subunit PdxT OS=Streptomyces griseus subsp. griseus (strain JCM 4626 / NBRC 13350) GN=pdxT PE=3 SV=1 10 231 2.0E-39
sp|Q4PJX5|PDX2_PLABE Pyridoxal 5'-phosphate synthase subunit Pdx2 OS=Plasmodium berghei GN=pdx2 PE=1 SV=1 9 233 4.0E-39
sp|Q8TQH7|PDXT_METAC Pyridoxal 5'-phosphate synthase subunit PdxT OS=Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A) GN=pdxT PE=3 SV=1 11 234 5.0E-39
sp|Q8PUA4|PDXT_METMA Pyridoxal 5'-phosphate synthase subunit PdxT OS=Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88) GN=pdxT PE=3 SV=2 11 235 7.0E-39
sp|C5A4H0|PDXT_THEGJ Pyridoxal 5'-phosphate synthase subunit PdxT OS=Thermococcus gammatolerans (strain DSM 15229 / JCM 11827 / EJ3) GN=pdxT PE=3 SV=1 8 234 1.0E-38
sp|Q2RMI9|PDXT_MOOTA Pyridoxal 5'-phosphate synthase subunit PdxT OS=Moorella thermoacetica (strain ATCC 39073) GN=pdxT PE=3 SV=1 11 231 1.0E-38
sp|Q47N39|PDXT_THEFY Pyridoxal 5'-phosphate synthase subunit PdxT OS=Thermobifida fusca (strain YX) GN=pdxT PE=3 SV=1 11 231 1.0E-38
sp|Q9V0J6|PDXT_PYRAB Pyridoxal 5'-phosphate synthase subunit PdxT OS=Pyrococcus abyssi (strain GE5 / Orsay) GN=pdxT PE=3 SV=1 11 234 1.0E-38
sp|B8DH16|PDXT_LISMH Pyridoxal 5'-phosphate synthase subunit PdxT OS=Listeria monocytogenes serotype 4a (strain HCC23) GN=pdxT PE=3 SV=1 11 234 1.0E-38
sp|A1T876|PDXT_MYCVP Pyridoxal 5'-phosphate synthase subunit PdxT OS=Mycobacterium vanbaalenii (strain DSM 7251 / PYR-1) GN=pdxT PE=3 SV=1 11 233 2.0E-38
sp|Q8Y5G1|PDXT_LISMO Pyridoxal 5'-phosphate synthase subunit PdxT OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=pdxT PE=3 SV=1 11 234 3.0E-38
sp|Q3A8Q0|PDXT_CARHZ Pyridoxal 5'-phosphate synthase subunit PdxT OS=Carboxydothermus hydrogenoformans (strain ATCC BAA-161 / DSM 6008 / Z-2901) GN=pdxT PE=3 SV=1 11 233 4.0E-38
sp|A5FRL6|PDXT_DEHMB Pyridoxal 5'-phosphate synthase subunit PdxT OS=Dehalococcoides mccartyi (strain ATCC BAA-2100 / JCM 16839 / KCTC 5957 / BAV1) GN=pdxT PE=3 SV=1 11 231 7.0E-38
sp|A0JXB5|PDXT_ARTS2 Pyridoxal 5'-phosphate synthase subunit PdxT OS=Arthrobacter sp. (strain FB24) GN=pdxT PE=3 SV=1 11 231 7.0E-38
sp|Q5YTE0|PDXT_NOCFA Pyridoxal 5'-phosphate synthase subunit PdxT OS=Nocardia farcinica (strain IFM 10152) GN=pdxT PE=3 SV=2 11 231 8.0E-38
sp|Q0W8A8|PDXT_METAR Pyridoxal 5'-phosphate synthase subunit PdxT OS=Methanocella arvoryzae (strain DSM 22066 / NBRC 105507 / MRE50) GN=pdxT PE=3 SV=1 11 234 1.0E-37
sp|Q8L1A7|PDXT_BACCI Pyridoxal 5'-phosphate synthase subunit PdxT OS=Bacillus circulans GN=pdxT PE=1 SV=1 11 231 1.0E-37
sp|A0AKK9|PDXT_LISW6 Pyridoxal 5'-phosphate synthase subunit PdxT OS=Listeria welshimeri serovar 6b (strain ATCC 35897 / DSM 20650 / SLCC5334) GN=pdxT PE=3 SV=1 11 234 1.0E-37
sp|A7Z0D4|PDXT_BACMF Pyridoxal 5'-phosphate synthase subunit PdxT OS=Bacillus methylotrophicus (strain DSM 23117 / BGSC 10A6 / FZB42) GN=pdxT PE=3 SV=1 8 231 1.0E-37
sp|C1KX54|PDXT_LISMC Pyridoxal 5'-phosphate synthase subunit PdxT OS=Listeria monocytogenes serotype 4b (strain CLIP80459) GN=pdxT PE=3 SV=1 11 234 1.0E-37
sp|Q71XR2|PDXT_LISMF Pyridoxal 5'-phosphate synthase subunit PdxT OS=Listeria monocytogenes serotype 4b (strain F2365) GN=pdxT PE=3 SV=1 11 234 2.0E-37
sp|C1B4C5|PDXT_RHOOB Pyridoxal 5'-phosphate synthase subunit PdxT OS=Rhodococcus opacus (strain B4) GN=pdxT PE=3 SV=1 10 231 2.0E-37
sp|B8H9E0|PDXT_ARTCA Pyridoxal 5'-phosphate synthase subunit PdxT OS=Arthrobacter chlorophenolicus (strain ATCC 700700 / DSM 12829 / JCM 12360 / NCIMB 13794 / A6) GN=pdxT PE=3 SV=1 11 231 2.0E-37
sp|A1SJA2|PDXT_NOCSJ Pyridoxal 5'-phosphate synthase subunit PdxT OS=Nocardioides sp. (strain BAA-499 / JS614) GN=pdxT PE=3 SV=1 11 231 3.0E-37
sp|A1R728|PDXT_ARTAT Pyridoxal 5'-phosphate synthase subunit PdxT OS=Arthrobacter aurescens (strain TC1) GN=pdxT PE=3 SV=2 11 231 3.0E-37
sp|C5D338|PDXT_GEOSW Pyridoxal 5'-phosphate synthase subunit PdxT OS=Geobacillus sp. (strain WCH70) GN=pdxT PE=3 SV=1 8 231 3.0E-37
sp|O26292|PDXT_METTH Pyridoxal 5'-phosphate synthase subunit PdxT OS=Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H) GN=pdxT PE=3 SV=1 8 235 3.0E-37
sp|Q9L287|PDXT_STRCO Pyridoxal 5'-phosphate synthase subunit PdxT OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=pdxT PE=3 SV=1 10 226 3.0E-37
sp|A7GJS9|PDXT_BACCN Pyridoxal 5'-phosphate synthase subunit PdxT OS=Bacillus cytotoxicus (strain DSM 22905 / CIP 110041 / 391-98 / NVH 391-98) GN=pdxT PE=3 SV=1 8 231 3.0E-37
sp|Q83HM6|PDXT_TROW8 Pyridoxal 5'-phosphate synthase subunit PdxT OS=Tropheryma whipplei (strain TW08/27) GN=pdxT PE=3 SV=1 9 231 3.0E-37
sp|Q0S1D2|PDXT_RHOJR Pyridoxal 5'-phosphate synthase subunit PdxT OS=Rhodococcus jostii (strain RHA1) GN=pdxT PE=3 SV=1 10 231 4.0E-37
sp|Q83GK3|PDXT_TROWT Pyridoxal 5'-phosphate synthase subunit PdxT OS=Tropheryma whipplei (strain Twist) GN=pdxT PE=3 SV=1 9 231 4.0E-37
sp|Q5JFR2|PDXT_THEKO Pyridoxal 5'-phosphate synthase subunit PdxT OS=Thermococcus kodakarensis (strain ATCC BAA-918 / JCM 12380 / KOD1) GN=pdxT PE=3 SV=1 8 232 4.0E-37
sp|Q7VL87|PDXT_HAEDU Pyridoxal 5'-phosphate synthase subunit PdxT OS=Haemophilus ducreyi (strain 35000HP / ATCC 700724) GN=pdxT PE=3 SV=1 11 233 5.0E-37
sp|A8A8T7|PDXT_IGNH4 Pyridoxal 5'-phosphate synthase subunit PdxT OS=Ignicoccus hospitalis (strain KIN4/I / DSM 18386 / JCM 14125) GN=pdxT PE=3 SV=2 11 232 5.0E-37
sp|Q12YR6|PDXT_METBU Pyridoxal 5'-phosphate synthase subunit PdxT OS=Methanococcoides burtonii (strain DSM 6242 / NBRC 107633 / OCM 468 / ACE-M) GN=pdxT PE=3 SV=1 11 235 6.0E-37
sp|Q465J4|PDXT_METBF Pyridoxal 5'-phosphate synthase subunit PdxT OS=Methanosarcina barkeri (strain Fusaro / DSM 804) GN=pdxT PE=3 SV=1 11 234 9.0E-37
sp|A8KZF0|PDXT_FRASN Pyridoxal 5'-phosphate synthase subunit PdxT OS=Frankia sp. (strain EAN1pec) GN=pdxT PE=3 SV=1 11 231 1.0E-36
sp|Q3ZX06|PDXT_DEHMC Pyridoxal 5'-phosphate synthase subunit PdxT OS=Dehalococcoides mccartyi (strain CBDB1) GN=pdxT PE=3 SV=1 11 231 1.0E-36
sp|B0BUD1|PDXT_ACTPJ Pyridoxal 5'-phosphate synthase subunit PdxT OS=Actinobacillus pleuropneumoniae serotype 3 (strain JL03) GN=pdxT PE=3 SV=1 11 233 1.0E-36
sp|B3GXB7|PDXT_ACTP7 Pyridoxal 5'-phosphate synthase subunit PdxT OS=Actinobacillus pleuropneumoniae serotype 7 (strain AP76) GN=pdxT PE=3 SV=1 11 233 1.0E-36
sp|B8G664|PDXT_CHLAD Pyridoxal 5'-phosphate synthase subunit PdxT OS=Chloroflexus aggregans (strain MD-66 / DSM 9485) GN=pdxT PE=3 SV=1 9 231 3.0E-36
sp|Q04F27|PDXT_OENOB Pyridoxal 5'-phosphate synthase subunit PdxT OS=Oenococcus oeni (strain ATCC BAA-331 / PSU-1) GN=pdxT PE=3 SV=1 9 231 5.0E-36
sp|Q63HF7|PDXT_BACCZ Pyridoxal 5'-phosphate synthase subunit PdxT OS=Bacillus cereus (strain ZK / E33L) GN=pdxT PE=3 SV=1 8 231 6.0E-36
sp|A9VMA0|PDXT_BACWK Pyridoxal 5'-phosphate synthase subunit PdxT OS=Bacillus weihenstephanensis (strain KBAB4) GN=pdxT PE=3 SV=1 8 231 6.0E-36
sp|Q3IU60|PDXT_NATPD Pyridoxal 5'-phosphate synthase subunit PdxT OS=Natronomonas pharaonis (strain ATCC 35678 / DSM 2160) GN=pdxT PE=3 SV=1 8 226 8.0E-36
sp|B7GFL9|PDXT_ANOFW Pyridoxal 5'-phosphate synthase subunit PdxT OS=Anoxybacillus flavithermus (strain DSM 21510 / WK1) GN=pdxT PE=3 SV=1 8 231 9.0E-36
sp|Q6A947|PDXT_PROAC Pyridoxal 5'-phosphate synthase subunit PdxT OS=Propionibacterium acnes (strain KPA171202 / DSM 16379) GN=pdxT PE=3 SV=1 10 233 1.0E-35
sp|A3MZT9|PDXT_ACTP2 Pyridoxal 5'-phosphate synthase subunit PdxT OS=Actinobacillus pleuropneumoniae serotype 5b (strain L20) GN=pdxT PE=3 SV=1 11 233 1.0E-35
sp|A5CS10|PDXT_CLAM3 Pyridoxal 5'-phosphate synthase subunit PdxT OS=Clavibacter michiganensis subsp. michiganensis (strain NCPPB 382) GN=pdxT PE=3 SV=1 10 231 1.0E-35
sp|P37528|PDXT_BACSU Pyridoxal 5'-phosphate synthase subunit PdxT OS=Bacillus subtilis (strain 168) GN=pdxT PE=1 SV=1 8 231 2.0E-35
sp|B9IYH9|PDXT_BACCQ Pyridoxal 5'-phosphate synthase subunit PdxT OS=Bacillus cereus (strain Q1) GN=pdxT PE=3 SV=1 8 231 2.0E-35
sp|B7HPS7|PDXT_BACC7 Pyridoxal 5'-phosphate synthase subunit PdxT OS=Bacillus cereus (strain AH187) GN=pdxT PE=3 SV=1 8 231 2.0E-35
sp|Q73FJ4|PDXT_BACC1 Pyridoxal 5'-phosphate synthase subunit PdxT OS=Bacillus cereus (strain ATCC 10987 / NRS 248) GN=pdxT PE=3 SV=1 8 231 2.0E-35
sp|A0QWH0|PDXT_MYCS2 Pyridoxal 5'-phosphate synthase subunit PdxT OS=Mycobacterium smegmatis (strain ATCC 700084 / mc(2)155) GN=pdxT PE=1 SV=1 11 233 3.0E-35
sp|A9B890|PDXT_HERA2 Pyridoxal 5'-phosphate synthase subunit PdxT OS=Herpetosiphon aurantiacus (strain ATCC 23779 / DSM 785) GN=pdxT PE=3 SV=1 9 230 3.0E-35
sp|Q81JC5|PDXT_BACCR Pyridoxal 5'-phosphate synthase subunit PdxT OS=Bacillus cereus (strain ATCC 14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL B-3711) GN=pdxT PE=3 SV=1 8 231 3.0E-35
sp|Q9YFK4|PDXT_AERPE Pyridoxal 5'-phosphate synthase subunit PdxT OS=Aeropyrum pernix (strain ATCC 700893 / DSM 11879 / JCM 9820 / NBRC 100138 / K1) GN=pdxT PE=3 SV=2 11 231 3.0E-35
sp|B0REB6|PDXT_CLAMS Pyridoxal 5'-phosphate synthase subunit PdxT OS=Clavibacter michiganensis subsp. sepedonicus (strain ATCC 33113 / DSM 20744 / JCM 9667 / LMG 2889 / C-1) GN=pdxT PE=3 SV=1 10 231 3.0E-35
sp|B7HII4|PDXT_BACC4 Pyridoxal 5'-phosphate synthase subunit PdxT OS=Bacillus cereus (strain B4264) GN=pdxT PE=3 SV=1 8 231 4.0E-35
sp|Q9KGN5|PDXT_BACHD Pyridoxal 5'-phosphate synthase subunit PdxT OS=Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125) GN=pdxT PE=3 SV=1 8 231 4.0E-35
sp|B9LIK4|PDXT_CHLSY Pyridoxal 5'-phosphate synthase subunit PdxT OS=Chloroflexus aurantiacus (strain ATCC 29364 / DSM 637 / Y-400-fl) GN=pdxT PE=3 SV=1 9 231 5.0E-35
sp|A9WFU0|PDXT_CHLAA Pyridoxal 5'-phosphate synthase subunit PdxT OS=Chloroflexus aurantiacus (strain ATCC 29366 / DSM 635 / J-10-fl) GN=pdxT PE=3 SV=1 9 231 5.0E-35
sp|B7IS30|PDXT_BACC2 Pyridoxal 5'-phosphate synthase subunit PdxT OS=Bacillus cereus (strain G9842) GN=pdxT PE=3 SV=1 8 231 5.0E-35
sp|Q9CLJ5|PDXT_PASMU Pyridoxal 5'-phosphate synthase subunit PdxT OS=Pasteurella multocida (strain Pm70) GN=pdxT PE=3 SV=1 11 231 5.0E-35
sp|Q2NGI4|PDXT_METST Pyridoxal 5'-phosphate synthase subunit PdxT OS=Methanosphaera stadtmanae (strain ATCC 43021 / DSM 3091 / JCM 11832 / MCB-3) GN=pdxT PE=3 SV=1 8 233 7.0E-35
sp|O29741|PDXT_ARCFU Pyridoxal 5'-phosphate synthase subunit PdxT OS=Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126) GN=pdxT PE=3 SV=1 11 231 7.0E-35
sp|A7NQB7|PDXT_ROSCS Pyridoxal 5'-phosphate synthase subunit PdxT OS=Roseiflexus castenholzii (strain DSM 13941 / HLO8) GN=pdxT PE=3 SV=1 9 231 7.0E-35
sp|A9WSE8|PDXT_RENSM Pyridoxal 5'-phosphate synthase subunit PdxT OS=Renibacterium salmoninarum (strain ATCC 33209 / DSM 20767 / JCM 11484 / NBRC 15589 / NCIMB 2235) GN=pdxT PE=3 SV=1 7 233 1.0E-34
sp|Q9RUL8|PDXT_DEIRA Pyridoxal 5'-phosphate synthase subunit PdxT OS=Deinococcus radiodurans (strain ATCC 13939 / DSM 20539 / JCM 16871 / LMG 4051 / NBRC 15346 / NCIMB 9279 / R1 / VKM B-1422) GN=pdxT PE=3 SV=1 9 230 1.0E-34
sp|A8FAD6|PDXT_BACP2 Pyridoxal 5'-phosphate synthase subunit PdxT OS=Bacillus pumilus (strain SAFR-032) GN=pdxT PE=3 SV=1 8 231 1.0E-34
sp|A4IJ95|PDXT_GEOTN Pyridoxal 5'-phosphate synthase subunit PdxT OS=Geobacillus thermodenitrificans (strain NG80-2) GN=pdxT PE=3 SV=1 11 231 2.0E-34
sp|A5UY93|PDXT_ROSS1 Pyridoxal 5'-phosphate synthase subunit PdxT OS=Roseiflexus sp. (strain RS-1) GN=pdxT PE=3 SV=1 9 230 2.0E-34
sp|C5CG73|PDXT_KOSOT Pyridoxal 5'-phosphate synthase subunit PdxT OS=Kosmotoga olearia (strain TBF 19.5.1) GN=pdxT PE=3 SV=1 11 234 2.0E-34
sp|Q8IIK4|PDX2_PLAF7 Pyridoxal 5'-phosphate synthase subunit Pdx2 OS=Plasmodium falciparum (isolate 3D7) GN=pdx2 PE=1 SV=2 9 233 4.0E-34
sp|Q72KF8|PDXT_THET2 Pyridoxal 5'-phosphate synthase subunit PdxT OS=Thermus thermophilus (strain HB27 / ATCC BAA-163 / DSM 7039) GN=pdxT PE=3 SV=1 10 231 5.0E-34
sp|Q5HRN4|PDXT_STAEQ Pyridoxal 5'-phosphate synthase subunit PdxT OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=pdxT PE=3 SV=1 8 234 6.0E-34
sp|B1I158|PDXT_DESAP Pyridoxal 5'-phosphate synthase subunit PdxT OS=Desulforudis audaxviator (strain MP104C) GN=pdxT PE=3 SV=1 8 231 8.0E-34
sp|A5MZY0|PDXT_CLOK5 Pyridoxal 5'-phosphate synthase subunit PdxT OS=Clostridium kluyveri (strain ATCC 8527 / DSM 555 / NCIMB 10680) GN=pdxT PE=3 SV=1 11 231 9.0E-34
sp|B9E3V5|PDXT_CLOK1 Pyridoxal 5'-phosphate synthase subunit PdxT OS=Clostridium kluyveri (strain NBRC 12016) GN=pdxT PE=3 SV=1 11 231 9.0E-34
sp|Q1IZC9|PDXT_DEIGD Pyridoxal 5'-phosphate synthase subunit PdxT OS=Deinococcus geothermalis (strain DSM 11300) GN=pdxT PE=3 SV=1 11 234 1.0E-33
sp|A6WCI3|PDXT_KINRD Pyridoxal 5'-phosphate synthase subunit PdxT OS=Kineococcus radiotolerans (strain ATCC BAA-149 / DSM 14245 / SRS30216) GN=pdxT PE=3 SV=1 11 231 1.0E-33
sp|Q65PL1|PDXT_BACLD Pyridoxal 5'-phosphate synthase subunit PdxT OS=Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / NBRC 12200 / NCIMB 9375 / NRRL NRS-1264 / Gibson 46) GN=pdxT PE=3 SV=1 8 231 1.0E-33
sp|Q59055|PDXT_METJA Pyridoxal 5'-phosphate synthase subunit PdxT OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=pdxT PE=1 SV=1 9 231 1.0E-33
sp|Q5L3Y1|PDXT_GEOKA Pyridoxal 5'-phosphate synthase subunit PdxT OS=Geobacillus kaustophilus (strain HTA426) GN=pdxT PE=1 SV=1 11 231 1.0E-33
sp|A8F840|PDXT_PSELT Pyridoxal 5'-phosphate synthase subunit PdxT OS=Pseudothermotoga lettingae (strain ATCC BAA-301 / DSM 14385 / NBRC 107922 / TMO) GN=pdxT PE=3 SV=2 9 231 2.0E-33
sp|A3DM32|PDXT_STAMF Pyridoxal 5'-phosphate synthase subunit PdxT OS=Staphylothermus marinus (strain ATCC 43588 / DSM 3639 / JCM 9404 / F1) GN=pdxT PE=3 SV=1 11 234 2.0E-33
sp|Q18KL6|PDXT_HALWD Pyridoxal 5'-phosphate synthase subunit PdxT OS=Haloquadratum walsbyi (strain DSM 16790 / HBSQ001) GN=pdxT PE=3 SV=1 8 226 2.0E-33
sp|Q8CQV8|PDXT_STAES Pyridoxal 5'-phosphate synthase subunit PdxT OS=Staphylococcus epidermidis (strain ATCC 12228) GN=pdxT PE=3 SV=1 11 234 2.0E-33
sp|A7HNV0|PDXT_FERNB Pyridoxal 5'-phosphate synthase subunit PdxT OS=Fervidobacterium nodosum (strain ATCC 35602 / DSM 5306 / Rt17-B1) GN=pdxT PE=3 SV=1 9 231 2.0E-33
sp|A0RTP4|PDXT_CENSY Pyridoxal 5'-phosphate synthase subunit PdxT OS=Cenarchaeum symbiosum (strain A) GN=pdxT PE=3 SV=1 11 231 3.0E-33
sp|Q6HQ04|PDXT_BACHK Pyridoxal 5'-phosphate synthase subunit PdxT OS=Bacillus thuringiensis subsp. konkukian (strain 97-27) GN=pdxT PE=3 SV=1 8 231 3.0E-33
sp|C1ES18|PDXT_BACC3 Pyridoxal 5'-phosphate synthase subunit PdxT OS=Bacillus cereus (strain 03BB102) GN=pdxT PE=3 SV=1 8 231 3.0E-33
sp|B7JJC7|PDXT_BACC0 Pyridoxal 5'-phosphate synthase subunit PdxT OS=Bacillus cereus (strain AH820) GN=pdxT PE=3 SV=1 8 231 3.0E-33
sp|A0R890|PDXT_BACAH Pyridoxal 5'-phosphate synthase subunit PdxT OS=Bacillus thuringiensis (strain Al Hakam) GN=pdxT PE=3 SV=2 8 231 3.0E-33
sp|A4FBA2|PDXT_SACEN Pyridoxal 5'-phosphate synthase subunit PdxT OS=Saccharopolyspora erythraea (strain ATCC 11635 / DSM 40517 / JCM 4748 / NBRC 13426 / NCIMB 8594 / NRRL 2338) GN=pdxT PE=3 SV=1 10 231 3.0E-33
sp|Q9UWX4|PDXT_SULSO Pyridoxal 5'-phosphate synthase subunit PdxT OS=Sulfolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) GN=pdxT PE=3 SV=1 11 231 3.0E-33
sp|Q49V29|PDXT_STAS1 Pyridoxal 5'-phosphate synthase subunit PdxT OS=Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229) GN=pdxT PE=3 SV=1 11 234 3.0E-33
sp|Q6MEN7|PDXT_PARUW Pyridoxal 5'-phosphate synthase subunit PdxT OS=Protochlamydia amoebophila (strain UWE25) GN=pdxT PE=3 SV=1 9 231 4.0E-33
sp|A3MSM9|PDXT_PYRCJ Pyridoxal 5'-phosphate synthase subunit PdxT OS=Pyrobaculum calidifontis (strain JCM 11548 / VA1) GN=pdxT PE=3 SV=1 11 232 5.0E-33
sp|A5D6D2|PDXT_PELTS Pyridoxal 5'-phosphate synthase subunit PdxT OS=Pelotomaculum thermopropionicum (strain DSM 13744 / JCM 10971 / SI) GN=pdxT PE=3 SV=1 11 235 5.0E-33
sp|Q5UZW7|PDXT_HALMA Pyridoxal 5'-phosphate synthase subunit PdxT OS=Haloarcula marismortui (strain ATCC 43049 / DSM 3752 / JCM 8966 / VKM B-1809) GN=pdxT PE=3 SV=1 12 226 5.0E-33
sp|B6YQU3|PDXT_AZOPC Pyridoxal 5'-phosphate synthase subunit PdxT OS=Azobacteroides pseudotrichonymphae genomovar. CFP2 GN=pdxT PE=3 SV=1 11 234 7.0E-33
sp|Q8NS90|PDXT_CORGL Pyridoxal 5'-phosphate synthase subunit PdxT OS=Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / LMG 3730 / NCIMB 10025) GN=pdxT PE=3 SV=1 9 231 8.0E-33
sp|Q97CP5|PDXT_THEVO Pyridoxal 5'-phosphate synthase subunit PdxT OS=Thermoplasma volcanium (strain ATCC 51530 / DSM 4299 / JCM 9571 / NBRC 15438 / GSS1) GN=pdxT PE=3 SV=1 11 231 8.0E-33
sp|B1MCJ8|PDXT_MYCA9 Pyridoxal 5'-phosphate synthase subunit PdxT OS=Mycobacterium abscessus (strain ATCC 19977 / DSM 44196 / CIP 104536 / JCM 13569 / NCTC 13031 / TMC 1543) GN=pdxT PE=3 SV=1 10 231 9.0E-33
sp|Q1B9S6|PDXT_MYCSS Pyridoxal 5'-phosphate synthase subunit PdxT OS=Mycobacterium sp. (strain MCS) GN=pdxT PE=3 SV=1 10 231 9.0E-33
sp|A1UF87|PDXT_MYCSK Pyridoxal 5'-phosphate synthase subunit PdxT OS=Mycobacterium sp. (strain KMS) GN=pdxT PE=3 SV=1 10 231 9.0E-33
sp|Q81W26|PDXT_BACAN Pyridoxal 5'-phosphate synthase subunit PdxT OS=Bacillus anthracis GN=pdxT PE=3 SV=1 8 231 9.0E-33
sp|C3LIY8|PDXT_BACAC Pyridoxal 5'-phosphate synthase subunit PdxT OS=Bacillus anthracis (strain CDC 684 / NRRL 3495) GN=pdxT PE=3 SV=1 8 231 9.0E-33
sp|C3P8Q4|PDXT_BACAA Pyridoxal 5'-phosphate synthase subunit PdxT OS=Bacillus anthracis (strain A0248) GN=pdxT PE=3 SV=1 8 231 9.0E-33
sp|A0QIC6|PDXT_MYCA1 Pyridoxal 5'-phosphate synthase subunit PdxT OS=Mycobacterium avium (strain 104) GN=pdxT PE=3 SV=1 11 231 1.0E-32
sp|Q0RNV0|PDXT_FRAAA Pyridoxal 5'-phosphate synthase subunit PdxT OS=Frankia alni (strain ACN14a) GN=pdxT PE=3 SV=1 11 231 1.0E-32
sp|A4QCC4|PDXT_CORGB Pyridoxal 5'-phosphate synthase subunit PdxT OS=Corynebacterium glutamicum (strain R) GN=pdxT PE=3 SV=1 9 231 1.0E-32
sp|Q4L3H9|PDXT_STAHJ Pyridoxal 5'-phosphate synthase subunit PdxT OS=Staphylococcus haemolyticus (strain JCSC1435) GN=pdxT PE=3 SV=1 11 234 2.0E-32
sp|Q9HMD2|PDXT_HALSA Pyridoxal 5'-phosphate synthase subunit PdxT OS=Halobacterium salinarum (strain ATCC 700922 / JCM 11081 / NRC-1) GN=pdxT PE=3 SV=1 9 226 2.0E-32
sp|B0R879|PDXT_HALS3 Pyridoxal 5'-phosphate synthase subunit PdxT OS=Halobacterium salinarum (strain ATCC 29341 / DSM 671 / R1) GN=pdxT PE=3 SV=1 9 226 2.0E-32
sp|Q2JD98|PDXT_FRASC Pyridoxal 5'-phosphate synthase subunit PdxT OS=Frankia sp. (strain CcI3) GN=pdxT PE=3 SV=1 11 233 3.0E-32
sp|A3PYU8|PDXT_MYCSJ Pyridoxal 5'-phosphate synthase subunit PdxT OS=Mycobacterium sp. (strain JLS) GN=pdxT PE=3 SV=1 10 231 3.0E-32
sp|Q4J8L2|PDXT_SULAC Pyridoxal 5'-phosphate synthase subunit PdxT OS=Sulfolobus acidocaldarius (strain ATCC 33909 / DSM 639 / JCM 8929 / NBRC 15157 / NCIMB 11770) GN=pdxT PE=3 SV=1 11 233 4.0E-32
sp|B8I364|PDXT_CLOCE Pyridoxal 5'-phosphate synthase subunit PdxT OS=Clostridium cellulolyticum (strain ATCC 35319 / DSM 5812 / JCM 6584 / H10) GN=pdxT PE=3 SV=1 11 231 4.0E-32
sp|A4X5V4|PDXT_SALTO Pyridoxal 5'-phosphate synthase subunit PdxT OS=Salinispora tropica (strain ATCC BAA-916 / DSM 44818 / CNB-440) GN=pdxT PE=3 SV=1 10 229 6.0E-32
sp|A8LWZ5|PDXT_SALAI Pyridoxal 5'-phosphate synthase subunit PdxT OS=Salinispora arenicola (strain CNS-205) GN=pdxT PE=3 SV=1 10 229 6.0E-32
sp|Q5SKD6|PDXT_THET8 Pyridoxal 5'-phosphate synthase subunit PdxT OS=Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) GN=pdxT PE=1 SV=1 10 231 6.0E-32
sp|C0ZH53|PDXT_BREBN Pyridoxal 5'-phosphate synthase subunit PdxT OS=Brevibacillus brevis (strain 47 / JCM 6285 / NBRC 100599) GN=pdxT PE=3 SV=1 11 231 7.0E-32
sp|C3MW85|PDXT_SULIM Pyridoxal 5'-phosphate synthase subunit PdxT OS=Sulfolobus islandicus (strain M.14.25 / Kamchatka #1) GN=pdxT PE=3 SV=1 11 231 8.0E-32
sp|C4KHU2|PDXT_SULIK Pyridoxal 5'-phosphate synthase subunit PdxT OS=Sulfolobus islandicus (strain M.16.4 / Kamchatka #3) GN=pdxT PE=3 SV=1 11 231 8.0E-32
sp|C3N6C7|PDXT_SULIA Pyridoxal 5'-phosphate synthase subunit PdxT OS=Sulfolobus islandicus (strain M.16.27) GN=pdxT PE=3 SV=1 11 231 8.0E-32
sp|B9KBI1|PDXT_THENN Pyridoxal 5'-phosphate synthase subunit PdxT OS=Thermotoga neapolitana (strain ATCC 49049 / DSM 4359 / NS-E) GN=pdxT PE=3 SV=1 11 231 9.0E-32
sp|Q9WYU3|PDXT_THEMA Pyridoxal 5'-phosphate synthase subunit PdxT OS=Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099) GN=pdxT PE=1 SV=1 11 231 1.0E-31
sp|A2BLL6|PDXT_HYPBU Pyridoxal 5'-phosphate synthase subunit PdxT OS=Hyperthermus butylicus (strain DSM 5456 / JCM 9403 / PLM1-5) GN=pdxT PE=3 SV=1 8 226 1.0E-31
sp|A6M3G5|PDXT_CLOB8 Pyridoxal 5'-phosphate synthase subunit PdxT OS=Clostridium beijerinckii (strain ATCC 51743 / NCIMB 8052) GN=pdxT PE=3 SV=1 11 231 2.0E-31
sp|A9A4S0|PDXT_NITMS Pyridoxal 5'-phosphate synthase subunit PdxT OS=Nitrosopumilus maritimus (strain SCM1) GN=pdxT PE=3 SV=1 11 231 2.0E-31
sp|P83813|PDXT_GEOSE Pyridoxal 5'-phosphate synthase subunit PdxT OS=Geobacillus stearothermophilus GN=pdxT PE=1 SV=1 11 231 2.0E-31
sp|B7IEZ6|PDXT_THEAB Pyridoxal 5'-phosphate synthase subunit PdxT OS=Thermosipho africanus (strain TCF52B) GN=pdxT PE=3 SV=1 11 231 2.0E-31
sp|P9WII7|PDXT_MYCTU Pyridoxal 5'-phosphate synthase subunit PdxT OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=pdxT PE=1 SV=1 11 231 2.0E-31
sp|P9WII6|PDXT_MYCTO Pyridoxal 5'-phosphate synthase subunit PdxT OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=pdxT PE=3 SV=1 11 231 2.0E-31
sp|A5U5V5|PDXT_MYCTA Pyridoxal 5'-phosphate synthase subunit PdxT OS=Mycobacterium tuberculosis (strain ATCC 25177 / H37Ra) GN=pdxT PE=3 SV=1 11 231 2.0E-31
sp|C1AF75|PDXT_MYCBT Pyridoxal 5'-phosphate synthase subunit PdxT OS=Mycobacterium bovis (strain BCG / Tokyo 172 / ATCC 35737 / TMC 1019) GN=pdxT PE=3 SV=1 11 231 2.0E-31
sp|A1KLV4|PDXT_MYCBP Pyridoxal 5'-phosphate synthase subunit PdxT OS=Mycobacterium bovis (strain BCG / Pasteur 1173P2) GN=pdxT PE=3 SV=1 11 231 2.0E-31
sp|Q7TY92|PDXT_MYCBO Pyridoxal 5'-phosphate synthase subunit PdxT OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=pdxT PE=3 SV=1 11 231 2.0E-31
sp|C3MQK7|PDXT_SULIL Pyridoxal 5'-phosphate synthase subunit PdxT OS=Sulfolobus islandicus (strain L.S.2.15 / Lassen #1) GN=pdxT PE=3 SV=1 11 231 3.0E-31
sp|A5IJU9|PDXT_THEP1 Pyridoxal 5'-phosphate synthase subunit PdxT OS=Thermotoga petrophila (strain RKU-1 / ATCC BAA-488 / DSM 13995) GN=pdxT PE=3 SV=1 11 231 3.0E-31
sp|Q6NK10|PDXT_CORDI Pyridoxal 5'-phosphate synthase subunit PdxT OS=Corynebacterium diphtheriae (strain ATCC 700971 / NCTC 13129 / Biotype gravis) GN=pdxT PE=3 SV=1 9 233 3.0E-31
sp|B9DKX8|PDXT_STACT Pyridoxal 5'-phosphate synthase subunit PdxT OS=Staphylococcus carnosus (strain TM300) GN=pdxT PE=3 SV=1 11 234 3.0E-31
sp|Q1IQH8|PDXT_KORVE Pyridoxal 5'-phosphate synthase subunit PdxT OS=Koribacter versatilis (strain Ellin345) GN=pdxT PE=3 SV=1 11 231 4.0E-31
sp|Q7A1R6|PDXT_STAAW Pyridoxal 5'-phosphate synthase subunit PdxT OS=Staphylococcus aureus (strain MW2) GN=pdxT PE=3 SV=1 11 234 5.0E-31
sp|A8YZL6|PDXT_STAAT Pyridoxal 5'-phosphate synthase subunit PdxT OS=Staphylococcus aureus (strain USA300 / TCH1516) GN=pdxT PE=3 SV=1 11 234 5.0E-31
sp|Q6GBW8|PDXT_STAAS Pyridoxal 5'-phosphate synthase subunit PdxT OS=Staphylococcus aureus (strain MSSA476) GN=pdxT PE=3 SV=1 11 234 5.0E-31
sp|Q6GJE9|PDXT_STAAR Pyridoxal 5'-phosphate synthase subunit PdxT OS=Staphylococcus aureus (strain MRSA252) GN=pdxT PE=3 SV=1 11 234 5.0E-31
sp|Q7A7A1|PDXT_STAAN Pyridoxal 5'-phosphate synthase subunit PdxT OS=Staphylococcus aureus (strain N315) GN=pdxT PE=1 SV=1 11 234 5.0E-31
sp|Q99W83|PDXT_STAAM Pyridoxal 5'-phosphate synthase subunit PdxT OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=pdxT PE=3 SV=1 11 234 5.0E-31
sp|A6QEH2|PDXT_STAAE Pyridoxal 5'-phosphate synthase subunit PdxT OS=Staphylococcus aureus (strain Newman) GN=pdxT PE=3 SV=1 11 234 5.0E-31
sp|Q5HIF4|PDXT_STAAC Pyridoxal 5'-phosphate synthase subunit PdxT OS=Staphylococcus aureus (strain COL) GN=pdxT PE=3 SV=1 11 234 5.0E-31
sp|Q2YSE1|PDXT_STAAB Pyridoxal 5'-phosphate synthase subunit PdxT OS=Staphylococcus aureus (strain bovine RF122 / ET3-1) GN=pdxT PE=3 SV=1 11 234 5.0E-31
sp|A5IQ73|PDXT_STAA9 Pyridoxal 5'-phosphate synthase subunit PdxT OS=Staphylococcus aureus (strain JH9) GN=pdxT PE=3 SV=1 11 234 5.0E-31
sp|Q2G0Q0|PDXT_STAA8 Pyridoxal 5'-phosphate synthase subunit PdxT OS=Staphylococcus aureus (strain NCTC 8325) GN=pdxT PE=3 SV=1 11 234 5.0E-31
sp|Q2FJC0|PDXT_STAA3 Pyridoxal 5'-phosphate synthase subunit PdxT OS=Staphylococcus aureus (strain USA300) GN=pdxT PE=3 SV=1 11 234 5.0E-31
sp|A6TYZ6|PDXT_STAA2 Pyridoxal 5'-phosphate synthase subunit PdxT OS=Staphylococcus aureus (strain JH1) GN=pdxT PE=3 SV=1 11 234 5.0E-31
sp|A7WYT2|PDXT_STAA1 Pyridoxal 5'-phosphate synthase subunit PdxT OS=Staphylococcus aureus (strain Mu3 / ATCC 700698) GN=pdxT PE=3 SV=1 11 234 5.0E-31
sp|Q2FTH1|PDXT_METHJ Pyridoxal 5'-phosphate synthase subunit PdxT OS=Methanospirillum hungatei JF-1 (strain ATCC 27890 / DSM 864 / NBRC 100397 / JF-1) GN=pdxT PE=3 SV=1 11 234 5.0E-31
sp|B1L921|PDXT_THESQ Pyridoxal 5'-phosphate synthase subunit PdxT OS=Thermotoga sp. (strain RQ2) GN=pdxT PE=3 SV=1 11 231 5.0E-31
sp|Q8RBJ4|PDXT_CALS4 Pyridoxal 5'-phosphate synthase subunit PdxT OS=Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4) GN=pdxT PE=3 SV=1 11 231 6.0E-31
sp|A2SPK0|PDXT_METLZ Pyridoxal 5'-phosphate synthase subunit PdxT OS=Methanocorpusculum labreanum (strain ATCC 43576 / DSM 4855 / Z) GN=pdxT PE=3 SV=1 11 231 7.0E-31
sp|Q8G575|PDXT_BIFLO Pyridoxal 5'-phosphate synthase subunit PdxT OS=Bifidobacterium longum (strain NCC 2705) GN=pdxT PE=3 SV=2 10 231 7.0E-31
sp|C3NGV9|PDXT_SULIN Pyridoxal 5'-phosphate synthase subunit PdxT OS=Sulfolobus islandicus (strain Y.N.15.51 / Yellowstone #2) GN=pdxT PE=3 SV=1 11 231 7.0E-31
sp|B2IQT4|PDXT_STRPS Pyridoxal 5'-phosphate synthase subunit PdxT OS=Streptococcus pneumoniae (strain CGSP14) GN=pdxT PE=3 SV=1 11 231 8.0E-31
sp|C3NET5|PDXT_SULIY Pyridoxal 5'-phosphate synthase subunit PdxT OS=Sulfolobus islandicus (strain Y.G.57.14 / Yellowstone #1) GN=pdxT PE=3 SV=1 11 231 9.0E-31
sp|P0C036|PDXT_METMP Pyridoxal 5'-phosphate synthase subunit PdxT OS=Methanococcus maripaludis (strain S2 / LL) GN=pdxT PE=3 SV=1 10 235 1.0E-30
sp|A6LP41|PDXT_THEM4 Pyridoxal 5'-phosphate synthase subunit PdxT OS=Thermosipho melanesiensis (strain DSM 12029 / CIP 104789 / BI429) GN=pdxT PE=3 SV=1 11 230 1.0E-30
sp|B0TZ16|PDXT_FRAP2 Pyridoxal 5'-phosphate synthase subunit PdxT OS=Francisella philomiragia subsp. philomiragia (strain ATCC 25017) GN=pdxT PE=3 SV=1 9 231 1.0E-30
sp|Q9CCT5|PDXT_MYCLE Pyridoxal 5'-phosphate synthase subunit PdxT OS=Mycobacterium leprae (strain TN) GN=pdxT PE=3 SV=2 11 231 1.0E-30
sp|B8FZR4|PDXT_DESHD Pyridoxal 5'-phosphate synthase subunit PdxT OS=Desulfitobacterium hafniense (strain DCB-2 / DSM 10664) GN=pdxT PE=3 SV=1 11 233 2.0E-30
sp|A4WHH5|PDXT_PYRAR Pyridoxal 5'-phosphate synthase subunit PdxT OS=Pyrobaculum arsenaticum (strain DSM 13514 / JCM 11321) GN=pdxT PE=3 SV=1 11 223 2.0E-30
sp|A4J0G0|PDXT_DESRM Pyridoxal 5'-phosphate synthase subunit PdxT OS=Desulfotomaculum reducens (strain MI-1) GN=pdxT PE=3 SV=1 9 231 2.0E-30
sp|B0K4N6|PDXT_THEPX Pyridoxal 5'-phosphate synthase subunit PdxT OS=Thermoanaerobacter sp. (strain X514) GN=pdxT PE=3 SV=1 11 231 3.0E-30
sp|B0KAS0|PDXT_THEP3 Pyridoxal 5'-phosphate synthase subunit PdxT OS=Thermoanaerobacter pseudethanolicus (strain ATCC 33223 / 39E) GN=pdxT PE=3 SV=1 11 231 3.0E-30
sp|A7I472|PDXT_METB6 Pyridoxal 5'-phosphate synthase subunit PdxT OS=Methanoregula boonei (strain 6A8) GN=pdxT PE=3 SV=2 11 233 3.0E-30
sp|Q9HM60|PDXT_THEAC Pyridoxal 5'-phosphate synthase subunit PdxT OS=Thermoplasma acidophilum (strain ATCC 25905 / DSM 1728 / JCM 9062 / NBRC 15155 / AMRC-C165) GN=pdxT PE=3 SV=1 11 231 5.0E-30
sp|Q8TWH2|PDXT_METKA Pyridoxal 5'-phosphate synthase subunit PdxT OS=Methanopyrus kandleri (strain AV19 / DSM 6324 / JCM 9639 / NBRC 100938) GN=pdxT PE=3 SV=1 46 233 5.0E-30
sp|A9A909|PDXT_METM6 Pyridoxal 5'-phosphate synthase subunit PdxT OS=Methanococcus maripaludis (strain C6 / ATCC BAA-1332) GN=pdxT PE=3 SV=1 10 235 5.0E-30
sp|Q8EN04|PDXT_OCEIH Pyridoxal 5'-phosphate synthase subunit PdxT OS=Oceanobacillus iheyensis (strain DSM 14371 / JCM 11309 / KCTC 3954 / HTE831) GN=pdxT PE=3 SV=2 11 230 7.0E-30
sp|A4YI12|PDXT_METS5 Pyridoxal 5'-phosphate synthase subunit PdxT OS=Metallosphaera sedula (strain ATCC 51363 / DSM 5348) GN=pdxT PE=3 SV=1 11 231 9.0E-30
sp|Q24PK8|PDXT_DESHY Pyridoxal 5'-phosphate synthase subunit PdxT OS=Desulfitobacterium hafniense (strain Y51) GN=pdxT PE=3 SV=1 11 233 2.0E-29
sp|A0PSY6|PDXT_MYCUA Pyridoxal 5'-phosphate synthase subunit PdxT OS=Mycobacterium ulcerans (strain Agy99) GN=pdxT PE=3 SV=1 11 231 2.0E-29
sp|B2HN48|PDXT_MYCMM Pyridoxal 5'-phosphate synthase subunit PdxT OS=Mycobacterium marinum (strain ATCC BAA-535 / M) GN=pdxT PE=3 SV=1 11 231 2.0E-29
sp|B1KYX4|PDXT_CLOBM Pyridoxal 5'-phosphate synthase subunit PdxT OS=Clostridium botulinum (strain Loch Maree / Type A3) GN=pdxT PE=3 SV=1 8 234 2.0E-29
sp|A4G0R6|PDXT_METM5 Pyridoxal 5'-phosphate synthase subunit PdxT OS=Methanococcus maripaludis (strain C5 / ATCC BAA-1333) GN=pdxT PE=3 SV=1 10 235 2.0E-29
sp|A6VHR9|PDXT_METM7 Pyridoxal 5'-phosphate synthase subunit PdxT OS=Methanococcus maripaludis (strain C7 / ATCC BAA-1331) GN=pdxT PE=3 SV=1 10 235 3.0E-29
sp|Q97LG6|PDXT_CLOAB Pyridoxal 5'-phosphate synthase subunit PdxT OS=Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / LMG 5710 / VKM B-1787) GN=pdxT PE=3 SV=1 11 231 3.0E-29
sp|C1CQQ1|PDXT_STRZT Pyridoxal 5'-phosphate synthase subunit PdxT OS=Streptococcus pneumoniae (strain Taiwan19F-14) GN=pdxT PE=3 SV=1 11 231 5.0E-29
sp|C1CLG6|PDXT_STRZP Pyridoxal 5'-phosphate synthase subunit PdxT OS=Streptococcus pneumoniae (strain P1031) GN=pdxT PE=3 SV=1 11 231 5.0E-29
sp|C1CF49|PDXT_STRZJ Pyridoxal 5'-phosphate synthase subunit PdxT OS=Streptococcus pneumoniae (strain JJA) GN=pdxT PE=3 SV=1 11 231 5.0E-29
sp|Q97PX3|PDXT_STRPN Pyridoxal 5'-phosphate synthase subunit PdxT OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) GN=pdxT PE=3 SV=1 11 231 5.0E-29
sp|B8ZL13|PDXT_STRPJ Pyridoxal 5'-phosphate synthase subunit PdxT OS=Streptococcus pneumoniae (strain ATCC 700669 / Spain 23F-1) GN=pdxT PE=3 SV=1 11 231 5.0E-29
sp|B1ICP8|PDXT_STRPI Pyridoxal 5'-phosphate synthase subunit PdxT OS=Streptococcus pneumoniae (strain Hungary19A-6) GN=pdxT PE=3 SV=1 11 231 5.0E-29
sp|C1C862|PDXT_STRP7 Pyridoxal 5'-phosphate synthase subunit PdxT OS=Streptococcus pneumoniae (strain 70585) GN=pdxT PE=3 SV=1 11 231 5.0E-29
sp|B1YGC2|PDXT_EXIS2 Pyridoxal 5'-phosphate synthase subunit PdxT OS=Exiguobacterium sibiricum (strain DSM 17290 / JCM 13490 / 255-15) GN=pdxT PE=3 SV=1 9 233 5.0E-29
sp|A3CRE5|PDXT_METMJ Pyridoxal 5'-phosphate synthase subunit PdxT OS=Methanoculleus marisnigri (strain ATCC 35101 / DSM 1498 / JR1) GN=pdxT PE=3 SV=1 9 231 6.0E-29
sp|Q8DP72|PDXT_STRR6 Pyridoxal 5'-phosphate synthase subunit PdxT OS=Streptococcus pneumoniae (strain ATCC BAA-255 / R6) GN=pdxT PE=3 SV=1 11 231 9.0E-29
sp|Q04JN6|PDXT_STRP2 Pyridoxal 5'-phosphate synthase subunit PdxT OS=Streptococcus pneumoniae serotype 2 (strain D39 / NCTC 7466) GN=pdxT PE=3 SV=1 11 231 9.0E-29
sp|A0B7N4|PDXT_METTP Pyridoxal 5'-phosphate synthase subunit PdxT OS=Methanosaeta thermophila (strain DSM 6194 / JCM 14653 / NBRC 101360 / PT) GN=pdxT PE=3 SV=1 11 231 1.0E-28
sp|A5UF87|PDXT_HAEIG Pyridoxal 5'-phosphate synthase subunit PdxT OS=Haemophilus influenzae (strain PittGG) GN=pdxT PE=3 SV=1 11 230 2.0E-28
sp|B9LSC8|PDXT_HALLT Pyridoxal 5'-phosphate synthase subunit PdxT OS=Halorubrum lacusprofundi (strain ATCC 49239 / DSM 5036 / JCM 8891 / ACAM 34) GN=pdxT PE=3 SV=1 41 226 2.0E-28
sp|P45294|PDXT_HAEIN Pyridoxal 5'-phosphate synthase subunit PdxT OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=pdxT PE=3 SV=2 11 230 2.0E-28
sp|A5UBN1|PDXT_HAEIE Pyridoxal 5'-phosphate synthase subunit PdxT OS=Haemophilus influenzae (strain PittEE) GN=pdxT PE=3 SV=1 11 230 2.0E-28
sp|Q4QJU4|PDXT_HAEI8 Pyridoxal 5'-phosphate synthase subunit PdxT OS=Haemophilus influenzae (strain 86-028NP) GN=pdxT PE=3 SV=1 11 230 2.0E-28
sp|Q971B2|PDXT_SULTO Pyridoxal 5'-phosphate synthase subunit PdxT OS=Sulfolobus tokodaii (strain DSM 16993 / JCM 10545 / NBRC 100140 / 7) GN=pdxT PE=3 SV=1 11 231 3.0E-28
sp|B5E5W0|PDXT_STRP4 Pyridoxal 5'-phosphate synthase subunit PdxT OS=Streptococcus pneumoniae serotype 19F (strain G54) GN=pdxT PE=3 SV=1 11 231 3.0E-28
sp|A4IZB4|PDXT_FRATW Pyridoxal 5'-phosphate synthase subunit PdxT OS=Francisella tularensis subsp. tularensis (strain WY96-3418) GN=pdxT PE=3 SV=1 11 230 9.0E-28
sp|Q5NHE5|PDXT_FRATT Pyridoxal 5'-phosphate synthase subunit PdxT OS=Francisella tularensis subsp. tularensis (strain SCHU S4 / Schu 4) GN=pdxT PE=3 SV=2 11 230 9.0E-28
sp|B2SDL4|PDXT_FRATM Pyridoxal 5'-phosphate synthase subunit PdxT OS=Francisella tularensis subsp. mediasiatica (strain FSC147) GN=pdxT PE=3 SV=1 11 230 9.0E-28
sp|Q14IU7|PDXT_FRAT1 Pyridoxal 5'-phosphate synthase subunit PdxT OS=Francisella tularensis subsp. tularensis (strain FSC 198) GN=pdxT PE=3 SV=2 11 230 9.0E-28
sp|A6UQT7|PDXT_METVS Pyridoxal 5'-phosphate synthase subunit PdxT OS=Methanococcus vannielii (strain SB / ATCC 35089 / DSM 1224) GN=pdxT PE=3 SV=1 10 235 1.0E-27
sp|A0Q5I2|PDXT_FRATN Pyridoxal 5'-phosphate synthase subunit PdxT OS=Francisella tularensis subsp. novicida (strain U112) GN=pdxT PE=3 SV=1 11 230 2.0E-27
sp|Q0BKT3|PDXT_FRATO Pyridoxal 5'-phosphate synthase subunit PdxT OS=Francisella tularensis subsp. holarctica (strain OSU18) GN=pdxT PE=3 SV=2 11 230 2.0E-27
sp|Q2A261|PDXT_FRATH Pyridoxal 5'-phosphate synthase subunit PdxT OS=Francisella tularensis subsp. holarctica (strain LVS) GN=pdxT PE=3 SV=1 11 230 2.0E-27
sp|A7NDQ2|PDXT_FRATF Pyridoxal 5'-phosphate synthase subunit PdxT OS=Francisella tularensis subsp. holarctica (strain FTNF002-00 / FTA) GN=pdxT PE=3 SV=1 11 230 2.0E-27
sp|A1A3A4|PDXT_BIFAA Pyridoxal 5'-phosphate synthase subunit PdxT OS=Bifidobacterium adolescentis (strain ATCC 15703 / DSM 20083 / NCTC 11814 / E194a) GN=pdxT PE=3 SV=2 10 231 2.0E-27
sp|Q02CB5|PDXT_SOLUE Pyridoxal 5'-phosphate synthase subunit PdxT OS=Solibacter usitatus (strain Ellin6076) GN=pdxT PE=3 SV=1 11 233 3.0E-27
sp|A6UWZ3|PDXT_META3 Pyridoxal 5'-phosphate synthase subunit PdxT OS=Methanococcus aeolicus (strain Nankai-3 / ATCC BAA-1280) GN=pdxT PE=3 SV=1 11 234 3.0E-27
sp|B8E120|PDXT_DICTD Pyridoxal 5'-phosphate synthase subunit PdxT OS=Dictyoglomus turgidum (strain Z-1310 / DSM 6724) GN=pdxT PE=3 SV=1 11 231 5.0E-27
sp|B5YF84|PDXT_DICT6 Pyridoxal 5'-phosphate synthase subunit PdxT OS=Dictyoglomus thermophilum (strain ATCC 35947 / DSM 3960 / H-6-12) GN=pdxT PE=3 SV=1 11 231 2.0E-26
sp|Q6L1R3|PDXT_PICTO Pyridoxal 5'-phosphate synthase subunit PdxT OS=Picrophilus torridus (strain ATCC 700027 / DSM 9790 / JCM 10055 / NBRC 100828) GN=pdxT PE=3 SV=1 11 234 1.0E-25
sp|B9MKY8|PDXT_CALBD Pyridoxal 5'-phosphate synthase subunit PdxT OS=Caldicellulosiruptor bescii (strain ATCC BAA-1888 / DSM 6725 / Z-1320) GN=pdxT PE=3 SV=1 11 234 1.0E-25
sp|A4XIB6|PDXT_CALS8 Pyridoxal 5'-phosphate synthase subunit PdxT OS=Caldicellulosiruptor saccharolyticus (strain ATCC 43494 / DSM 8903 / Tp8T 6331) GN=pdxT PE=3 SV=1 11 234 2.0E-25
sp|A8MAY1|PDXT_CALMQ Pyridoxal 5'-phosphate synthase subunit PdxT OS=Caldivirga maquilingensis (strain ATCC 700844 / DSM 13496 / JCM 10307 / IC-167) GN=pdxT PE=3 SV=1 11 234 4.0E-25
sp|A1RU67|PDXT_PYRIL Pyridoxal 5'-phosphate synthase subunit PdxT OS=Pyrobaculum islandicum (strain DSM 4184 / JCM 9189 / GEO3) GN=pdxT PE=3 SV=1 12 231 5.0E-25
sp|B1YB90|PDXT_PYRNV Pyridoxal 5'-phosphate synthase subunit PdxT OS=Pyrobaculum neutrophilum (strain DSM 2338 / JCM 9278 / V24Sta) GN=pdxT PE=3 SV=1 12 231 3.0E-24
sp|Q73WF2|PDXT_MYCPA Pyridoxal 5'-phosphate synthase subunit PdxT OS=Mycobacterium paratuberculosis (strain ATCC BAA-968 / K-10) GN=pdxT PE=3 SV=1 11 183 3.0E-24
sp|B1L4Z3|PDXT_KORCO Pyridoxal 5'-phosphate synthase subunit PdxT OS=Korarchaeum cryptofilum (strain OPF8) GN=pdxT PE=3 SV=1 11 234 8.0E-24
sp|B8GE19|PDXT_METPE Pyridoxal 5'-phosphate synthase subunit PdxT OS=Methanosphaerula palustris (strain ATCC BAA-1556 / DSM 19958 / E1-9c) GN=pdxT PE=3 SV=1 11 230 2.0E-23
sp|Q8ZUE9|PDXT_PYRAE Pyridoxal 5'-phosphate synthase subunit PdxT OS=Pyrobaculum aerophilum (strain ATCC 51768 / IM2 / DSM 7523 / JCM 9630 / NBRC 100827) GN=pdxT PE=3 SV=1 11 234 2.0E-20
sp|Q2LXR3|PDXT_SYNAS Pyridoxal 5'-phosphate synthase subunit PdxT OS=Syntrophus aciditrophicus (strain SB) GN=pdxT PE=3 SV=1 4 220 1.0E-14
sp|Q9ZGM1|HIS5_LEPBO Imidazole glycerol phosphate synthase subunit HisH OS=Leptospira borgpetersenii GN=hisH PE=3 SV=1 45 218 3.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0042823 pyridoxal phosphate biosynthetic process Yes
GO:0008236 serine-type peptidase activity Yes
GO:0003824 catalytic activity Yes
GO:0004359 glutaminase activity Yes
GO:0006508 proteolysis Yes
GO:0042819 vitamin B6 biosynthetic process Yes
GO:1901576 organic substance biosynthetic process No
GO:1901360 organic cyclic compound metabolic process No
GO:0019637 organophosphate metabolic process No
GO:0006807 nitrogen compound metabolic process No
GO:0043170 macromolecule metabolic process No
GO:0018130 heterocycle biosynthetic process No
GO:0016811 hydrolase activity, acting on carbon-nitrogen (but not peptide) bonds, in linear amides No
GO:0006081 cellular aldehyde metabolic process No
GO:0006796 phosphate-containing compound metabolic process No
GO:0042816 vitamin B6 metabolic process No
GO:0140096 catalytic activity, acting on a protein No
GO:0008233 peptidase activity No
GO:0072525 pyridine-containing compound biosynthetic process No
GO:0006725 cellular aromatic compound metabolic process No
GO:0006766 vitamin metabolic process No
GO:0034641 cellular nitrogen compound metabolic process No
GO:0006793 phosphorus metabolic process No
GO:0042364 water-soluble vitamin biosynthetic process No
GO:0003674 molecular_function No
GO:0016787 hydrolase activity No
GO:0008150 biological_process No
GO:0090407 organophosphate biosynthetic process No
GO:0009987 cellular process No
GO:1901617 organic hydroxy compound biosynthetic process No
GO:0046184 aldehyde biosynthetic process No
GO:0006767 water-soluble vitamin metabolic process No
GO:0009110 vitamin biosynthetic process No
GO:0046483 heterocycle metabolic process No
GO:1901615 organic hydroxy compound metabolic process No
GO:1901564 organonitrogen compound metabolic process No
GO:0019538 protein metabolic process No
GO:0009058 biosynthetic process No
GO:0044238 primary metabolic process No
GO:0042822 pyridoxal phosphate metabolic process No
GO:0017171 serine hydrolase activity No
GO:0019438 aromatic compound biosynthetic process No
GO:1901362 organic cyclic compound biosynthetic process No
GO:0008152 metabolic process No
GO:1901566 organonitrogen compound biosynthetic process No
GO:0044237 cellular metabolic process No
GO:0044281 small molecule metabolic process No
GO:0071704 organic substance metabolic process No
GO:0044283 small molecule biosynthetic process No
GO:0044249 cellular biosynthetic process No
GO:0016810 hydrolase activity, acting on carbon-nitrogen (but not peptide) bonds No
GO:0044271 cellular nitrogen compound biosynthetic process No
GO:0072524 pyridine-containing compound metabolic process No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup3804
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|1300
Ophiocordyceps australis map64 (Brazil) OphauB2|3513 (this protein)
Ophiocordyceps camponoti-floridani Ophcf2|03588
Ophiocordyceps camponoti-rufipedis Ophun1|1388
Ophiocordyceps kimflemingae Ophio5|3342
Ophiocordyceps subramaniannii Hirsu2|7430

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|3513
MTVQSRRLIVVGVLALQGGFAEHVHLVRRAAQLLQLETRLKAIEVRTADELASCDGLIIPGGESTSMAFVAEESG
LLEPLRDFVKRQKKPVWGTCAGLILLSEQANATKQGGQQLIGGLGVRVHRNHFGRQIESFQTPLDLAFLSPSPKE
PPEPFAGIFIRAPVVEQVLHPDVVVLAKVPGRVHKARPGLSQASTESDSADIVAVRQGNVLGTSFHPELTTDARI
HVWWLQEMLHL*
Coding >OphauB2|3513
ATGACGGTCCAGTCGCGCCGCCTCATTGTTGTGGGAGTCTTGGCCCTCCAGGGTGGCTTTGCTGAGCATGTCCAT
CTGGTACGCCGGGCCGCTCAACTCCTGCAGCTCGAGACCAGACTCAAGGCCATCGAGGTGCGCACCGCAGACGAG
CTGGCTAGCTGCGATGGGCTCATCATTCCCGGTGGCGAGAGCACCAGCATGGCCTTTGTGGCGGAAGAGTCTGGG
CTGCTGGAGCCGCTGCGGGACTTTGTAAAACGGCAAAAGAAGCCCGTCTGGGGCACCTGTGCCGGTCTTATTCTC
TTGTCGGAGCAGGCCAACGCCACCAAGCAGGGCGGCCAGCAACTCATTGGCGGCCTGGGCGTGCGAGTCCACCGC
AACCACTTTGGCCGTCAGATTGAGAGCTTCCAGACGCCACTGGACCTAGCCTTTCTTTCCCCGTCGCCCAAGGAG
CCGCCGGAACCGTTTGCCGGCATCTTTATTCGCGCGCCCGTTGTCGAGCAAGTCTTGCACCCTGACGTGGTTGTC
TTGGCAAAGGTGCCCGGCCGTGTGCACAAGGCGCGCCCAGGCCTTTCACAGGCTAGTACTGAGAGTGATTCGGCC
GACATTGTTGCTGTGCGGCAGGGAAACGTGCTTGGCACCAGCTTTCATCCTGAACTGACTACCGACGCGCGCATT
CACGTTTGGTGGCTGCAAGAAATGCTACATCTTTGA
Transcript >OphauB2|3513
ATGACGGTCCAGTCGCGCCGCCTCATTGTTGTGGGAGTCTTGGCCCTCCAGGGTGGCTTTGCTGAGCATGTCCAT
CTGGTACGCCGGGCCGCTCAACTCCTGCAGCTCGAGACCAGACTCAAGGCCATCGAGGTGCGCACCGCAGACGAG
CTGGCTAGCTGCGATGGGCTCATCATTCCCGGTGGCGAGAGCACCAGCATGGCCTTTGTGGCGGAAGAGTCTGGG
CTGCTGGAGCCGCTGCGGGACTTTGTAAAACGGCAAAAGAAGCCCGTCTGGGGCACCTGTGCCGGTCTTATTCTC
TTGTCGGAGCAGGCCAACGCCACCAAGCAGGGCGGCCAGCAACTCATTGGCGGCCTGGGCGTGCGAGTCCACCGC
AACCACTTTGGCCGTCAGATTGAGAGCTTCCAGACGCCACTGGACCTAGCCTTTCTTTCCCCGTCGCCCAAGGAG
CCGCCGGAACCGTTTGCCGGCATCTTTATTCGCGCGCCCGTTGTCGAGCAAGTCTTGCACCCTGACGTGGTTGTC
TTGGCAAAGGTGCCCGGCCGTGTGCACAAGGCGCGCCCAGGCCTTTCACAGGCTAGTACTGAGAGTGATTCGGCC
GACATTGTTGCTGTGCGGCAGGGAAACGTGCTTGGCACCAGCTTTCATCCTGAACTGACTACCGACGCGCGCATT
CACGTTTGGTGGCTGCAAGAAATGCTACATCTTTGA
Gene >OphauB2|3513
ATGACGGTCCAGTCGCGCCGCCTCATTGTTGTGGGAGTCTTGGCCCTCCAGGGTGGCTTTGCTGAGCATGTCCAT
CTGGTACGCCGGGCCGCTCAACTCCTGCAGCTCGAGACCAGACTCAAGGCCATCGAGGTGCGCACCGCAGACGAG
CTGGCTAGCTGCGATGGGCTCATCATTCCCGGTGGCGAGAGCACCAGCATGGCCTTTGTGGCGGAAGAGTCTGGG
CTGCTGGAGCCGCTGCGGGACTTTGTAAAGTAAGTTGCTTGTTTCCCCTGCGAGATGCGACGAGTCAAGTTTTGT
TCTTCTTGTTTACCAAGGCATTGGCTGCAGACGGCAAAAGAAGCCCGTCTGGGGCACCTGTGCCGGTCTTATTCT
CTTGTCGGAGCAGGCCAACGCCACCAAGCAGGGCGGCCAGCAACTCATTGGCGGCCTGGGCGTGCGAGTCCACCG
CAACCACTTTGGCCGTCAGATTGAGAGCTTCCAGACGCCACTGGACCTAGCCTTTCTTTCCCCGTCGCCCAAGGA
GCCGCCGGAACCGTTTGCCGGCATCTTTATTCGCGCGCCCGTTGTCGAGCAAGTCTTGCACCCTGACGTGGTTGT
CTTGGCAAAGGTGCCCGGCCGTGTGCACAAGGCGCGCCCAGGCCTTTCACAGGCTAGTACTGAGAGTGATTCGGC
CGACATTGTTGCTGTGCGGCAGGGAAACGTGCTTGGCACCAGCTTTCATCCTGAACTGACTACCGACGCGCGCAT
TCACGTTTGGTGGCTGCAAGAAATGCTACATCTTTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail