Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|3471
Gene name
LocationContig_22:140324..141714
Strand+
Gene length (bp)1390
Transcript length (bp)1338
Coding sequence length (bp)1338
Protein length (aa) 446

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF04427 Brix Brix domain 2.8E-46 42 343

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O14206|YDD3_SCHPO Brix domain-containing protein C1B9.03c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC1B9.03c PE=1 SV=2 1 391 4.0E-93
sp|P38789|SSF1_YEAST Ribosome biogenesis protein SSF1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SSF1 PE=1 SV=1 1 413 8.0E-82
sp|Q12153|SSF2_YEAST Ribosome biogenesis protein SSF2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SSF2 PE=1 SV=1 1 407 4.0E-81
sp|Q5REM3|SSF1_PONAB Suppressor of SWI4 1 homolog OS=Pongo abelii GN=PPAN PE=2 SV=1 2 411 2.0E-57
sp|Q9NQ55|SSF1_HUMAN Suppressor of SWI4 1 homolog OS=Homo sapiens GN=PPAN PE=2 SV=1 2 402 2.0E-57
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O14206|YDD3_SCHPO Brix domain-containing protein C1B9.03c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC1B9.03c PE=1 SV=2 1 391 4.0E-93
sp|P38789|SSF1_YEAST Ribosome biogenesis protein SSF1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SSF1 PE=1 SV=1 1 413 8.0E-82
sp|Q12153|SSF2_YEAST Ribosome biogenesis protein SSF2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SSF2 PE=1 SV=1 1 407 4.0E-81
sp|Q5REM3|SSF1_PONAB Suppressor of SWI4 1 homolog OS=Pongo abelii GN=PPAN PE=2 SV=1 2 411 2.0E-57
sp|Q9NQ55|SSF1_HUMAN Suppressor of SWI4 1 homolog OS=Homo sapiens GN=PPAN PE=2 SV=1 2 402 2.0E-57
sp|Q91YU8|SSF1_MOUSE Suppressor of SWI4 1 homolog OS=Mus musculus GN=Ppan PE=1 SV=2 2 399 9.0E-54
sp|Q54N44|PPAN_DICDI Peter Pan-like protein OS=Dictyostelium discoideum GN=ppan PE=3 SV=1 31 414 1.0E-48
sp|Q9ASU7|PPAN_ARATH Peter Pan-like protein OS=Arabidopsis thaliana GN=PPAN PE=1 SV=1 30 358 3.0E-48
sp|Q9VDE5|PPAN_DROME Protein Peter pan OS=Drosophila melanogaster GN=ppan PE=1 SV=1 7 415 6.0E-41
sp|Q6FNN7|IMP4_CANGA U3 small nucleolar ribonucleoprotein protein IMP4 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=IMP4 PE=3 SV=1 12 220 1.0E-07
[Show less]

GO

GO Term Description Terminal node
GO:0019843 rRNA binding Yes
GO:0006364 rRNA processing Yes
GO:0097159 organic cyclic compound binding No
GO:0043170 macromolecule metabolic process No
GO:0006725 cellular aromatic compound metabolic process No
GO:0008150 biological_process No
GO:0005488 binding No
GO:0003674 molecular_function No
GO:0006396 RNA processing No
GO:0034641 cellular nitrogen compound metabolic process No
GO:0003723 RNA binding No
GO:0006807 nitrogen compound metabolic process No
GO:1901360 organic cyclic compound metabolic process No
GO:0090304 nucleic acid metabolic process No
GO:0006139 nucleobase-containing compound metabolic process No
GO:0034470 ncRNA processing No
GO:1901363 heterocyclic compound binding No
GO:0016072 rRNA metabolic process No
GO:0071704 organic substance metabolic process No
GO:0044237 cellular metabolic process No
GO:0008152 metabolic process No
GO:0009987 cellular process No
GO:0044238 primary metabolic process No
GO:0003676 nucleic acid binding No
GO:0046483 heterocycle metabolic process No
GO:0034660 ncRNA metabolic process No
GO:0016070 RNA metabolic process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 12 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|3471
MARRRTKKRTHAGANNAQPASAGHASIRDPKSMVIRIGAGEVGSSISQLATDVRRVMEPGTASRLKERRGNKLKD
YAVMCGPLGVTHLLLFSRSQGGNTNLRVAATPRGPTMHFRVDKYALCKDVQRTQRHPRGGGKEFLTPPLLVMDGF
TTPHATAKSKVPKHLESLATTVFRSLFPPINPQTTPIKSIRRVLILKREQSCPDDGTFILNFRHYAITTKPADAS
RPLRRLNAAEKLMTTKTSRHSKMPNLGKLQDIADYMIGGDNGDGYMTDMTSGSEPDTDAEVEVLGTSHKKISSAK
ARQAAAQDDDEDAAAQDGEEENVERLRVKLVELGPRMRLRLTKVEEGLCEGKIMWHEYVHKTQQQVKELDKRWEK
KRQEKEARRREQKANVERKKAAKEQVRGDGGDDDGDDDDYSDMDVDDLDSEGLAGDGEFLVNEEVENKGE*
Coding >OphauB2|3471
ATGGCACGCAGACGGACAAAAAAGCGCACCCACGCCGGGGCCAACAACGCTCAGCCCGCCTCTGCCGGCCATGCA
TCCATACGCGACCCCAAGTCCATGGTGATTCGCATTGGCGCAGGCGAAGTCGGCTCCAGCATCAGCCAACTAGCC
ACCGACGTGCGCCGCGTCATGGAGCCCGGCACGGCAAGCCGGCTCAAGGAGCGCCGGGGCAACAAACTCAAGGAC
TATGCCGTCATGTGCGGCCCGCTTGGAGTGACGCATCTGCTGCTCTTTTCGCGCTCACAAGGCGGAAATACAAAT
CTGCGAGTGGCGGCGACGCCTCGCGGGCCGACGATGCATTTCCGCGTCGACAAGTATGCGCTGTGCAAAGACGTC
CAGCGGACGCAGCGGCATCCTCGCGGTGGAGGAAAGGAGTTTTTGACGCCGCCTTTGCTCGTCATGGACGGCTTC
ACCACGCCCCATGCTACTGCCAAGTCAAAGGTGCCCAAGCATCTAGAGTCGCTGGCCACCACGGTCTTTCGCTCC
TTGTTTCCGCCTATTAATCCGCAGACGACACCCATCAAGTCAATACGCAGAGTGCTTATTCTCAAGCGCGAGCAG
TCTTGCCCCGACGACGGCACCTTTATCCTTAATTTCAGACACTATGCAATCACCACCAAGCCTGCAGACGCGTCA
CGCCCGCTCCGCCGCCTCAATGCCGCTGAGAAGCTCATGACGACCAAGACGAGTCGCCACAGCAAAATGCCCAAT
CTCGGCAAGTTGCAGGACATTGCAGATTACATGATTGGCGGCGACAATGGCGACGGCTACATGACAGACATGACG
AGCGGCAGTGAGCCCGACACGGACGCCGAGGTGGAAGTCTTGGGCACGTCGCACAAGAAGATTTCATCGGCCAAG
GCTCGCCAAGCCGCAGCACAAGACGACGACGAAGACGCCGCCGCCCAAGACGGCGAGGAGGAAAACGTGGAGCGC
CTGCGCGTCAAACTGGTTGAGCTGGGTCCGCGCATGCGACTACGCCTAACAAAGGTGGAGGAAGGCCTGTGTGAG
GGCAAAATTATGTGGCATGAATACGTGCACAAGACGCAGCAGCAGGTCAAGGAGCTGGACAAGCGGTGGGAAAAG
AAGAGACAGGAAAAGGAAGCGCGGCGCAGAGAGCAAAAGGCCAATGTGGAGAGGAAAAAGGCGGCCAAGGAGCAG
GTGCGAGGAGATGGTGGTGACGACGACGGCGACGATGACGATTATAGCGATATGGATGTGGACGACTTGGACAGC
GAGGGGCTGGCGGGCGATGGCGAGTTTTTGGTGAATGAAGAGGTGGAGAACAAGGGGGAGTGA
Transcript >OphauB2|3471
ATGGCACGCAGACGGACAAAAAAGCGCACCCACGCCGGGGCCAACAACGCTCAGCCCGCCTCTGCCGGCCATGCA
TCCATACGCGACCCCAAGTCCATGGTGATTCGCATTGGCGCAGGCGAAGTCGGCTCCAGCATCAGCCAACTAGCC
ACCGACGTGCGCCGCGTCATGGAGCCCGGCACGGCAAGCCGGCTCAAGGAGCGCCGGGGCAACAAACTCAAGGAC
TATGCCGTCATGTGCGGCCCGCTTGGAGTGACGCATCTGCTGCTCTTTTCGCGCTCACAAGGCGGAAATACAAAT
CTGCGAGTGGCGGCGACGCCTCGCGGGCCGACGATGCATTTCCGCGTCGACAAGTATGCGCTGTGCAAAGACGTC
CAGCGGACGCAGCGGCATCCTCGCGGTGGAGGAAAGGAGTTTTTGACGCCGCCTTTGCTCGTCATGGACGGCTTC
ACCACGCCCCATGCTACTGCCAAGTCAAAGGTGCCCAAGCATCTAGAGTCGCTGGCCACCACGGTCTTTCGCTCC
TTGTTTCCGCCTATTAATCCGCAGACGACACCCATCAAGTCAATACGCAGAGTGCTTATTCTCAAGCGCGAGCAG
TCTTGCCCCGACGACGGCACCTTTATCCTTAATTTCAGACACTATGCAATCACCACCAAGCCTGCAGACGCGTCA
CGCCCGCTCCGCCGCCTCAATGCCGCTGAGAAGCTCATGACGACCAAGACGAGTCGCCACAGCAAAATGCCCAAT
CTCGGCAAGTTGCAGGACATTGCAGATTACATGATTGGCGGCGACAATGGCGACGGCTACATGACAGACATGACG
AGCGGCAGTGAGCCCGACACGGACGCCGAGGTGGAAGTCTTGGGCACGTCGCACAAGAAGATTTCATCGGCCAAG
GCTCGCCAAGCCGCAGCACAAGACGACGACGAAGACGCCGCCGCCCAAGACGGCGAGGAGGAAAACGTGGAGCGC
CTGCGCGTCAAACTGGTTGAGCTGGGTCCGCGCATGCGACTACGCCTAACAAAGGTGGAGGAAGGCCTGTGTGAG
GGCAAAATTATGTGGCATGAATACGTGCACAAGACGCAGCAGCAGGTCAAGGAGCTGGACAAGCGGTGGGAAAAG
AAGAGACAGGAAAAGGAAGCGCGGCGCAGAGAGCAAAAGGCCAATGTGGAGAGGAAAAAGGCGGCCAAGGAGCAG
GTGCGAGGAGATGGTGGTGACGACGACGGCGACGATGACGATTATAGCGATATGGATGTGGACGACTTGGACAGC
GAGGGGCTGGCGGGCGATGGCGAGTTTTTGGTGAATGAAGAGGTGGAGAACAAGGGGGAGTGA
Gene >OphauB2|3471
ATGGCACGCAGACGGACAAAAAAGCGCACCCACGCCGGGGCCAACAACGCTCAGCCCGCCTCTGCCGGCCATGCA
TCCATACGCGACCCCAAGTCCATGGTGATTCGCATTGGCGCAGGCGAAGTCGGCTCCAGCATCAGCCAACTAGCC
ACCGACGTGCGCCGCGTCATGGAGCCCGGCACGGCAAGCCGGCTCAAGGAGCGCCGGGGCAACAAACTCAAGGAC
TATGCCGTCATGTGCGGCCCGCTTGGAGTGACGCATCTGCTGCTCTTTTCGCGCTCACAAGGCGGAAATACAAAT
CTGCGAGTGGCGGCGACGCCTCGCGGGCCGACGATGCATTTCCGCGTCGACAAGTATGCGCTGTGCAAAGACGTC
CAGCGGACGCAGCGGCATCCTCGCGGTGGAGGAAAGGAGTTTTTGACGCCGCCTTTGGTAGGGCTTGCAAAGTTG
CTCTTGATGCTTGGCTCTGCTGACGCCGACCCAGCTCGTCATGGACGGCTTCACCACGCCCCATGCTACTGCCAA
GTCAAAGGTGCCCAAGCATCTAGAGTCGCTGGCCACCACGGTCTTTCGCTCCTTGTTTCCGCCTATTAATCCGCA
GACGACACCCATCAAGTCAATACGCAGAGTGCTTATTCTCAAGCGCGAGCAGTCTTGCCCCGACGACGGCACCTT
TATCCTTAATTTCAGACACTATGCAATCACCACCAAGCCTGCAGACGCGTCACGCCCGCTCCGCCGCCTCAATGC
CGCTGAGAAGCTCATGACGACCAAGACGAGTCGCCACAGCAAAATGCCCAATCTCGGCAAGTTGCAGGACATTGC
AGATTACATGATTGGCGGCGACAATGGCGACGGCTACATGACAGACATGACGAGCGGCAGTGAGCCCGACACGGA
CGCCGAGGTGGAAGTCTTGGGCACGTCGCACAAGAAGATTTCATCGGCCAAGGCTCGCCAAGCCGCAGCACAAGA
CGACGACGAAGACGCCGCCGCCCAAGACGGCGAGGAGGAAAACGTGGAGCGCCTGCGCGTCAAACTGGTTGAGCT
GGGTCCGCGCATGCGACTACGCCTAACAAAGGTGGAGGAAGGCCTGTGTGAGGGCAAAATTATGTGGCATGAATA
CGTGCACAAGACGCAGCAGCAGGTCAAGGAGCTGGACAAGCGGTGGGAAAAGAAGAGACAGGAAAAGGAAGCGCG
GCGCAGAGAGCAAAAGGCCAATGTGGAGAGGAAAAAGGCGGCCAAGGAGCAGGTGCGAGGAGATGGTGGTGACGA
CGACGGCGACGATGACGATTATAGCGATATGGATGTGGACGACTTGGACAGCGAGGGGCTGGCGGGCGATGGCGA
GTTTTTGGTGAATGAAGAGGTGGAGAACAAGGGGGAGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail