Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|351
Gene name
LocationContig_103:8534..9608
Strand+
Gene length (bp)1074
Transcript length (bp)1074
Coding sequence length (bp)1074
Protein length (aa) 358

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF06391 MAT1 CDK-activating kinase assembly factor MAT1 1.4E-32 66 253
PF17121 zf-C3HC4_5 Zinc finger, C3HC4 type (RING finger) 2.7E-28 13 63

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q75D20|TFB3_ASHGO RNA polymerase II transcription factor B subunit 3 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=TFB3 PE=3 SV=1 10 325 1.0E-55
sp|Q6C7D0|TFB3_YARLI RNA polymerase II transcription factor B subunit 3 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=TFB3 PE=3 SV=1 14 336 5.0E-54
sp|Q6BP96|TFB3_DEBHA RNA polymerase II transcription factor B subunit 3 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=TFB3 PE=3 SV=2 10 326 3.0E-52
sp|Q03290|TFB3_YEAST RNA polymerase II transcription factor B subunit 3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TFB3 PE=1 SV=1 14 325 3.0E-51
sp|Q6CT73|TFB3_KLULA RNA polymerase II transcription factor B subunit 3 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=TFB3 PE=3 SV=1 10 325 3.0E-48
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q75D20|TFB3_ASHGO RNA polymerase II transcription factor B subunit 3 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=TFB3 PE=3 SV=1 10 325 1.0E-55
sp|Q6C7D0|TFB3_YARLI RNA polymerase II transcription factor B subunit 3 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=TFB3 PE=3 SV=1 14 336 5.0E-54
sp|Q6BP96|TFB3_DEBHA RNA polymerase II transcription factor B subunit 3 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=TFB3 PE=3 SV=2 10 326 3.0E-52
sp|Q03290|TFB3_YEAST RNA polymerase II transcription factor B subunit 3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TFB3 PE=1 SV=1 14 325 3.0E-51
sp|Q6CT73|TFB3_KLULA RNA polymerase II transcription factor B subunit 3 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=TFB3 PE=3 SV=1 10 325 3.0E-48
sp|Q6FMP4|TFB3_CANGA RNA polymerase II transcription factor B subunit 3 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=TFB3 PE=3 SV=1 7 325 1.0E-45
sp|O94684|TFB3_SCHPO RNA polymerase II transcription factor B subunit 3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pmh1 PE=1 SV=1 13 328 7.0E-43
sp|P51951|MAT1_XENLA CDK-activating kinase assembly factor MAT1 OS=Xenopus laevis GN=mnat1 PE=2 SV=1 12 318 2.0E-28
sp|P51950|MAT1_MARGL CDK-activating kinase assembly factor MAT1 OS=Marthasterias glacialis PE=1 SV=1 12 337 4.0E-27
sp|P51949|MAT1_MOUSE CDK-activating kinase assembly factor MAT1 OS=Mus musculus GN=Mnat1 PE=1 SV=2 12 318 6.0E-26
sp|P51948|MAT1_HUMAN CDK-activating kinase assembly factor MAT1 OS=Homo sapiens GN=MNAT1 PE=1 SV=1 12 318 1.0E-25
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 55 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|351
MSRTASTSIDTEDETCPVCKTTRYFNKDMEFRINPECYHRMCKTCVERIFRDGPNQCPYAGCHKTLRLRGFKTAF
FADLSIEREVDIRRRVAAVFNKAEDDFQSLTPFNDYLDMVETLTDELVNGDENTRAKAQARLADWEAQHRADIER
NKRLARESDEARQRRLTAESEAARARRQADLAQEAADRAHEARLREEMLDSLTTAETGHASEALNRVMLKKRGQH
KQAPTASSTAGLSIRGLRTKASSNTSSASANKPYDPFGGLSMAPSRVDVSLEALGLYHSEWVDAVRSKDEFRVGG
YLAEEYVGRALFEAFSGLGIDIAEEKGMSDSTGVSTAGAKEVALTGHTTAQLEAANA*
Coding >OphauB2|351
ATGTCCCGCACGGCAAGCACATCCATCGACACTGAAGACGAAACATGTCCCGTGTGCAAAACGACGCGCTACTTC
AACAAGGACATGGAATTCCGCATCAACCCCGAGTGCTACCACCGCATGTGCAAGACATGCGTCGAGCGCATCTTT
CGCGACGGGCCTAACCAGTGCCCCTATGCCGGATGCCACAAGACGCTGCGGCTGCGCGGCTTCAAGACGGCCTTT
TTTGCAGACTTGTCGATTGAGCGCGAAGTCGATATCCGACGCCGCGTGGCGGCTGTGTTCAACAAGGCCGAAGAC
GACTTTCAGTCACTGACTCCCTTCAACGATTATCTAGACATGGTGGAGACGCTGACGGATGAGCTTGTCAATGGC
GACGAGAATACACGGGCCAAGGCCCAGGCCAGGCTGGCGGATTGGGAGGCGCAGCATCGCGCTGATATTGAGCGC
AATAAGCGTCTGGCGCGAGAATCAGACGAGGCTCGTCAGAGGCGCCTAACTGCTGAGTCGGAAGCTGCGCGCGCC
CGGCGTCAAGCAGACTTGGCGCAAGAAGCTGCTGATCGAGCCCATGAGGCGCGTTTGCGCGAGGAAATGCTCGAT
TCACTCACCACTGCCGAGACGGGCCACGCCTCTGAAGCTCTTAATCGCGTCATGCTAAAAAAACGCGGCCAGCAC
AAGCAAGCCCCAACCGCGTCTTCCACTGCCGGCCTGTCCATTCGCGGCCTGCGCACAAAAGCCTCGTCCAATACA
TCCTCAGCCTCTGCGAATAAGCCCTACGACCCCTTTGGCGGCCTGTCCATGGCTCCCTCTCGCGTCGACGTGTCG
CTCGAGGCTCTTGGTCTCTACCATAGCGAATGGGTCGACGCGGTCCGCTCCAAGGACGAGTTTCGTGTGGGCGGC
TACTTGGCAGAGGAATACGTTGGACGCGCCCTCTTTGAGGCCTTTTCTGGCCTGGGCATCGATATTGCTGAGGAG
AAGGGCATGTCGGATTCAACAGGTGTTTCCACTGCTGGAGCTAAAGAGGTTGCGCTTACGGGCCACACGACGGCT
CAGCTTGAAGCTGCAAATGCTTGA
Transcript >OphauB2|351
ATGTCCCGCACGGCAAGCACATCCATCGACACTGAAGACGAAACATGTCCCGTGTGCAAAACGACGCGCTACTTC
AACAAGGACATGGAATTCCGCATCAACCCCGAGTGCTACCACCGCATGTGCAAGACATGCGTCGAGCGCATCTTT
CGCGACGGGCCTAACCAGTGCCCCTATGCCGGATGCCACAAGACGCTGCGGCTGCGCGGCTTCAAGACGGCCTTT
TTTGCAGACTTGTCGATTGAGCGCGAAGTCGATATCCGACGCCGCGTGGCGGCTGTGTTCAACAAGGCCGAAGAC
GACTTTCAGTCACTGACTCCCTTCAACGATTATCTAGACATGGTGGAGACGCTGACGGATGAGCTTGTCAATGGC
GACGAGAATACACGGGCCAAGGCCCAGGCCAGGCTGGCGGATTGGGAGGCGCAGCATCGCGCTGATATTGAGCGC
AATAAGCGTCTGGCGCGAGAATCAGACGAGGCTCGTCAGAGGCGCCTAACTGCTGAGTCGGAAGCTGCGCGCGCC
CGGCGTCAAGCAGACTTGGCGCAAGAAGCTGCTGATCGAGCCCATGAGGCGCGTTTGCGCGAGGAAATGCTCGAT
TCACTCACCACTGCCGAGACGGGCCACGCCTCTGAAGCTCTTAATCGCGTCATGCTAAAAAAACGCGGCCAGCAC
AAGCAAGCCCCAACCGCGTCTTCCACTGCCGGCCTGTCCATTCGCGGCCTGCGCACAAAAGCCTCGTCCAATACA
TCCTCAGCCTCTGCGAATAAGCCCTACGACCCCTTTGGCGGCCTGTCCATGGCTCCCTCTCGCGTCGACGTGTCG
CTCGAGGCTCTTGGTCTCTACCATAGCGAATGGGTCGACGCGGTCCGCTCCAAGGACGAGTTTCGTGTGGGCGGC
TACTTGGCAGAGGAATACGTTGGACGCGCCCTCTTTGAGGCCTTTTCTGGCCTGGGCATCGATATTGCTGAGGAG
AAGGGCATGTCGGATTCAACAGGTGTTTCCACTGCTGGAGCTAAAGAGGTTGCGCTTACGGGCCACACGACGGCT
CAGCTTGAAGCTGCAAATGCTTGA
Gene >OphauB2|351
ATGTCCCGCACGGCAAGCACATCCATCGACACTGAAGACGAAACATGTCCCGTGTGCAAAACGACGCGCTACTTC
AACAAGGACATGGAATTCCGCATCAACCCCGAGTGCTACCACCGCATGTGCAAGACATGCGTCGAGCGCATCTTT
CGCGACGGGCCTAACCAGTGCCCCTATGCCGGATGCCACAAGACGCTGCGGCTGCGCGGCTTCAAGACGGCCTTT
TTTGCAGACTTGTCGATTGAGCGCGAAGTCGATATCCGACGCCGCGTGGCGGCTGTGTTCAACAAGGCCGAAGAC
GACTTTCAGTCACTGACTCCCTTCAACGATTATCTAGACATGGTGGAGACGCTGACGGATGAGCTTGTCAATGGC
GACGAGAATACACGGGCCAAGGCCCAGGCCAGGCTGGCGGATTGGGAGGCGCAGCATCGCGCTGATATTGAGCGC
AATAAGCGTCTGGCGCGAGAATCAGACGAGGCTCGTCAGAGGCGCCTAACTGCTGAGTCGGAAGCTGCGCGCGCC
CGGCGTCAAGCAGACTTGGCGCAAGAAGCTGCTGATCGAGCCCATGAGGCGCGTTTGCGCGAGGAAATGCTCGAT
TCACTCACCACTGCCGAGACGGGCCACGCCTCTGAAGCTCTTAATCGCGTCATGCTAAAAAAACGCGGCCAGCAC
AAGCAAGCCCCAACCGCGTCTTCCACTGCCGGCCTGTCCATTCGCGGCCTGCGCACAAAAGCCTCGTCCAATACA
TCCTCAGCCTCTGCGAATAAGCCCTACGACCCCTTTGGCGGCCTGTCCATGGCTCCCTCTCGCGTCGACGTGTCG
CTCGAGGCTCTTGGTCTCTACCATAGCGAATGGGTCGACGCGGTCCGCTCCAAGGACGAGTTTCGTGTGGGCGGC
TACTTGGCAGAGGAATACGTTGGACGCGCCCTCTTTGAGGCCTTTTCTGGCCTGGGCATCGATATTGCTGAGGAG
AAGGGCATGTCGGATTCAACAGGTGTTTCCACTGCTGGAGCTAAAGAGGTTGCGCTTACGGGCCACACGACGGCT
CAGCTTGAAGCTGCAAATGCTTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail