Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|3497
Gene name
LocationContig_220:3229..5264
Strand+
Gene length (bp)2035
Transcript length (bp)1911
Coding sequence length (bp)1911
Protein length (aa) 637

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF03666 NPR3 Nitrogen Permease regulator of amino acid transport activity 3 2.2E-15 65 129
PF03666 NPR3 Nitrogen Permease regulator of amino acid transport activity 3 5.1E-116 127 462

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q2UBT9|NPR3_ASPOR Nitrogen permease regulator 3 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=npr3 PE=3 SV=1 8 636 1.0E-85
sp|C8VSE7|NPR3_EMENI Nitrogen permease regulator 3 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=npr3 PE=3 SV=1 52 636 1.0E-84
sp|Q1DHE5|NPR3_COCIM Nitrogen permease regulator 3 OS=Coccidioides immitis (strain RS) GN=NPR3 PE=3 SV=1 37 636 1.0E-78
sp|Q0CQ46|NPR3_ASPTN Nitrogen permease regulator 3 OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=npr3 PE=3 SV=1 60 636 2.0E-77
sp|Q4WTC7|NPR3_ASPFU Nitrogen permease regulator 3 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=npr3 PE=3 SV=2 59 474 7.0E-75
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q2UBT9|NPR3_ASPOR Nitrogen permease regulator 3 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=npr3 PE=3 SV=1 8 636 1.0E-85
sp|C8VSE7|NPR3_EMENI Nitrogen permease regulator 3 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=npr3 PE=3 SV=1 52 636 1.0E-84
sp|Q1DHE5|NPR3_COCIM Nitrogen permease regulator 3 OS=Coccidioides immitis (strain RS) GN=NPR3 PE=3 SV=1 37 636 1.0E-78
sp|Q0CQ46|NPR3_ASPTN Nitrogen permease regulator 3 OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=npr3 PE=3 SV=1 60 636 2.0E-77
sp|Q4WTC7|NPR3_ASPFU Nitrogen permease regulator 3 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=npr3 PE=3 SV=2 59 474 7.0E-75
sp|A1CQD6|NPR3_ASPCL Nitrogen permease regulator 3 OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=npr3 PE=3 SV=1 135 636 2.0E-73
sp|A1D3A0|NPR3_NEOFI Nitrogen permease regulator 3 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=npr3 PE=3 SV=1 135 474 2.0E-73
sp|A2QQ79|NPR3_ASPNC Nitrogen permease regulator 3 OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=npr3 PE=3 SV=2 128 474 9.0E-73
sp|Q0TZN8|NPR3_PHANO Nitrogen permease regulator 3 OS=Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) GN=NPR3 PE=3 SV=1 137 473 2.0E-63
sp|A3LYV8|NPR3_PICST Nitrogen permease regulator 3 OS=Scheffersomyces stipitis (strain ATCC 58785 / CBS 6054 / NBRC 10063 / NRRL Y-11545) GN=NPR3 PE=3 SV=2 61 636 4.0E-57
sp|Q5A319|NPR3_CANAL Nitrogen permease regulator 3 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=NPR3 PE=3 SV=1 71 636 2.0E-56
sp|Q6BQU8|NPR3_DEBHA Nitrogen permease regulator 3 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=NPR3 PE=3 SV=2 63 636 9.0E-52
sp|A5D9Y9|NPR3_PICGU Nitrogen permease regulator 3 OS=Meyerozyma guilliermondii (strain ATCC 6260 / CBS 566 / DSM 6381 / JCM 1539 / NBRC 10279 / NRRL Y-324) GN=NPR3 PE=3 SV=2 61 636 7.0E-50
sp|Q9HGM7|NPRL3_SCHPO Nitrogen permease regulator 3-like protein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC543.04 PE=3 SV=1 8 478 9.0E-38
sp|Q6CJJ1|NPR3_KLULA Nitrogen permease regulator 3 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=NPR3 PE=3 SV=1 62 636 1.0E-35
sp|Q750J0|NPR3_ASHGO Nitrogen permease regulator 3 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=NPR3 PE=3 SV=3 62 636 2.0E-35
sp|A5E0E7|NPR3_LODEL Nitrogen permease regulator 3 OS=Lodderomyces elongisporus (strain ATCC 11503 / CBS 2605 / JCM 1781 / NBRC 1676 / NRRL YB-4239) GN=NPR3 PE=3 SV=1 63 473 4.0E-30
sp|Q8VIJ8|NPRL3_MOUSE Nitrogen permease regulator 3-like protein OS=Mus musculus GN=Nprl3 PE=1 SV=1 71 459 4.0E-21
sp|Q12980|NPRL3_HUMAN Nitrogen permease regulator 3-like protein OS=Homo sapiens GN=NPRL3 PE=1 SV=1 4 459 3.0E-20
sp|P38742|NPR3_YEAST Nitrogen permease regulator 3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=NPR3 PE=1 SV=1 344 636 1.0E-19
sp|Q6FVA1|NPR3_CANGA Nitrogen permease regulator 3 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=NPR3 PE=3 SV=1 353 472 6.0E-15
sp|Q6FVA1|NPR3_CANGA Nitrogen permease regulator 3 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=NPR3 PE=3 SV=1 71 266 5.0E-09
sp|Q0TZN8|NPR3_PHANO Nitrogen permease regulator 3 OS=Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) GN=NPR3 PE=3 SV=1 557 636 3.0E-06
sp|Q9VUB4|NPRL3_DROME Nitrogen permease regulator 3-like protein OS=Drosophila melanogaster GN=Nprl3 PE=1 SV=1 62 453 9.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0032007 negative regulation of TOR signaling Yes
GO:1902531 regulation of intracellular signal transduction No
GO:0009966 regulation of signal transduction No
GO:0023057 negative regulation of signaling No
GO:0048585 negative regulation of response to stimulus No
GO:0048583 regulation of response to stimulus No
GO:0032006 regulation of TOR signaling No
GO:0048523 negative regulation of cellular process No
GO:0050794 regulation of cellular process No
GO:0010648 negative regulation of cell communication No
GO:0065007 biological regulation No
GO:0050789 regulation of biological process No
GO:0008150 biological_process No
GO:0023051 regulation of signaling No
GO:1902532 negative regulation of intracellular signal transduction No
GO:0048519 negative regulation of biological process No
GO:0009968 negative regulation of signal transduction No
GO:0010646 regulation of cell communication No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup985
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|7404
Ophiocordyceps australis map64 (Brazil) OphauB2|3497 (this protein)
Ophiocordyceps camponoti-floridani Ophcf2|00148
Ophiocordyceps camponoti-rufipedis Ophun1|5349
Ophiocordyceps kimflemingae Ophio5|6772
Ophiocordyceps kimflemingae Ophio5|6773
Ophiocordyceps subramaniannii Hirsu2|8089

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|3497
MAVESGSLVAVALIINRSRDGPAFVFHYPPHVPQPAEAPRDAEDVLLRRQADSDAPCVPWERVAGFPTRDLASIL
TPARSYHKALFQLSLDPLLCISYPIHVPDNGKWKKVNKHEHQLRRSSPTPRDKTKDEAPDDDKRSSMTMFNLVLM
LNPNTKHQVKELVDALYRNIVKKVNKAYKYSQQHSDFIWKESKRILAAKDKAREDGTTITTLWKEILHISSLAAS
VRDIFDSVSHNKIATLHLDTASGVLTPSLQIPAPFFASDLPPPHDQSQLGLWLTTANVFLSHDALEEPGFFDRTF
ALLIKEDEKKIISELQTDRDPATLSMIDFVRLAKPTTSFHQIGQNSALTLGQVRKYAQHFIFWRRAIAIPPLHAR
DVYIVSPNCHLARLPQACHEWQRAFPVAPPLPNFLAELSMCPKQYKLFCPSKAHRPLYLRMLAWLLRGAWVTQLC
TFAYVVVWPEIIYEVDYEMEAEELAAADAHDTGSSSSPSPPSLMPHRRPDASARPTVQQAAEKARLERIALRAQR
QAADKATAHARRIVPLATLHPSTNDAPHLAAIEPRIVLDARRATGKESRYLSAIALRLSDEKVRSAWTLMCRYFD
GRCALERIALQQDYKRKDVAAMLSAMSEYLLCTRHW*
Coding >OphauB2|3497
ATGGCCGTCGAGAGCGGCAGCCTCGTGGCCGTTGCCCTCATCATCAACCGGTCCCGCGATGGCCCGGCATTCGTC
TTCCACTACCCGCCCCATGTTCCGCAGCCGGCCGAGGCCCCCCGAGATGCCGAGGACGTGCTGCTCAGACGGCAG
GCCGACTCGGACGCGCCTTGTGTGCCGTGGGAGCGCGTCGCCGGCTTTCCCACGCGCGACCTGGCCAGCATCTTG
ACGCCAGCCCGCTCCTACCACAAGGCCCTTTTTCAGCTCTCGCTTGATCCGCTGCTGTGCATCTCGTATCCCATC
CACGTGCCCGACAATGGAAAGTGGAAAAAGGTGAACAAGCACGAGCACCAGCTCCGCCGCTCTTCGCCCACGCCT
CGAGACAAGACCAAGGACGAGGCGCCCGACGACGACAAGCGCAGCTCCATGACCATGTTCAACCTGGTGCTCATG
CTCAACCCAAACACAAAGCACCAGGTCAAGGAGCTCGTCGACGCCCTCTACCGCAACATTGTCAAAAAGGTCAAC
AAGGCCTACAAGTATAGCCAGCAGCACAGCGACTTTATCTGGAAAGAGTCGAAACGCATTCTCGCCGCCAAGGAC
AAGGCTCGTGAGGACGGCACCACCATCACCACCCTGTGGAAGGAAATCCTGCACATTTCATCTCTGGCCGCCTCG
GTCCGCGACATCTTCGACTCCGTCTCCCACAACAAGATTGCCACACTGCACCTCGACACGGCCTCGGGCGTCCTC
ACCCCTTCTCTGCAAATCCCCGCCCCCTTTTTCGCCTCGGACCTGCCGCCCCCGCATGACCAGAGCCAGCTGGGC
CTGTGGCTCACCACGGCCAATGTCTTTCTCAGCCACGACGCGCTCGAGGAACCCGGCTTCTTTGACCGCACCTTT
GCTCTCTTGATCAAGGAAGACGAGAAGAAGATCATATCGGAGCTCCAGACGGATCGAGACCCTGCCACGCTCTCC
ATGATTGACTTTGTCCGCCTGGCCAAGCCCACCACGTCCTTCCATCAGATTGGCCAGAACAGTGCCCTCACTCTG
GGCCAGGTGCGCAAGTATGCCCAGCACTTCATCTTTTGGCGCCGCGCCATTGCCATTCCCCCCTTGCACGCCCGC
GACGTCTATATTGTCTCGCCAAACTGCCACCTCGCCCGCCTGCCCCAGGCTTGCCACGAGTGGCAGCGTGCCTTT
CCGGTAGCCCCGCCACTGCCCAACTTCCTTGCTGAGCTGTCCATGTGCCCCAAGCAGTACAAGCTGTTCTGCCCG
AGCAAGGCCCATCGCCCTCTGTATCTGCGCATGCTGGCCTGGCTGCTCCGCGGCGCCTGGGTCACGCAGCTGTGC
ACCTTTGCCTACGTGGTTGTCTGGCCTGAAATCATTTACGAGGTTGACTATGAGATGGAAGCCGAAGAGCTGGCT
GCTGCCGACGCCCACGACACGGGCTCCAGCTCATCTCCATCGCCACCCAGTCTTATGCCACACCGCCGCCCCGAT
GCCAGTGCGCGCCCGACTGTCCAGCAAGCGGCCGAAAAGGCTCGTCTGGAGCGCATCGCCCTCCGCGCCCAGCGC
CAAGCCGCCGACAAGGCCACGGCCCATGCCCGCCGCATCGTCCCCCTCGCCACTCTGCACCCTAGCACAAACGAC
GCGCCGCACCTGGCCGCTATTGAACCCCGCATCGTCCTTGACGCCAGGCGCGCGACCGGAAAGGAGTCGCGCTAC
CTCTCCGCCATTGCTCTCCGTCTTTCCGACGAAAAGGTCCGCTCCGCCTGGACCCTCATGTGCCGTTATTTCGAT
GGCCGCTGTGCCCTTGAGCGCATCGCTCTTCAGCAAGATTATAAGCGCAAAGACGTTGCTGCTATGCTCTCAGCC
ATGAGTGAATACCTCCTGTGTACCAGGCACTGGTGA
Transcript >OphauB2|3497
ATGGCCGTCGAGAGCGGCAGCCTCGTGGCCGTTGCCCTCATCATCAACCGGTCCCGCGATGGCCCGGCATTCGTC
TTCCACTACCCGCCCCATGTTCCGCAGCCGGCCGAGGCCCCCCGAGATGCCGAGGACGTGCTGCTCAGACGGCAG
GCCGACTCGGACGCGCCTTGTGTGCCGTGGGAGCGCGTCGCCGGCTTTCCCACGCGCGACCTGGCCAGCATCTTG
ACGCCAGCCCGCTCCTACCACAAGGCCCTTTTTCAGCTCTCGCTTGATCCGCTGCTGTGCATCTCGTATCCCATC
CACGTGCCCGACAATGGAAAGTGGAAAAAGGTGAACAAGCACGAGCACCAGCTCCGCCGCTCTTCGCCCACGCCT
CGAGACAAGACCAAGGACGAGGCGCCCGACGACGACAAGCGCAGCTCCATGACCATGTTCAACCTGGTGCTCATG
CTCAACCCAAACACAAAGCACCAGGTCAAGGAGCTCGTCGACGCCCTCTACCGCAACATTGTCAAAAAGGTCAAC
AAGGCCTACAAGTATAGCCAGCAGCACAGCGACTTTATCTGGAAAGAGTCGAAACGCATTCTCGCCGCCAAGGAC
AAGGCTCGTGAGGACGGCACCACCATCACCACCCTGTGGAAGGAAATCCTGCACATTTCATCTCTGGCCGCCTCG
GTCCGCGACATCTTCGACTCCGTCTCCCACAACAAGATTGCCACACTGCACCTCGACACGGCCTCGGGCGTCCTC
ACCCCTTCTCTGCAAATCCCCGCCCCCTTTTTCGCCTCGGACCTGCCGCCCCCGCATGACCAGAGCCAGCTGGGC
CTGTGGCTCACCACGGCCAATGTCTTTCTCAGCCACGACGCGCTCGAGGAACCCGGCTTCTTTGACCGCACCTTT
GCTCTCTTGATCAAGGAAGACGAGAAGAAGATCATATCGGAGCTCCAGACGGATCGAGACCCTGCCACGCTCTCC
ATGATTGACTTTGTCCGCCTGGCCAAGCCCACCACGTCCTTCCATCAGATTGGCCAGAACAGTGCCCTCACTCTG
GGCCAGGTGCGCAAGTATGCCCAGCACTTCATCTTTTGGCGCCGCGCCATTGCCATTCCCCCCTTGCACGCCCGC
GACGTCTATATTGTCTCGCCAAACTGCCACCTCGCCCGCCTGCCCCAGGCTTGCCACGAGTGGCAGCGTGCCTTT
CCGGTAGCCCCGCCACTGCCCAACTTCCTTGCTGAGCTGTCCATGTGCCCCAAGCAGTACAAGCTGTTCTGCCCG
AGCAAGGCCCATCGCCCTCTGTATCTGCGCATGCTGGCCTGGCTGCTCCGCGGCGCCTGGGTCACGCAGCTGTGC
ACCTTTGCCTACGTGGTTGTCTGGCCTGAAATCATTTACGAGGTTGACTATGAGATGGAAGCCGAAGAGCTGGCT
GCTGCCGACGCCCACGACACGGGCTCCAGCTCATCTCCATCGCCACCCAGTCTTATGCCACACCGCCGCCCCGAT
GCCAGTGCGCGCCCGACTGTCCAGCAAGCGGCCGAAAAGGCTCGTCTGGAGCGCATCGCCCTCCGCGCCCAGCGC
CAAGCCGCCGACAAGGCCACGGCCCATGCCCGCCGCATCGTCCCCCTCGCCACTCTGCACCCTAGCACAAACGAC
GCGCCGCACCTGGCCGCTATTGAACCCCGCATCGTCCTTGACGCCAGGCGCGCGACCGGAAAGGAGTCGCGCTAC
CTCTCCGCCATTGCTCTCCGTCTTTCCGACGAAAAGGTCCGCTCCGCCTGGACCCTCATGTGCCGTTATTTCGAT
GGCCGCTGTGCCCTTGAGCGCATCGCTCTTCAGCAAGATTATAAGCGCAAAGACGTTGCTGCTATGCTCTCAGCC
ATGAGTGAATACCTCCTGTGTACCAGGCACTGGTGA
Gene >OphauB2|3497
ATGGCCGTCGAGAGCGGCAGCCTCGTGGCCGTTGCCCTCATCATCAACCGGTCCCGCGATGGCCCGGCATTCGTC
TTCCACTACCCGCCCCATGTTCCGCAGCCGGCCGAGGCCCCCCGAGATGCCGAGGACGTGCTGCTCAGACGGCAG
GCCGACTCGGACGCGCCTTGTGTGCCGTGGGAGCGCGTCGCCGGCTTTCCCACGCGCGACCTGGCCAGCATCTTG
ACGCCAGCCCGCTCCTACCACAAGGCCCTTTTTCAGCTCTCGCTTGATCCGCTGCTGTGCATCTCGTATCCCATC
CACGTGCCCGACAATGGAAAGTGGAAAAAGGTGAACAAGCACGAGCACCAGCTCCGCCGCTCTTCGCCCACGCCT
CGAGACAAGACCAAGGACGAGGCGCCCGACGACGACAAGCGCAGCTCCATGACCATGTTCAACCTGGTGCTCATG
CTCAACCCAAACACAAAGCACCAGGTCAAGGAGCTCGTCGACGCCCTCTACCGCAACATTGTCAAAAAGGTCAAC
AAGGCCTACAAGTATAGCCAGCAGCACAGCGACTTTATCTGGAAAGAGTCGAAACGCATTCTCGCCGCCAAGGAC
AAGGCTCGTGAGGACGGCAAGTGGCGTGCCTTCCCCCTTGTTGTGCTCATGGCCTCGTGCTCATGACCCACTCTT
GCAGGCACCACCATCACCACCCTGTGGAAGGAAATCCTGCACATTTCATCTCTGGCCGCCTCGGTCCGCGACATC
TTCGACTCCGTCTCCCACAACAAGATTGCCACACTGCACCTCGACACGGCCTCGGGCGTCCTCACCCCTTCTCTG
CAAATCCCCGCCCCCTTTTTCGCCTCGGACCTGCCGCCCCCGCATGACCAGAGCCAGCTGGGCCTGTGGCTCACC
ACGGCCAATGTCTTTCTCAGCCACGACGCGCTCGAGGAACCCGGCTTCTTTGACCGCACCTTTGCTCTCTTGATC
AAGGAAGACGAGAAGAAGATCATATCGGAGCTCCAGACGGATCGAGACCCTGCCACGCTCTCCATGATTGACTTT
GTCCGCCTGGCCAAGCCCACCACGTCGTCTGTCTCCCTTGTCGAGCCGTGGCTGTGCAGCTGGGTGCTGATTCTT
CTTCTCTCCCAGCTTCCATCAGATTGGCCAGAACAGTGCCCTCACTCTGGGCCAGGTGCGCAAGTATGCCCAGCA
CTTCATCTTTTGGCGCCGCGCCATTGCCATTCCCCCCTTGCACGCCCGCGACGTCTATATTGTCTCGCCAAACTG
CCACCTCGCCCGCCTGCCCCAGGCTTGCCACGAGTGGCAGCGTGCCTTTCCGGTAGCCCCGCCACTGCCCAACTT
CCTTGCTGAGCTGTCCATGTGCCCCAAGCAGTACAAGCTGTTCTGCCCGAGCAAGGCCCATCGCCCTCTGTATCT
GCGCATGCTGGCCTGGCTGCTCCGCGGCGCCTGGGTCACGCAGCTGTGCACCTTTGCCTACGTGGTTGTCTGGCC
TGAAATCATTTACGAGGTTGACTATGAGATGGAAGCCGAAGAGCTGGCTGCTGCCGACGCCCACGACACGGGCTC
CAGCTCATCTCCATCGCCACCCAGTCTTATGCCACACCGCCGCCCCGATGCCAGTGCGCGCCCGACTGTCCAGCA
AGCGGCCGAAAAGGCTCGTCTGGAGCGCATCGCCCTCCGCGCCCAGCGCCAAGCCGCCGACAAGGCCACGGCCCA
TGCCCGCCGCATCGTCCCCCTCGCCACTCTGCACCCTAGCACAAACGACGCGCCGCACCTGGCCGCTATTGAACC
CCGCATCGTCCTTGACGCCAGGCGCGCGACCGGAAAGGAGTCGCGCTACCTCTCCGCCATTGCTCTCCGTCTTTC
CGACGAAAAGGTCCGCTCCGCCTGGACCCTCATGTGCCGTTATTTCGATGGCCGCTGTGCCCTTGAGCGCATCGC
TCTTCAGCAAGATTATAAGCGCAAAGACGTTGCTGCTATGCTCTCAGCCATGAGTGAATACCTCCTGTGTACCAG
GCACTGGTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail