Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|3496
Gene name
LocationContig_220:1177..2435
Strand-
Gene length (bp)1258
Transcript length (bp)1203
Coding sequence length (bp)1203
Protein length (aa) 401

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01633 Choline_kinase Choline/ethanolamine kinase 1.8E-46 78 298
PF01636 APH Phosphotransferase enzyme family 6.9E-09 94 284
PF02958 EcKL Ecdysteroid kinase-like family 2.5E-05 139 281

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9HBU6|EKI1_HUMAN Ethanolamine kinase 1 OS=Homo sapiens GN=ETNK1 PE=1 SV=1 26 377 9.0E-55
sp|A7SK27|EKI_NEMVE Probable ethanolamine kinase OS=Nematostella vectensis GN=etnk PE=3 SV=1 13 375 5.0E-54
sp|Q9D4V0|EKI1_MOUSE Ethanolamine kinase 1 OS=Mus musculus GN=Etnk1 PE=1 SV=2 25 377 3.0E-53
sp|A7MCT6|EKI2_MOUSE Ethanolamine kinase 2 OS=Mus musculus GN=Etnk2 PE=1 SV=1 13 390 1.0E-51
sp|D3ZRW8|EKI2_RAT Ethanolamine kinase 2 OS=Rattus norvegicus GN=Etnk2 PE=3 SV=1 21 390 4.0E-51
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9HBU6|EKI1_HUMAN Ethanolamine kinase 1 OS=Homo sapiens GN=ETNK1 PE=1 SV=1 26 377 9.0E-55
sp|A7SK27|EKI_NEMVE Probable ethanolamine kinase OS=Nematostella vectensis GN=etnk PE=3 SV=1 13 375 5.0E-54
sp|Q9D4V0|EKI1_MOUSE Ethanolamine kinase 1 OS=Mus musculus GN=Etnk1 PE=1 SV=2 25 377 3.0E-53
sp|A7MCT6|EKI2_MOUSE Ethanolamine kinase 2 OS=Mus musculus GN=Etnk2 PE=1 SV=1 13 390 1.0E-51
sp|D3ZRW8|EKI2_RAT Ethanolamine kinase 2 OS=Rattus norvegicus GN=Etnk2 PE=3 SV=1 21 390 4.0E-51
sp|Q9NVF9|EKI2_HUMAN Ethanolamine kinase 2 OS=Homo sapiens GN=ETNK2 PE=2 SV=3 13 390 9.0E-49
sp|P54352|EAS_DROME Ethanolamine kinase OS=Drosophila melanogaster GN=eas PE=1 SV=2 78 377 3.0E-47
sp|O81024|EKI_ARATH Probable ethanolamine kinase OS=Arabidopsis thaliana GN=EMB1187 PE=2 SV=1 30 371 6.0E-43
sp|Q9SZ92|CK3_ARATH Probable choline kinase 3 OS=Arabidopsis thaliana GN=At4g09760 PE=2 SV=1 72 375 7.0E-37
sp|Q8L518|CK2_ARATH Probable choline kinase 2 OS=Arabidopsis thaliana GN=At1g74320 PE=2 SV=1 27 375 4.0E-35
sp|Q869T9|EKIA_DICDI Probable ethanolamine kinase A OS=Dictyostelium discoideum GN=etnkA PE=3 SV=1 36 372 1.0E-34
sp|Q9M9H6|CK1_ARATH Probable choline kinase 1 OS=Arabidopsis thaliana GN=CK1 PE=2 SV=1 30 375 3.0E-33
sp|Q9Y259|CHKB_HUMAN Choline/ethanolamine kinase OS=Homo sapiens GN=CHKB PE=1 SV=3 53 377 3.0E-26
sp|Q01134|CHKA_RAT Choline kinase alpha OS=Rattus norvegicus GN=Chka PE=1 SV=2 43 375 5.0E-23
sp|O54783|CHKB_RAT Choline/ethanolamine kinase OS=Rattus norvegicus GN=Chkb PE=1 SV=3 53 377 9.0E-23
sp|O55229|CHKB_MOUSE Choline/ethanolamine kinase OS=Mus musculus GN=Chkb PE=1 SV=3 53 381 1.0E-22
sp|O54804|CHKA_MOUSE Choline kinase alpha OS=Mus musculus GN=Chka PE=1 SV=3 43 375 3.0E-21
sp|Q03764|EKI1_YEAST Ethanolamine kinase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=EKI1 PE=1 SV=1 37 351 2.0E-20
sp|P35790|CHKA_HUMAN Choline kinase alpha OS=Homo sapiens GN=CHKA PE=1 SV=3 43 375 3.0E-20
sp|Q22942|CKA2_CAEEL Choline kinase A2 OS=Caenorhabditis elegans GN=cka-2 PE=1 SV=2 46 375 1.0E-18
sp|Q554D8|EKIB_DICDI Probable ethanolamine kinase B OS=Dictyostelium discoideum GN=etnkB PE=3 SV=1 55 155 4.0E-11
sp|Q554D8|EKIB_DICDI Probable ethanolamine kinase B OS=Dictyostelium discoideum GN=etnkB PE=3 SV=1 232 371 4.0E-10
sp|P20485|KICH_YEAST Choline kinase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CKI1 PE=1 SV=1 263 351 8.0E-08
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 45 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|3496
MATPAANDSHGHVRFISLRYDNADSRRSALKLVLTLVPQWAVDEAHIDLVRFTDGITNTLLKAVNRRPGLSETDM
DRDAILLRAYGNGTDVLIDREREAANHELLMRHGLAPELLARFANGMLYRFIPGVVAQPKDLCDAQVMTAVARHL
AQWHATVPCLPDAPTKVAVDGVERAKIVNAAPGKPFPNTWTTMQKWILALPAKTDAQRQRRDVLQHELDELIGNL
SQRPGLGENGLVFAHCDLLSANVIIHGDGGDAPTVSFIDYEYGTPSPVAFDLANHFAEWAGYDCDYAAVPKRAQR
LAFIREYIKAYARLSGAEMREEDEVKKLMDQVDAFRGVPGFYWGIWSLIQATISYIKFDYAAYAESRLGEYWAYK
AEQDGSREAAGKEMPLREKTWASCK*
Coding >OphauB2|3496
ATGGCGACACCTGCCGCCAATGACAGCCATGGCCATGTACGCTTCATTTCGCTGCGTTATGACAATGCCGACTCG
CGCCGCTCTGCCCTCAAACTCGTCCTCACTCTTGTGCCGCAGTGGGCCGTTGACGAGGCACATATCGACCTTGTA
CGGTTTACAGATGGCATCACAAACACGCTGCTCAAGGCGGTCAACCGCCGCCCCGGCCTGTCAGAGACGGACATG
GACCGTGATGCAATTCTGCTACGTGCCTATGGAAACGGCACCGATGTGCTCATTGACCGCGAACGCGAAGCTGCC
AACCATGAGCTTCTCATGCGCCATGGCCTTGCCCCTGAGTTGCTGGCTCGCTTCGCCAATGGCATGCTTTACCGC
TTTATCCCCGGCGTGGTGGCCCAGCCAAAGGACCTTTGTGACGCGCAAGTCATGACAGCCGTCGCTCGACACCTG
GCACAATGGCACGCCACGGTTCCTTGCCTGCCTGATGCCCCCACCAAGGTGGCTGTTGACGGTGTCGAGCGGGCA
AAGATTGTCAATGCGGCCCCAGGCAAGCCTTTTCCCAATACGTGGACGACGATGCAAAAGTGGATCTTGGCACTC
CCAGCAAAAACGGACGCTCAACGCCAGCGCAGGGACGTTTTGCAGCACGAGCTTGATGAGCTGATTGGAAATCTC
AGCCAGCGTCCCGGGCTTGGGGAAAATGGGCTCGTCTTTGCGCACTGCGACTTGCTCAGTGCCAACGTGATTATA
CATGGCGACGGCGGAGACGCGCCCACTGTCAGCTTCATCGACTACGAATACGGCACTCCGTCGCCCGTAGCCTTT
GACTTGGCCAACCACTTTGCCGAATGGGCTGGCTACGACTGCGACTACGCGGCAGTCCCGAAGCGTGCGCAGCGC
CTTGCCTTTATCCGCGAGTACATCAAGGCGTATGCCCGGCTTTCTGGTGCCGAAATGAGGGAGGAAGACGAGGTT
AAAAAGCTCATGGACCAAGTGGACGCTTTTCGCGGAGTCCCTGGCTTCTACTGGGGCATCTGGTCTCTCATCCAG
GCCACCATTTCGTACATCAAGTTTGACTATGCAGCGTACGCAGAATCGCGCCTGGGCGAATACTGGGCTTACAAG
GCGGAGCAGGATGGCAGCCGGGAAGCAGCGGGCAAGGAGATGCCGCTGAGAGAAAAGACGTGGGCAAGTTGCAAG
TAG
Transcript >OphauB2|3496
ATGGCGACACCTGCCGCCAATGACAGCCATGGCCATGTACGCTTCATTTCGCTGCGTTATGACAATGCCGACTCG
CGCCGCTCTGCCCTCAAACTCGTCCTCACTCTTGTGCCGCAGTGGGCCGTTGACGAGGCACATATCGACCTTGTA
CGGTTTACAGATGGCATCACAAACACGCTGCTCAAGGCGGTCAACCGCCGCCCCGGCCTGTCAGAGACGGACATG
GACCGTGATGCAATTCTGCTACGTGCCTATGGAAACGGCACCGATGTGCTCATTGACCGCGAACGCGAAGCTGCC
AACCATGAGCTTCTCATGCGCCATGGCCTTGCCCCTGAGTTGCTGGCTCGCTTCGCCAATGGCATGCTTTACCGC
TTTATCCCCGGCGTGGTGGCCCAGCCAAAGGACCTTTGTGACGCGCAAGTCATGACAGCCGTCGCTCGACACCTG
GCACAATGGCACGCCACGGTTCCTTGCCTGCCTGATGCCCCCACCAAGGTGGCTGTTGACGGTGTCGAGCGGGCA
AAGATTGTCAATGCGGCCCCAGGCAAGCCTTTTCCCAATACGTGGACGACGATGCAAAAGTGGATCTTGGCACTC
CCAGCAAAAACGGACGCTCAACGCCAGCGCAGGGACGTTTTGCAGCACGAGCTTGATGAGCTGATTGGAAATCTC
AGCCAGCGTCCCGGGCTTGGGGAAAATGGGCTCGTCTTTGCGCACTGCGACTTGCTCAGTGCCAACGTGATTATA
CATGGCGACGGCGGAGACGCGCCCACTGTCAGCTTCATCGACTACGAATACGGCACTCCGTCGCCCGTAGCCTTT
GACTTGGCCAACCACTTTGCCGAATGGGCTGGCTACGACTGCGACTACGCGGCAGTCCCGAAGCGTGCGCAGCGC
CTTGCCTTTATCCGCGAGTACATCAAGGCGTATGCCCGGCTTTCTGGTGCCGAAATGAGGGAGGAAGACGAGGTT
AAAAAGCTCATGGACCAAGTGGACGCTTTTCGCGGAGTCCCTGGCTTCTACTGGGGCATCTGGTCTCTCATCCAG
GCCACCATTTCGTACATCAAGTTTGACTATGCAGCGTACGCAGAATCGCGCCTGGGCGAATACTGGGCTTACAAG
GCGGAGCAGGATGGCAGCCGGGAAGCAGCGGGCAAGGAGATGCCGCTGAGAGAAAAGACGTGGGCAAGTTGCAAG
TAG
Gene >OphauB2|3496
ATGGCGACACCTGCCGCCAATGACAGCCATGGCCATGTACGCTTCATTTCGCTGCGTTATGACAATGCCGACTCG
CGCCGCTCTGCCCTCAAACTCGTCCTCACTCTTGTGCCGCAGTGGGCCGTTGACGAGGCACATATCGACCTTGTA
CGGTTTACAGATGGCATCACAAACACGCTGCTCAAGGCGGTCAACCGCCGCCCCGGCCTGTCAGAGACGGACATG
GACCGTGATGCAATTCTGCTACGTGCCTATGGAAACGGCACCGATGTGCTCATTGACCGCGAACGCGAAGCTGCC
AACCATGAGCTTCTCATGCGCCATGGCCTTGCCCCTGAGTTGCTGGCTCGCTTCGCCAATGGCATGCTTTACCGC
TTTATCCCCGGCGTGGTGGCCCAGCCAAAGGACCTTTGTGACGCGCAAGTCATGACAGCCGTCGCTCGACACCTG
GCACAATGGCACGCCACGGTTCCTTGCCTGCCTGATGCCCCCACCAAGGTGGCTGTTGACGGTGTCGAGCGGGCA
AAGATTGTCAATGCGGCCCCAGGCAAGCCTTTTCCCAATACGTGGACGACGATGCAAAAGTGGATCTTGGCACTC
CCAGCAAAAACGGACGCTCAACGCCAGCGCAGGGACGTTTTGCAGCACGAGCTTGATGAGCTGATTGGAAATCTC
AGCCAGCGTCCCGGGCTTGGGGAAAATGGGGTCAGTTGACACCATGAGGGGACTGGGCAAGACCAACTGACGTCT
GAAACTGCAGCTCGTCTTTGCGCACTGCGACTTGCTCAGTGCCAACGTGATTATACATGGCGACGGCGGAGACGC
GCCCACTGTCAGCTTCATCGACTACGAATACGGCACTCCGTCGCCCGTAGCCTTTGACTTGGCCAACCACTTTGC
CGAATGGGCTGGCTACGACTGCGACTACGCGGCAGTCCCGAAGCGTGCGCAGCGCCTTGCCTTTATCCGCGAGTA
CATCAAGGCGTATGCCCGGCTTTCTGGTGCCGAAATGAGGGAGGAAGACGAGGTTAAAAAGCTCATGGACCAAGT
GGACGCTTTTCGCGGAGTCCCTGGCTTCTACTGGGGCATCTGGTCTCTCATCCAGGCCACCATTTCGTACATCAA
GTTTGACTATGCAGCGTACGCAGAATCGCGCCTGGGCGAATACTGGGCTTACAAGGCGGAGCAGGATGGCAGCCG
GGAAGCAGCGGGCAAGGAGATGCCGCTGAGAGAAAAGACGTGGGCAAGTTGCAAGTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail