Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|3470
Gene name
LocationContig_22:138361..140076
Strand-
Gene length (bp)1715
Transcript length (bp)1608
Coding sequence length (bp)1608
Protein length (aa) 536

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00270 DEAD DEAD/DEAH box helicase 2.6E-46 69 235
PF00271 Helicase_C Helicase conserved C-terminal domain 7.3E-31 275 380
PF04851 ResIII Type III restriction enzyme, res subunit 9.9E-05 89 229

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q4IFI0|RRP3_GIBZE ATP-dependent rRNA helicase RRP3 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=RRP3 PE=3 SV=1 1 445 0.0E+00
sp|A7EML8|RRP3_SCLS1 ATP-dependent rRNA helicase rrp3 OS=Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1) GN=rrp3 PE=3 SV=1 1 445 0.0E+00
sp|Q7RY59|RRP3_NEUCR ATP-dependent rRNA helicase rrp-3 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=rrp-3 PE=3 SV=1 28 445 0.0E+00
sp|Q2H1Q8|RRP3_CHAGB ATP-dependent rRNA helicase RRP3 OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=RRP3 PE=3 SV=1 3 445 0.0E+00
sp|A6RW56|RRP3_BOTFB ATP-dependent rRNA helicase rrp3 OS=Botryotinia fuckeliana (strain B05.10) GN=rrp3 PE=3 SV=1 22 445 0.0E+00
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q4IFI0|RRP3_GIBZE ATP-dependent rRNA helicase RRP3 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=RRP3 PE=3 SV=1 1 445 0.0E+00
sp|A7EML8|RRP3_SCLS1 ATP-dependent rRNA helicase rrp3 OS=Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1) GN=rrp3 PE=3 SV=1 1 445 0.0E+00
sp|Q7RY59|RRP3_NEUCR ATP-dependent rRNA helicase rrp-3 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=rrp-3 PE=3 SV=1 28 445 0.0E+00
sp|Q2H1Q8|RRP3_CHAGB ATP-dependent rRNA helicase RRP3 OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=RRP3 PE=3 SV=1 3 445 0.0E+00
sp|A6RW56|RRP3_BOTFB ATP-dependent rRNA helicase rrp3 OS=Botryotinia fuckeliana (strain B05.10) GN=rrp3 PE=3 SV=1 22 445 0.0E+00
sp|A1D405|RRP3_NEOFI ATP-dependent rRNA helicase rrp3 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=rrp3 PE=3 SV=1 1 443 0.0E+00
sp|Q1E1N5|RRP3_COCIM ATP-dependent rRNA helicase RRP3 OS=Coccidioides immitis (strain RS) GN=RRP3 PE=3 SV=1 1 445 0.0E+00
sp|Q4WJE9|RRP3_ASPFU ATP-dependent rRNA helicase rrp3 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=rrp3 PE=3 SV=1 1 443 0.0E+00
sp|A4RGD1|RRP3_MAGO7 ATP-dependent rRNA helicase RRP3 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=RRP3 PE=3 SV=1 11 445 0.0E+00
sp|A6QRQ7|RRP3_AJECN ATP-dependent rRNA helicase RRP3 OS=Ajellomyces capsulatus (strain NAm1 / WU24) GN=RRP3 PE=3 SV=1 37 443 0.0E+00
sp|A1CR32|RRP3_ASPCL ATP-dependent rRNA helicase rrp3 OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=rrp3 PE=3 SV=1 24 443 0.0E+00
sp|Q2UNB7|RRP3_ASPOR ATP-dependent rRNA helicase rrp3 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=rrp3 PE=3 SV=1 1 437 0.0E+00
sp|Q5B5E7|RRP3_EMENI ATP-dependent rRNA helicase rrp3 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=rrp3 PE=3 SV=1 1 443 0.0E+00
sp|A2RB17|RRP3_ASPNC ATP-dependent rRNA helicase rrp3 OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=rrp3 PE=3 SV=1 45 437 0.0E+00
sp|Q0CIQ3|RRP3_ASPTN ATP-dependent rRNA helicase rrp3 OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=rrp3 PE=3 SV=2 22 445 0.0E+00
sp|Q6CH58|RRP3_YARLI ATP-dependent rRNA helicase RRP3 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=RRP3 PE=3 SV=1 12 438 0.0E+00
sp|Q9P6N8|RRP3_SCHPO ATP-dependent rRNA helicase rrp3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rrp3 PE=3 SV=1 42 443 0.0E+00
sp|Q0UK12|RRP3_PHANO ATP-dependent rRNA helicase RRP3 OS=Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) GN=RRP3 PE=3 SV=2 45 443 0.0E+00
sp|Q9CWX9|DDX47_MOUSE Probable ATP-dependent RNA helicase DDX47 OS=Mus musculus GN=Ddx47 PE=2 SV=2 21 437 0.0E+00
sp|Q29S22|DDX47_BOVIN Probable ATP-dependent RNA helicase DDX47 OS=Bos taurus GN=DDX47 PE=2 SV=1 27 437 0.0E+00
sp|Q9H0S4|DDX47_HUMAN Probable ATP-dependent RNA helicase DDX47 OS=Homo sapiens GN=DDX47 PE=1 SV=1 20 437 0.0E+00
sp|Q4P3U9|RRP3_USTMA ATP-dependent rRNA helicase RRP3 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=RRP3 PE=3 SV=2 47 437 0.0E+00
sp|P34580|DDX47_CAEEL Putative ATP-dependent RNA helicase T26G10.1 OS=Caenorhabditis elegans GN=T26G10.1 PE=3 SV=1 45 443 0.0E+00
sp|P0CR00|RRP3_CRYNJ ATP-dependent rRNA helicase RRP3 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=RRP3 PE=3 SV=1 39 437 2.0E-178
sp|P0CR01|RRP3_CRYNB ATP-dependent rRNA helicase RRP3 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=RRP3 PE=3 SV=1 39 437 2.0E-178
sp|Q5ACU6|RRP3_CANAL ATP-dependent rRNA helicase RRP3 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=RRP3 PE=3 SV=2 45 439 3.0E-171
sp|Q6BQ61|RRP3_DEBHA ATP-dependent rRNA helicase RRP3 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=RRP3 PE=3 SV=2 45 444 5.0E-171
sp|A5DQF1|RRP3_PICGU ATP-dependent rRNA helicase RRP3 OS=Meyerozyma guilliermondii (strain ATCC 6260 / CBS 566 / DSM 6381 / JCM 1539 / NBRC 10279 / NRRL Y-324) GN=RRP3 PE=3 SV=2 46 445 6.0E-170
sp|Q54VT4|DDX47_DICDI Probable ATP-dependent RNA helicase ddx47 OS=Dictyostelium discoideum GN=ddx47 PE=3 SV=1 46 437 2.0E-168
sp|Q75EW9|RRP3_ASHGO ATP-dependent rRNA helicase RRP3 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=RRP3 PE=3 SV=2 5 436 2.0E-165
sp|A6ZSX1|RRP3_YEAS7 ATP-dependent rRNA helicase RRP3 OS=Saccharomyces cerevisiae (strain YJM789) GN=RRP3 PE=3 SV=1 42 436 4.0E-165
sp|P38712|RRP3_YEAST ATP-dependent rRNA helicase RRP3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RRP3 PE=1 SV=2 42 436 1.0E-164
sp|Q8GY84|RH10_ARATH DEAD-box ATP-dependent RNA helicase 10 OS=Arabidopsis thaliana GN=RH10 PE=2 SV=2 37 437 2.0E-164
sp|A7TS37|RRP3_VANPO ATP-dependent rRNA helicase RRP3 OS=Vanderwaltozyma polyspora (strain ATCC 22028 / DSM 70294) GN=RRP3 PE=3 SV=1 46 436 5.0E-164
sp|Q6CT85|RRP3_KLULA ATP-dependent rRNA helicase RRP3 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=RRP3 PE=3 SV=1 23 436 1.0E-163
sp|A3LS22|RRP3_PICST ATP-dependent rRNA helicase RRP3 OS=Scheffersomyces stipitis (strain ATCC 58785 / CBS 6054 / NBRC 10063 / NRRL Y-11545) GN=RRP3 PE=3 SV=3 46 441 8.0E-162
sp|Q6FNK8|RRP3_CANGA ATP-dependent rRNA helicase RRP3 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=RRP3 PE=3 SV=1 46 436 5.0E-161
sp|Q7Y183|RH10_ORYSJ DEAD-box ATP-dependent RNA helicase 10 OS=Oryza sativa subsp. japonica GN=Os03g0669000 PE=2 SV=1 33 437 2.0E-155
sp|A5E6W6|RRP3_LODEL ATP-dependent rRNA helicase RRP3 OS=Lodderomyces elongisporus (strain ATCC 11503 / CBS 2605 / JCM 1781 / NBRC 1676 / NRRL YB-4239) GN=RRP3 PE=3 SV=1 45 428 7.0E-137
sp|Q55BR9|DDX49_DICDI Probable ATP-dependent RNA helicase ddx49 OS=Dictyostelium discoideum GN=ddx49 PE=3 SV=1 45 439 5.0E-116
sp|Q9Y6V7|DDX49_HUMAN Probable ATP-dependent RNA helicase DDX49 OS=Homo sapiens GN=DDX49 PE=1 SV=1 47 438 7.0E-113
sp|Q9SA27|RH36_ARATH DEAD-box ATP-dependent RNA helicase 36 OS=Arabidopsis thaliana GN=RH36 PE=2 SV=1 3 442 2.0E-112
sp|Q4FZF3|DDX49_MOUSE Probable ATP-dependent RNA helicase DDX49 OS=Mus musculus GN=Ddx49 PE=2 SV=1 47 438 3.0E-111
sp|Q8L4E9|RH36_ORYSJ DEAD-box ATP-dependent RNA helicase 36 OS=Oryza sativa subsp. japonica GN=Os07g0633500 PE=3 SV=1 44 436 9.0E-105
sp|Q9HGM5|DBP8_SCHPO ATP-dependent RNA helicase dbp8 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=dbp8 PE=3 SV=1 45 436 8.0E-102
sp|Q8SR63|RRP3_ENCCU ATP-dependent rRNA helicase RRP3 OS=Encephalitozoon cuniculi (strain GB-M1) GN=RRP3 PE=3 SV=1 47 437 3.0E-101
sp|A5DLE0|DBP8_PICGU ATP-dependent RNA helicase DBP8 OS=Meyerozyma guilliermondii (strain ATCC 6260 / CBS 566 / DSM 6381 / JCM 1539 / NBRC 10279 / NRRL Y-324) GN=DBP8 PE=3 SV=2 46 409 2.0E-98
sp|A7TK63|DBP8_VANPO ATP-dependent RNA helicase DBP8 OS=Vanderwaltozyma polyspora (strain ATCC 22028 / DSM 70294) GN=DBP8 PE=3 SV=1 47 409 5.0E-98
sp|Q59PR3|DBP8_CANAL ATP-dependent RNA helicase DBP8 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=DBP8 PE=3 SV=1 46 409 8.0E-98
sp|A5E0U9|DBP8_LODEL ATP-dependent RNA helicase DBP8 OS=Lodderomyces elongisporus (strain ATCC 11503 / CBS 2605 / JCM 1781 / NBRC 1676 / NRRL YB-4239) GN=DBP8 PE=3 SV=1 44 409 4.0E-97
sp|Q6BGU8|DBP8_DEBHA ATP-dependent RNA helicase DBP8 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=DBP8 PE=3 SV=2 46 409 1.0E-96
sp|Q4I662|DBP8_GIBZE ATP-dependent RNA helicase DBP8 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=DBP8 PE=3 SV=1 39 444 2.0E-94
sp|Q756G5|DBP8_ASHGO ATP-dependent RNA helicase DBP8 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=DBP8 PE=3 SV=1 46 411 3.0E-94
sp|P38719|DBP8_YEAST ATP-dependent RNA helicase DBP8 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DBP8 PE=1 SV=1 47 408 4.0E-94
sp|A6ZT77|DBP8_YEAS7 ATP-dependent RNA helicase DBP8 OS=Saccharomyces cerevisiae (strain YJM789) GN=DBP8 PE=3 SV=1 47 408 4.0E-94
sp|Q6C799|DBP8_YARLI ATP-dependent RNA helicase DBP8 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=DBP8 PE=3 SV=1 46 438 1.0E-93
sp|A3LP87|DBP8_PICST ATP-dependent RNA helicase DBP8 OS=Scheffersomyces stipitis (strain ATCC 58785 / CBS 6054 / NBRC 10063 / NRRL Y-11545) GN=DBP8 PE=3 SV=2 46 409 9.0E-93
sp|Q6CXW0|DBP8_KLULA ATP-dependent RNA helicase DBP8 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=DBP8 PE=3 SV=1 47 411 1.0E-91
sp|Q9ZRZ8|RH28_ARATH DEAD-box ATP-dependent RNA helicase 28 OS=Arabidopsis thaliana GN=RH28 PE=2 SV=1 9 429 1.0E-91
sp|Q6FQZ0|DBP8_CANGA ATP-dependent RNA helicase DBP8 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=DBP8 PE=3 SV=1 45 408 1.0E-91
sp|Q0INC5|RH28_ORYSJ DEAD-box ATP-dependent RNA helicase 28 OS=Oryza sativa subsp. japonica GN=Os12g0481100 PE=2 SV=2 25 410 3.0E-91
sp|A6SFV4|DBP8_BOTFB ATP-dependent RNA helicase dbp8 OS=Botryotinia fuckeliana (strain B05.10) GN=dbp8 PE=3 SV=1 5 444 2.0E-90
sp|Q5L3G9|CSHA_GEOKA DEAD-box ATP-dependent RNA helicase CshA OS=Geobacillus kaustophilus (strain HTA426) GN=cshA PE=3 SV=1 46 425 2.0E-89
sp|A7E436|DBP8_SCLS1 ATP-dependent RNA helicase dbp8 OS=Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1) GN=dbp8 PE=3 SV=1 33 444 3.0E-89
sp|A1CKJ0|DBP8_ASPCL ATP-dependent RNA helicase dbp8 OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=dbp8 PE=3 SV=1 5 444 3.0E-89
sp|Q0U8V9|DBP8_PHANO ATP-dependent RNA helicase DBP8 OS=Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) GN=DBP8 PE=3 SV=1 2 444 1.0E-88
sp|Q63GX5|CSHA_BACCZ DEAD-box ATP-dependent RNA helicase CshA OS=Bacillus cereus (strain ZK / E33L) GN=cshA PE=3 SV=1 46 409 2.0E-88
sp|Q6HPE6|CSHA_BACHK DEAD-box ATP-dependent RNA helicase CshA OS=Bacillus thuringiensis subsp. konkukian (strain 97-27) GN=cshA PE=3 SV=1 46 409 2.0E-88
sp|Q81VG0|CSHA_BACAN DEAD-box ATP-dependent RNA helicase CshA OS=Bacillus anthracis GN=cshA PE=3 SV=1 46 409 2.0E-88
sp|A0R8U6|CSHA_BACAH DEAD-box ATP-dependent RNA helicase CshA OS=Bacillus thuringiensis (strain Al Hakam) GN=cshA PE=3 SV=1 46 409 2.0E-88
sp|Q73EU1|CSHA_BACC1 DEAD-box ATP-dependent RNA helicase CshA OS=Bacillus cereus (strain ATCC 10987 / NRS 248) GN=cshA PE=3 SV=1 46 409 2.0E-88
sp|Q81IT9|CSHA_BACCR DEAD-box ATP-dependent RNA helicase CshA OS=Bacillus cereus (strain ATCC 14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL B-3711) GN=cshA PE=2 SV=2 46 409 2.0E-88
sp|Q54TJ4|DDX27_DICDI Probable ATP-dependent RNA helicase ddx27 OS=Dictyostelium discoideum GN=ddx27 PE=3 SV=1 46 427 9.0E-88
sp|A5AA68|DBP8_ASPNC ATP-dependent RNA helicase dbp8 OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=dbp8 PE=3 SV=1 5 444 2.0E-87
sp|Q5B3H7|DBP8_EMENI ATP-dependent RNA helicase dbp8 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=dbp8 PE=3 SV=1 1 444 2.0E-87
sp|Q4WXW1|DBP8_ASPFU ATP-dependent RNA helicase dbp8 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=dbp8 PE=3 SV=1 42 444 2.0E-86
sp|A1D6X9|DBP8_NEOFI ATP-dependent RNA helicase dbp8 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=dbp8 PE=3 SV=1 42 444 3.0E-86
sp|Q0CZN5|DRS1_ASPTN ATP-dependent RNA helicase drs1 OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=drs1 PE=3 SV=1 12 393 1.0E-85
sp|Q2UQI6|DRS1_ASPOR ATP-dependent RNA helicase drs1 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=drs1 PE=3 SV=2 9 393 3.0E-85
sp|Q0V1Z7|DRS1_PHANO ATP-dependent RNA helicase DRS1 OS=Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) GN=DRS1 PE=3 SV=1 62 430 4.0E-85
sp|P0CR02|DBP8_CRYNJ ATP-dependent RNA helicase DBP8 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=DBP8 PE=3 SV=1 22 436 4.0E-85
sp|A7F4L5|DRS1_SCLS1 ATP-dependent RNA helicase drs1 OS=Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1) GN=drs1 PE=3 SV=1 10 427 5.0E-85
sp|Q4WRV2|DRS1_ASPFU ATP-dependent RNA helicase drs1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=drs1 PE=3 SV=1 45 398 1.0E-84
sp|A1D1R8|DRS1_NEOFI ATP-dependent RNA helicase drs1 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=drs1 PE=3 SV=1 40 398 1.0E-84
sp|Q07886|DDX49_DROME Probable ATP-dependent RNA helicase Dbp45A OS=Drosophila melanogaster GN=Dbp45A PE=2 SV=2 47 436 2.0E-84
sp|Q7RYZ7|DBP8_NEUCR ATP-dependent RNA helicase dbp-8 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=dbp-8 PE=3 SV=1 42 425 2.0E-84
sp|Q65N62|CSHA_BACLD DEAD-box ATP-dependent RNA helicase CshA OS=Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / NBRC 12200 / NCIMB 9375 / NRRL NRS-1264 / Gibson 46) GN=cshA PE=3 SV=1 46 409 3.0E-84
sp|P0CR03|DBP8_CRYNB ATP-dependent RNA helicase DBP8 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=DBP8 PE=3 SV=1 22 436 4.0E-84
sp|A1CNV8|DRS1_ASPCL ATP-dependent RNA helicase drs1 OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=drs1 PE=3 SV=1 17 393 7.0E-84
sp|Q0CNX1|DBP8_ASPTN ATP-dependent RNA helicase dbp8 OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=dbp8 PE=3 SV=1 7 444 1.0E-83
sp|P96614|CSHA_BACSU DEAD-box ATP-dependent RNA helicase CshA OS=Bacillus subtilis (strain 168) GN=cshA PE=1 SV=2 46 409 2.0E-83
sp|A2QAX7|DRS1_ASPNC ATP-dependent RNA helicase drs1 OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=drs1 PE=3 SV=1 18 393 3.0E-83
sp|Q49Z29|CSHA_STAS1 DEAD-box ATP-dependent RNA helicase CshA OS=Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229) GN=cshA PE=3 SV=1 45 419 4.0E-83
sp|A1A4H6|DDX27_BOVIN Probable ATP-dependent RNA helicase DDX27 OS=Bos taurus GN=DDX27 PE=2 SV=1 46 430 4.0E-83
sp|Q4I830|DRS1_GIBZE ATP-dependent RNA helicase DRS1 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=DRS1 PE=3 SV=1 46 422 8.0E-83
sp|Q7A0D2|CSHA_STAAW DEAD-box ATP-dependent RNA helicase CshA OS=Staphylococcus aureus (strain MW2) GN=cshA PE=3 SV=1 45 419 1.0E-82
sp|Q6G7M9|CSHA_STAAS DEAD-box ATP-dependent RNA helicase CshA OS=Staphylococcus aureus (strain MSSA476) GN=cshA PE=3 SV=1 45 419 1.0E-82
sp|Q7A4G0|CSHA_STAAN DEAD-box ATP-dependent RNA helicase CshA OS=Staphylococcus aureus (strain N315) GN=cshA PE=1 SV=1 45 419 1.0E-82
sp|Q99SH6|CSHA_STAAM DEAD-box ATP-dependent RNA helicase CshA OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=cshA PE=3 SV=1 45 419 1.0E-82
sp|Q5HEB9|CSHA_STAAC DEAD-box ATP-dependent RNA helicase CshA OS=Staphylococcus aureus (strain COL) GN=cshA PE=3 SV=1 45 419 1.0E-82
sp|Q2FWH5|CSHA_STAA8 DEAD-box ATP-dependent RNA helicase CshA OS=Staphylococcus aureus (strain NCTC 8325) GN=cshA PE=1 SV=1 45 419 1.0E-82
sp|Q2FF45|CSHA_STAA3 DEAD-box ATP-dependent RNA helicase CshA OS=Staphylococcus aureus (strain USA300) GN=cshA PE=3 SV=1 45 419 1.0E-82
sp|Q6GEZ3|CSHA_STAAR DEAD-box ATP-dependent RNA helicase CshA OS=Staphylococcus aureus (strain MRSA252) GN=cshA PE=3 SV=1 45 419 1.0E-82
sp|Q2YUH3|CSHA_STAAB DEAD-box ATP-dependent RNA helicase CshA OS=Staphylococcus aureus (strain bovine RF122 / ET3-1) GN=cshA PE=3 SV=1 45 419 2.0E-82
sp|Q96GQ7|DDX27_HUMAN Probable ATP-dependent RNA helicase DDX27 OS=Homo sapiens GN=DDX27 PE=1 SV=2 46 430 4.0E-82
sp|Q4L7W0|CSHA_STAHJ DEAD-box ATP-dependent RNA helicase CshA OS=Staphylococcus haemolyticus (strain JCSC1435) GN=cshA PE=3 SV=1 45 419 5.0E-82
sp|Q1E2B2|DRS1_COCIM ATP-dependent RNA helicase DRS1 OS=Coccidioides immitis (strain RS) GN=DRS1 PE=3 SV=1 39 393 5.0E-82
sp|Q09903|DRS1_SCHPO ATP-dependent RNA helicase drs1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=drs1 PE=3 SV=1 46 429 6.0E-82
sp|A4R8G3|DBP8_MAGO7 ATP-dependent RNA helicase DBP8 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=DBP8 PE=3 SV=3 3 425 7.0E-82
sp|Q8Y8N0|CSHA_LISMO ATP-dependent RNA helicase CshA OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=cshA PE=2 SV=1 47 425 1.0E-81
sp|A4QYM6|DRS1_MAGO7 ATP-dependent RNA helicase DRS1 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=DRS1 PE=3 SV=1 11 437 1.0E-81
sp|Q6FW42|DRS1_CANGA ATP-dependent RNA helicase DRS1 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=DRS1 PE=3 SV=1 8 395 2.0E-81
sp|Q1E0Z3|DBP8_COCIM ATP-dependent RNA helicase DBP8 OS=Coccidioides immitis (strain RS) GN=DBP8 PE=3 SV=1 5 444 2.0E-81
sp|P93008|RH21_ARATH DEAD-box ATP-dependent RNA helicase 21 OS=Arabidopsis thaliana GN=RH21 PE=2 SV=1 41 414 3.0E-81
sp|A6RUH2|DRS1_BOTFB ATP-dependent RNA helicase drs1 OS=Botryotinia fuckeliana (strain B05.10) GN=drs1 PE=3 SV=1 20 427 3.0E-81
sp|P0CQ92|DRS1_CRYNJ ATP-dependent RNA helicase DRS1 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=DRS1 PE=3 SV=1 26 427 5.0E-81
sp|P0CQ93|DRS1_CRYNB ATP-dependent RNA helicase DRS1 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=DRS1 PE=3 SV=1 26 427 5.0E-81
sp|A7TJM9|DRS1_VANPO ATP-dependent RNA helicase DRS1 OS=Vanderwaltozyma polyspora (strain ATCC 22028 / DSM 70294) GN=DRS1 PE=3 SV=1 46 389 9.0E-81
sp|Q5HME0|CSHA_STAEQ DEAD-box ATP-dependent RNA helicase CshA OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=cshA PE=3 SV=1 45 419 1.0E-80
sp|Q75F95|DRS1_ASHGO ATP-dependent RNA helicase DRS1 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=DRS1 PE=3 SV=1 46 391 4.0E-80
sp|Q8CRP6|CSHA_STAES DEAD-box ATP-dependent RNA helicase CshA OS=Staphylococcus epidermidis (strain ATCC 12228) GN=cshA PE=3 SV=1 45 419 4.0E-80
sp|Q921N6|DDX27_MOUSE Probable ATP-dependent RNA helicase DDX27 OS=Mus musculus GN=Ddx27 PE=1 SV=3 34 430 9.0E-80
sp|Q6CJV1|DRS1_KLULA ATP-dependent RNA helicase DRS1 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=DRS1 PE=3 SV=1 45 389 1.0E-79
sp|A3LSN3|DRS1_PICST ATP-dependent RNA helicase DRS1 OS=Scheffersomyces stipitis (strain ATCC 58785 / CBS 6054 / NBRC 10063 / NRRL Y-11545) GN=DRS1 PE=3 SV=3 46 389 2.0E-79
sp|B9XXL6|RHPA_HELP8 DEAD-box ATP-dependent RNA helicase RhpA OS=Helicobacter pylori (strain B128) GN=rhpA PE=1 SV=1 46 411 2.0E-79
sp|O25029|RHPA_HELPY DEAD-box ATP-dependent RNA helicase RhpA OS=Helicobacter pylori (strain ATCC 700392 / 26695) GN=rhpA PE=1 SV=1 32 411 3.0E-79
sp|Q6BTL5|DRS1_DEBHA ATP-dependent RNA helicase DRS1 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=DRS1 PE=3 SV=1 35 389 7.0E-79
sp|Q89AF9|DEAD_BUCBP ATP-dependent RNA helicase DeaD OS=Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp) GN=deaD PE=3 SV=1 46 436 7.0E-79
sp|P25888|RHLE_ECOLI ATP-dependent RNA helicase RhlE OS=Escherichia coli (strain K12) GN=rhlE PE=1 SV=3 46 408 1.0E-78
sp|P0C2N8|DRS1_NEUCR ATP-dependent RNA helicase drs1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=drh-11 PE=3 SV=1 46 393 1.0E-78
sp|A5DKW3|DRS1_PICGU ATP-dependent RNA helicase DRS1 OS=Meyerozyma guilliermondii (strain ATCC 6260 / CBS 566 / DSM 6381 / JCM 1539 / NBRC 10279 / NRRL Y-324) GN=DRS1 PE=3 SV=2 3 393 2.0E-78
sp|Q2UKX3|DBP8_ASPOR ATP-dependent RNA helicase dbp8 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=dbp8 PE=3 SV=1 50 444 2.0E-78
sp|Q9Z6C9|CSHA_LACRE ATP-dependent RNA helicase CshA OS=Lactobacillus reuteri GN=cshA PE=3 SV=1 47 401 2.0E-78
sp|P57453|DEAD_BUCAI ATP-dependent RNA helicase DeaD OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS) GN=deaD PE=3 SV=1 46 438 3.0E-78
sp|Q814I2|DBPA_BACCR ATP-dependent RNA helicase DbpA OS=Bacillus cereus (strain ATCC 14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL B-3711) GN=dbpA PE=2 SV=1 43 433 1.0E-77
sp|Q8W4R3|RH30_ARATH DEAD-box ATP-dependent RNA helicase 30 OS=Arabidopsis thaliana GN=RH30 PE=2 SV=2 38 399 2.0E-77
sp|P32892|DRS1_YEAST ATP-dependent RNA helicase DRS1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DRS1 PE=1 SV=2 39 391 4.0E-77
sp|A7A0P8|DRS1_YEAS7 ATP-dependent RNA helicase DRS1 OS=Saccharomyces cerevisiae (strain YJM789) GN=DRS1 PE=3 SV=1 39 391 4.0E-77
sp|Q8K9H6|DEAD_BUCAP ATP-dependent RNA helicase DeaD OS=Buchnera aphidicola subsp. Schizaphis graminum (strain Sg) GN=deaD PE=3 SV=1 46 420 4.0E-77
sp|Q9C718|RH20_ARATH DEAD-box ATP-dependent RNA helicase 20 OS=Arabidopsis thaliana GN=RH20 PE=2 SV=1 31 390 6.0E-77
sp|Q5ACK7|DRS1_CANAL ATP-dependent RNA helicase DRS1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=DRS1 PE=3 SV=1 46 395 1.0E-76
sp|P0A9P8|DEAD_SHIFL ATP-dependent RNA helicase DeaD OS=Shigella flexneri GN=deaD PE=3 SV=2 42 404 2.0E-76
sp|P0A9P6|DEAD_ECOLI ATP-dependent RNA helicase DeaD OS=Escherichia coli (strain K12) GN=deaD PE=1 SV=2 42 404 2.0E-76
sp|P0A9P7|DEAD_ECOL6 ATP-dependent RNA helicase DeaD OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=deaD PE=3 SV=2 42 404 2.0E-76
sp|Q8XA87|DEAD_ECO57 ATP-dependent RNA helicase DeaD OS=Escherichia coli O157:H7 GN=deaD PE=3 SV=3 42 404 3.0E-76
sp|A2YV85|RH29_ORYSI DEAD-box ATP-dependent RNA helicase 29 OS=Oryza sativa subsp. indica GN=OsI_028228 PE=2 SV=2 15 428 5.0E-76
sp|P0A4D8|CSHA_STRR6 DEAD-box ATP-dependent RNA helicase CshA OS=Streptococcus pneumoniae (strain ATCC BAA-255 / R6) GN=cshA PE=3 SV=1 47 408 6.0E-76
sp|P0A4D7|CSHA_STRPN DEAD-box ATP-dependent RNA helicase CshA OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) GN=cshA PE=3 SV=1 47 408 6.0E-76
sp|A3BT52|RH29_ORYSJ DEAD-box ATP-dependent RNA helicase 29 OS=Oryza sativa subsp. japonica GN=Os08g0416100 PE=2 SV=2 15 428 1.0E-75
sp|P9WH05|DEAD_MYCTU ATP-dependent RNA helicase DeaD OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=deaD PE=1 SV=1 46 408 3.0E-75
sp|P9WH04|DEAD_MYCTO ATP-dependent RNA helicase DeaD OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=deaD PE=3 SV=1 46 408 3.0E-75
sp|A5DY34|DRS1_LODEL ATP-dependent RNA helicase DRS1 OS=Lodderomyces elongisporus (strain ATCC 11503 / CBS 2605 / JCM 1781 / NBRC 1676 / NRRL YB-4239) GN=DRS1 PE=3 SV=1 45 389 3.0E-75
sp|Q5QMN3|RH20_ORYSJ DEAD-box ATP-dependent RNA helicase 20 OS=Oryza sativa subsp. japonica GN=Os01g0197200 PE=3 SV=2 31 390 5.0E-75
sp|P33906|DEAD_KLEPN ATP-dependent RNA helicase DeaD OS=Klebsiella pneumoniae GN=deaD PE=3 SV=3 46 404 6.0E-75
sp|Q1EB31|DBP4_COCIM ATP-dependent RNA helicase DBP4 OS=Coccidioides immitis (strain RS) GN=DBP4 PE=3 SV=1 45 401 7.0E-75
sp|P42305|DBPA_BACSU ATP-dependent RNA helicase DbpA OS=Bacillus subtilis (strain 168) GN=dbpA PE=1 SV=2 47 416 2.0E-74
sp|A7ESL8|DBP4_SCLS1 ATP-dependent RNA helicase dbp4 OS=Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1) GN=dbp4 PE=3 SV=1 45 401 5.0E-74
sp|Q6CGD1|DBP4_YARLI ATP-dependent RNA helicase DBP4 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=DBP4 PE=3 SV=1 32 402 6.0E-74
sp|Q9BUQ8|DDX23_HUMAN Probable ATP-dependent RNA helicase DDX23 OS=Homo sapiens GN=DDX23 PE=1 SV=3 29 404 7.0E-74
sp|Q9Y7T7|PRP28_SCHPO Pre-mRNA-splicing ATP-dependent RNA helicase prp28 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=prp28 PE=3 SV=1 41 434 9.0E-74
sp|Q6C7D2|HAS1_YARLI ATP-dependent RNA helicase HAS1 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=HAS1 PE=3 SV=1 29 403 2.0E-73
sp|Q53RK8|RH21_ORYSJ DEAD-box ATP-dependent RNA helicase 21 OS=Oryza sativa subsp. japonica GN=Os03g0708600 PE=2 SV=1 5 397 3.0E-73
sp|Q6CEB8|DRS1_YARLI ATP-dependent RNA helicase DRS1 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=DRS1 PE=3 SV=1 45 391 4.0E-73
sp|Q5RC67|DDX23_PONAB Probable ATP-dependent RNA helicase DDX23 OS=Pongo abelii GN=DDX23 PE=2 SV=1 29 404 4.0E-73
sp|P44586|DEAD_HAEIN ATP-dependent RNA helicase DeaD OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=deaD PE=3 SV=1 46 409 2.0E-72
sp|Q6FLF3|DBP2_CANGA ATP-dependent RNA helicase DBP2 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=DBP2 PE=3 SV=1 38 424 3.0E-72
sp|Q0DB53|RH52A_ORYSJ DEAD-box ATP-dependent RNA helicase 52A OS=Oryza sativa subsp. japonica GN=Os06g0602400 PE=2 SV=2 38 396 3.0E-72
sp|Q74Z73|HAS1_ASHGO ATP-dependent RNA helicase HAS1 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=HAS1 PE=3 SV=2 47 403 4.0E-72
sp|Q6CXB7|HAS1_KLULA ATP-dependent RNA helicase HAS1 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=HAS1 PE=3 SV=1 2 403 4.0E-72
sp|Q81DF9|CSHE_BACCR DEAD-box ATP-dependent RNA helicase CshE OS=Bacillus cereus (strain ATCC 14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL B-3711) GN=cshE PE=2 SV=1 45 405 5.0E-72
sp|A2QS00|DBP4_ASPNC ATP-dependent RNA helicase dbp4 OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=dbp4 PE=3 SV=1 42 389 5.0E-72
sp|Q4P9P3|DRS1_USTMA ATP-dependent RNA helicase DRS1 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=DRS1 PE=3 SV=1 43 398 6.0E-72
sp|Q59LU0|DBP2_CANAL ATP-dependent RNA helicase DBP2 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=DBP2 PE=3 SV=2 28 396 7.0E-72
sp|Q0CMM5|DBP4_ASPTN ATP-dependent RNA helicase dbp4 OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=dbp4 PE=3 SV=2 42 420 1.0E-71
sp|A1CTZ2|DBP4_ASPCL ATP-dependent RNA helicase dbp4 OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=dbp4 PE=3 SV=1 32 401 2.0E-71
sp|A1CIQ5|HAS1_ASPCL ATP-dependent RNA helicase has1 OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=has1 PE=3 SV=1 12 403 2.0E-71
sp|Q6FIL3|HAS1_CANGA ATP-dependent RNA helicase HAS1 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=HAS1 PE=3 SV=1 20 403 4.0E-71
sp|Q755N4|DBP2_ASHGO ATP-dependent RNA helicase DBP2 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=DBP2 PE=3 SV=2 38 396 4.0E-71
sp|A5DL80|DBP2_PICGU ATP-dependent RNA helicase DBP2 OS=Meyerozyma guilliermondii (strain ATCC 6260 / CBS 566 / DSM 6381 / JCM 1539 / NBRC 10279 / NRRL Y-324) GN=DBP2 PE=3 SV=3 41 396 4.0E-71
sp|Q5BBY1|HAS1_EMENI ATP-dependent RNA helicase has1 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=has1 PE=3 SV=1 28 403 7.0E-71
sp|Q4IAS1|DBP4_GIBZE ATP-dependent RNA helicase DBP4 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=DBP4 PE=3 SV=1 42 389 7.0E-71
sp|Q4WM60|DBP4_ASPFU ATP-dependent RNA helicase dbp4 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=dbp4 PE=3 SV=1 45 401 1.0E-70
sp|Q6Z4K6|RH52B_ORYSJ DEAD-box ATP-dependent RNA helicase 52B OS=Oryza sativa subsp. japonica GN=PL10B PE=2 SV=1 38 411 1.0E-70
sp|Q9SB89|RH27_ARATH DEAD-box ATP-dependent RNA helicase 27 OS=Arabidopsis thaliana GN=RH27 PE=2 SV=2 45 403 1.0E-70
sp|A1DNF9|DBP4_NEOFI ATP-dependent RNA helicase dbp4 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=dbp4 PE=3 SV=1 42 401 2.0E-70
sp|Q2UHB7|DBP4_ASPOR ATP-dependent RNA helicase dbp4 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=dbp4 PE=3 SV=1 42 389 2.0E-70
sp|Q03532|HAS1_YEAST ATP-dependent RNA helicase HAS1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HAS1 PE=1 SV=1 8 427 3.0E-70
sp|Q0UR48|HAS1_PHANO ATP-dependent RNA helicase HAS1 OS=Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) GN=HAS1 PE=3 SV=1 11 403 3.0E-70
sp|A1CW14|HAS1_NEOFI ATP-dependent RNA helicase has1 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=has1 PE=3 SV=1 12 403 4.0E-70
sp|Q7RZ35|DBP4_NEUCR ATP-dependent RNA helicase dbp-4 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=dbp-4 PE=3 SV=1 47 401 4.0E-70
sp|A4R8B5|HAS1_MAGO7 ATP-dependent RNA helicase HAS1 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=HAS1 PE=3 SV=2 12 403 5.0E-70
sp|Q6C4D4|DBP2_YARLI ATP-dependent RNA helicase DBP2 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=DBP2 PE=3 SV=1 41 391 6.0E-70
sp|O49289|RH29_ARATH Putative DEAD-box ATP-dependent RNA helicase 29 OS=Arabidopsis thaliana GN=RH29 PE=3 SV=1 47 416 7.0E-70
sp|Q54S03|DDX18_DICDI Probable ATP-dependent RNA helicase ddx18 OS=Dictyostelium discoideum GN=ddx18 PE=3 SV=1 47 427 7.0E-70
sp|P44701|SRMB_HAEIN ATP-dependent RNA helicase SrmB OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=srmB PE=3 SV=1 47 401 8.0E-70
sp|Q86XP3|DDX42_HUMAN ATP-dependent RNA helicase DDX42 OS=Homo sapiens GN=DDX42 PE=1 SV=1 32 403 9.0E-70
sp|Q1DMX8|PRP28_COCIM Pre-mRNA-splicing ATP-dependent RNA helicase PRP28 OS=Coccidioides immitis (strain RS) GN=PRP28 PE=3 SV=2 41 406 9.0E-70
sp|Q75HJ0|RH37_ORYSJ DEAD-box ATP-dependent RNA helicase 37 OS=Oryza sativa subsp. japonica GN=PL10A PE=2 SV=1 38 396 1.0E-69
sp|Q810A7|DDX42_MOUSE ATP-dependent RNA helicase DDX42 OS=Mus musculus GN=Ddx42 PE=1 SV=3 32 403 1.0E-69
sp|Q7ZY47|DDX42_XENLA ATP-dependent RNA helicase DDX42 OS=Xenopus laevis GN=ddx42 PE=2 SV=1 32 403 1.0E-69
sp|Q5BFU1|DBP4_EMENI ATP-dependent RNA helicase dbp4 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=dbp4 PE=3 SV=1 45 389 1.0E-69
sp|Q5R7D1|DDX42_PONAB ATP-dependent RNA helicase DDX42 OS=Pongo abelii GN=DDX42 PE=2 SV=1 32 403 1.0E-69
sp|A7E449|DBP2_SCLS1 ATP-dependent RNA helicase dbp2 OS=Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1) GN=dbp2 PE=3 SV=1 39 390 1.0E-69
sp|Q7S9J4|DBP10_NEUCR ATP-dependent RNA helicase dbp-10 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=dbp-10 PE=3 SV=1 1 408 2.0E-69
sp|Q55804|CRHR_SYNY3 RNA helicase CrhR OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=crhR PE=1 SV=1 46 409 2.0E-69
sp|A6SFW7|DBP2_BOTFB ATP-dependent RNA helicase dbp2 OS=Botryotinia fuckeliana (strain B05.10) GN=dbp2 PE=3 SV=2 39 390 2.0E-69
sp|Q9UJV9|DDX41_HUMAN Probable ATP-dependent RNA helicase DDX41 OS=Homo sapiens GN=DDX41 PE=1 SV=2 41 391 2.0E-69
sp|Q6FP38|DBP1_CANGA ATP-dependent RNA helicase DBP1 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=DBP1 PE=3 SV=1 35 433 2.0E-69
sp|Q6C7X8|DBP10_YARLI ATP-dependent RNA helicase DBP10 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=DBP10 PE=3 SV=1 35 408 3.0E-69
sp|Q5F485|DDX42_CHICK ATP-dependent RNA helicase DDX42 OS=Gallus gallus GN=DDX42 PE=2 SV=1 32 403 3.0E-69
sp|Q09916|HAS1_SCHPO ATP-dependent RNA helicase has1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=has1 PE=1 SV=1 47 403 3.0E-69
sp|A5DID7|HAS1_PICGU ATP-dependent RNA helicase HAS1 OS=Meyerozyma guilliermondii (strain ATCC 6260 / CBS 566 / DSM 6381 / JCM 1539 / NBRC 10279 / NRRL Y-324) GN=HAS1 PE=3 SV=2 35 403 3.0E-69
sp|Q54CD8|DDX54_DICDI ATP-dependent RNA helicase ddx54 OS=Dictyostelium discoideum GN=helA PE=3 SV=1 47 408 3.0E-69
sp|A6ZRX0|DBP2_YEAS7 ATP-dependent RNA helicase DBP2 OS=Saccharomyces cerevisiae (strain YJM789) GN=DBP2 PE=3 SV=1 14 391 4.0E-69
sp|Q6BY27|DBP2_DEBHA ATP-dependent RNA helicase DBP2 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=DBP2 PE=3 SV=1 41 396 5.0E-69
sp|P24783|DBP2_YEAST ATP-dependent RNA helicase DBP2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DBP2 PE=1 SV=1 14 391 5.0E-69
sp|Q54IV3|DDX42_DICDI Probable ATP-dependent RNA helicase ddx42 OS=Dictyostelium discoideum GN=ddx42 PE=3 SV=1 46 403 5.0E-69
sp|A5E2Z9|HAS1_LODEL ATP-dependent RNA helicase HAS1 OS=Lodderomyces elongisporus (strain ATCC 11503 / CBS 2605 / JCM 1781 / NBRC 1676 / NRRL YB-4239) GN=HAS1 PE=3 SV=1 13 403 5.0E-69
sp|Q91VN6|DDX41_MOUSE Probable ATP-dependent RNA helicase DDX41 OS=Mus musculus GN=Ddx41 PE=1 SV=2 41 391 5.0E-69
sp|Q58083|H669_METJA Probable ATP-dependent RNA helicase MJ0669 OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=MJ0669 PE=1 SV=1 46 408 5.0E-69
sp|Q8H0U8|RH42_ARATH DEAD-box ATP-dependent RNA helicase 42 OS=Arabidopsis thaliana GN=RH42 PE=1 SV=2 38 393 5.0E-69
sp|A2Q9T6|HAS1_ASPNC ATP-dependent RNA helicase has1 OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=has1 PE=3 SV=1 12 403 5.0E-69
sp|Q1EB38|DBP10_COCIM ATP-dependent RNA helicase DBP10 OS=Coccidioides immitis (strain RS) GN=DBP10 PE=3 SV=1 47 408 6.0E-69
sp|A5DF03|PRP28_PICGU Pre-mRNA-splicing ATP-dependent RNA helicase PRP28 OS=Meyerozyma guilliermondii (strain ATCC 6260 / CBS 566 / DSM 6381 / JCM 1539 / NBRC 10279 / NRRL Y-324) GN=PRP28 PE=3 SV=2 41 412 6.0E-69
sp|A4RGU2|DBP4_MAGO7 ATP-dependent RNA helicase DBP4 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=DBP4 PE=3 SV=1 44 389 6.0E-69
sp|Q501J6|DDX17_MOUSE Probable ATP-dependent RNA helicase DDX17 OS=Mus musculus GN=Ddx17 PE=1 SV=1 64 390 7.0E-69
sp|Q09719|DBP10_SCHPO ATP-dependent RNA helicase dbp10 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=dbp10 PE=1 SV=1 46 393 7.0E-69
sp|Q4I7F9|PRP28_GIBZE Pre-mRNA-splicing ATP-dependent RNA helicase PRP28 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=PRP28 PE=3 SV=1 41 406 7.0E-69
sp|Q95YF3|CGH1_CAEEL ATP-dependent RNA helicase cgh-1 OS=Caenorhabditis elegans GN=cgh-1 PE=1 SV=1 65 412 7.0E-69
sp|Q2U070|DBP2_ASPOR ATP-dependent RNA helicase dbp2 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=dbp2 PE=3 SV=1 41 390 1.0E-68
sp|Q5BFU7|DBP10_EMENI ATP-dependent RNA helicase dbp10 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=dbp10 PE=3 SV=1 13 408 1.0E-68
sp|Q2UUN6|HAS1_ASPOR ATP-dependent RNA helicase has1 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=has1 PE=3 SV=2 7 415 1.0E-68
sp|A1DGZ7|DBP2_NEOFI ATP-dependent RNA helicase dbp2 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=dbp2 PE=3 SV=1 31 390 1.0E-68
sp|Q0UMB9|DBP4_PHANO ATP-dependent RNA helicase DBP4 OS=Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) GN=DBP4 PE=3 SV=1 44 402 1.0E-68
sp|Q6CIV2|DBP2_KLULA ATP-dependent RNA helicase DBP2 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=DBP2 PE=3 SV=1 38 396 1.0E-68
sp|Q1DP69|DBP2_COCIM ATP-dependent RNA helicase DBP2 OS=Coccidioides immitis (strain RS) GN=DBP2 PE=3 SV=2 38 390 2.0E-68
sp|A7TGU7|DHH1_VANPO ATP-dependent RNA helicase DHH1 OS=Vanderwaltozyma polyspora (strain ATCC 22028 / DSM 70294) GN=DHH1 PE=3 SV=1 12 412 2.0E-68
sp|A1CHL3|PRP28_ASPCL Pre-mRNA-splicing ATP-dependent RNA helicase prp28 OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=prp28 PE=3 SV=1 41 406 2.0E-68
sp|A1CX72|PRP28_NEOFI Pre-mRNA-splicing ATP-dependent RNA helicase prp28 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=prp28 PE=3 SV=1 41 406 2.0E-68
sp|Q5GUR8|RHLB_XANOR ATP-dependent RNA helicase RhlB OS=Xanthomonas oryzae pv. oryzae (strain KACC10331 / KXO85) GN=rhlB PE=3 SV=2 46 416 2.0E-68
sp|Q1EA54|HAS1_COCIM ATP-dependent RNA helicase HAS1 OS=Coccidioides immitis (strain RS) GN=HAS1 PE=3 SV=1 9 403 2.0E-68
sp|Q5N7W4|RH30_ORYSJ DEAD-box ATP-dependent RNA helicase 30 OS=Oryza sativa subsp. japonica GN=Os01g0911100 PE=2 SV=2 31 390 2.0E-68
sp|A1C6C4|DBP2_ASPCL ATP-dependent RNA helicase dbp2 OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=dbp2 PE=3 SV=1 31 390 3.0E-68
sp|Q2H720|DBP2_CHAGB ATP-dependent RNA helicase DBP2 OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=DBP2 PE=3 SV=1 36 390 3.0E-68
sp|Q4WQM4|HAS1_ASPFU ATP-dependent RNA helicase has1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=has1 PE=3 SV=2 12 403 3.0E-68
sp|Q4P5U4|DBP4_USTMA ATP-dependent RNA helicase DBP4 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=DBP4 PE=3 SV=2 45 389 3.0E-68
sp|Q4WEB4|FAL1_ASPFU ATP-dependent RNA helicase fal1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=fal1 PE=3 SV=2 27 420 3.0E-68
sp|Q4WPE9|PRP28_ASPFU Pre-mRNA-splicing ATP-dependent RNA helicase prp28 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=prp28 PE=3 SV=1 41 406 4.0E-68
sp|O22907|RH24_ARATH DEAD-box ATP-dependent RNA helicase 24 OS=Arabidopsis thaliana GN=RH24 PE=1 SV=2 45 391 4.0E-68
sp|Q5B0J9|DBP2_EMENI ATP-dependent RNA helicase dbp2 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=dbp2 PE=3 SV=1 31 390 4.0E-68
sp|Q4TVV3|DDX46_DANRE Probable ATP-dependent RNA helicase DDX46 OS=Danio rerio GN=ddx46 PE=2 SV=1 40 419 5.0E-68
sp|Q92841|DDX17_HUMAN Probable ATP-dependent RNA helicase DDX17 OS=Homo sapiens GN=DDX17 PE=1 SV=2 64 390 5.0E-68
sp|Q2UAK1|FAL1_ASPOR ATP-dependent RNA helicase fal1 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=fal1 PE=3 SV=1 27 420 5.0E-68
sp|A1C595|FAL1_ASPCL ATP-dependent RNA helicase fal1 OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=fal1 PE=3 SV=1 38 420 6.0E-68
sp|B5FZY7|IF4A3_TAEGU Eukaryotic initiation factor 4A-III OS=Taeniopygia guttata GN=EIF4A3 PE=2 SV=1 28 412 6.0E-68
sp|O42226|I4A3B_XENLA Eukaryotic initiation factor 4A-III-B OS=Xenopus laevis GN=eif4a3-b PE=2 SV=1 28 412 6.0E-68
sp|A4QU31|FAL1_MAGO7 ATP-dependent RNA helicase FAL1 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=FAL1 PE=3 SV=1 46 420 7.0E-68
sp|P24782|DBP2_SCHPO ATP-dependent RNA helicase dbp2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=dbp2 PE=2 SV=2 41 390 7.0E-68
sp|A4RHF1|DED1_MAGO7 ATP-dependent RNA helicase DED1 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=DED1 PE=3 SV=2 35 393 7.0E-68
sp|Q6BH93|HAS1_DEBHA ATP-dependent RNA helicase HAS1 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=HAS1 PE=3 SV=1 46 415 7.0E-68
sp|Q0CAS8|FAL1_ASPTN ATP-dependent RNA helicase fal1 OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=fal1 PE=3 SV=1 38 420 7.0E-68
sp|Q5ZM36|IF4A3_CHICK Eukaryotic initiation factor 4A-III OS=Gallus gallus GN=EIF4A3 PE=2 SV=1 28 412 7.0E-68
sp|Q8Y7M8|DBPA_LISMO ATP-dependent RNA helicase DbpA OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=dbpA PE=2 SV=1 47 427 7.0E-68
sp|Q3BNH8|RHLB_XANC5 ATP-dependent RNA helicase RhlB OS=Xanthomonas campestris pv. vesicatoria (strain 85-10) GN=rhlB PE=3 SV=1 46 416 8.0E-68
sp|Q7SBC6|DBP2_NEUCR ATP-dependent RNA helicase dbp2 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=drh-1 PE=3 SV=2 38 390 8.0E-68
sp|Q8PFZ3|RHLB_XANAC ATP-dependent RNA helicase RhlB OS=Xanthomonas axonopodis pv. citri (strain 306) GN=rhlB PE=3 SV=1 46 416 8.0E-68
sp|A7EM88|FAL1_SCLS1 ATP-dependent RNA helicase fal1 OS=Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1) GN=fal1 PE=3 SV=1 43 412 8.0E-68
sp|Q3B8Q2|IF4A3_RAT Eukaryotic initiation factor 4A-III OS=Rattus norvegicus GN=Eif4a3 PE=1 SV=1 28 412 9.0E-68
sp|A6M931|IF4A3_PIG Eukaryotic initiation factor 4A-III OS=Sus scrofa GN=EIF4A3 PE=2 SV=1 28 412 9.0E-68
sp|Q2NL22|IF4A3_BOVIN Eukaryotic initiation factor 4A-III OS=Bos taurus GN=EIF4A3 PE=2 SV=3 28 412 9.0E-68
sp|Q10MH8|RH24_ORYSJ DEAD-box ATP-dependent RNA helicase 24 OS=Oryza sativa subsp. japonica GN=Os03g0308500 PE=2 SV=1 39 396 9.0E-68
sp|A5DAC8|DBP3_PICGU ATP-dependent RNA helicase DBP3 OS=Meyerozyma guilliermondii (strain ATCC 6260 / CBS 566 / DSM 6381 / JCM 1539 / NBRC 10279 / NRRL Y-324) GN=DBP3 PE=3 SV=2 65 396 9.0E-68
sp|Q8P4D4|RHLB_XANCP ATP-dependent RNA helicase RhlB OS=Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25) GN=rhlB PE=3 SV=1 46 416 9.0E-68
sp|B0RWT6|RHLB_XANCB ATP-dependent RNA helicase RhlB OS=Xanthomonas campestris pv. campestris (strain B100) GN=rhlB PE=3 SV=1 46 416 9.0E-68
sp|Q4UPY5|RHLB_XANC8 ATP-dependent RNA helicase RhlB OS=Xanthomonas campestris pv. campestris (strain 8004) GN=rhlB PE=3 SV=1 46 416 9.0E-68
sp|B7ZTW1|IF4A3_XENTR Eukaryotic initiation factor 4A-III OS=Xenopus tropicalis GN=eif4a3 PE=2 SV=1 28 412 9.0E-68
sp|P38919|IF4A3_HUMAN Eukaryotic initiation factor 4A-III OS=Homo sapiens GN=EIF4A3 PE=1 SV=4 28 412 9.0E-68
sp|Q91VC3|IF4A3_MOUSE Eukaryotic initiation factor 4A-III OS=Mus musculus GN=Eif4a3 PE=1 SV=3 28 412 9.0E-68
sp|A6S4N4|FAL1_BOTFB ATP-dependent RNA helicase fal1 OS=Botryotinia fuckeliana (strain B05.10) GN=fal1 PE=3 SV=1 43 412 9.0E-68
sp|Q9LU46|RH35_ARATH DEAD-box ATP-dependent RNA helicase 35 OS=Arabidopsis thaliana GN=RH35 PE=2 SV=1 41 395 1.0E-67
sp|A1D071|FAL1_NEOFI ATP-dependent RNA helicase fal1 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=fal1 PE=3 SV=1 38 420 1.0E-67
sp|Q0CZS8|HAS1_ASPTN ATP-dependent RNA helicase has1 OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=has1 PE=3 SV=1 13 389 1.0E-67
sp|A3LNR6|HAS1_PICST ATP-dependent RNA helicase HAS1 OS=Scheffersomyces stipitis (strain ATCC 58785 / CBS 6054 / NBRC 10063 / NRRL Y-11545) GN=HAS1 PE=3 SV=2 47 403 1.0E-67
sp|Q8RXK6|RH8_ARATH DEAD-box ATP-dependent RNA helicase 8 OS=Arabidopsis thaliana GN=RH8 PE=2 SV=1 13 422 1.0E-67
sp|A5AAE5|FAL1_ASPNC ATP-dependent RNA helicase fal1 OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=fal1 PE=3 SV=2 38 420 2.0E-67
sp|Q84UQ1|RH42_ORYSJ DEAD-box ATP-dependent RNA helicase 42 OS=Oryza sativa subsp. japonica GN=Os08g0159900 PE=2 SV=1 38 391 2.0E-67
sp|Q2UH00|PRP28_ASPOR Pre-mRNA-splicing ATP-dependent RNA helicase prp28 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=prp28 PE=3 SV=1 41 397 2.0E-67
sp|Q4X195|DBP2_ASPFU ATP-dependent RNA helicase dbp2 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=dbp2 PE=3 SV=2 31 390 2.0E-67
sp|A6SEH9|DED1_BOTFB ATP-dependent RNA helicase ded1 OS=Botryotinia fuckeliana (strain B05.10) GN=ded1 PE=3 SV=1 35 391 2.0E-67
sp|A7EJY3|DED1_SCLS1 ATP-dependent RNA helicase ded1 OS=Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1) GN=ded1 PE=3 SV=1 35 391 2.0E-67
sp|Q5AUL4|FAL1_EMENI ATP-dependent RNA helicase fal1 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=fal1 PE=3 SV=1 38 420 2.0E-67
sp|P0CQ84|HAS1_CRYNJ ATP-dependent RNA helicase HAS1 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=HAS1 PE=3 SV=1 5 426 2.0E-67
sp|P0CQ85|HAS1_CRYNB ATP-dependent RNA helicase HAS1 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=HAS1 PE=3 SV=1 5 426 2.0E-67
sp|A2QC74|DBP2_ASPNC ATP-dependent RNA helicase dbp2 OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=dbp2 PE=3 SV=1 38 390 2.0E-67
sp|A4R715|DHH1_MAGO7 ATP-dependent RNA helicase DHH1 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=DHH1 PE=3 SV=2 47 413 3.0E-67
sp|Q4I7K4|DED1_GIBZE ATP-dependent RNA helicase DED1 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=DED1 PE=3 SV=1 35 421 3.0E-67
sp|B5DG42|IF4A3_SALSA Eukaryotic initiation factor 4A-III OS=Salmo salar GN=eif4a3 PE=2 SV=1 28 412 3.0E-67
sp|Q4HZ42|DBP10_GIBZE ATP-dependent RNA helicase DBP10 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=DBP10 PE=3 SV=1 12 444 3.0E-67
sp|Q7SH33|PRP5_NEUCR Pre-mRNA-processing ATP-dependent RNA helicase prp-5 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=prp-5 PE=3 SV=1 41 404 3.0E-67
sp|Q9P735|FAL1_NEUCR ATP-dependent RNA helicase fal-1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=fal-1 PE=3 SV=2 46 412 3.0E-67
sp|A3LWX3|DHH1_PICST ATP-dependent RNA helicase DHH1 OS=Scheffersomyces stipitis (strain ATCC 58785 / CBS 6054 / NBRC 10063 / NRRL Y-11545) GN=DHH1 PE=3 SV=1 45 412 3.0E-67
sp|Q755A5|DBP3_ASHGO ATP-dependent RNA helicase DBP3 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=DBP3 PE=3 SV=1 61 432 3.0E-67
sp|Q4P184|FAL1_USTMA ATP-dependent RNA helicase FAL1 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=FAL1 PE=3 SV=1 39 419 4.0E-67
sp|Q4IF76|DBP2_GIBZE ATP-dependent RNA helicase DBP2 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=DBP2 PE=3 SV=1 12 390 4.0E-67
sp|Q54E49|DDX6_DICDI Probable ATP-dependent RNA helicase ddx6 OS=Dictyostelium discoideum GN=ddx6 PE=3 SV=1 12 412 4.0E-67
sp|A5DZE6|DED1_LODEL ATP-dependent RNA helicase DED1 OS=Lodderomyces elongisporus (strain ATCC 11503 / CBS 2605 / JCM 1781 / NBRC 1676 / NRRL YB-4239) GN=DED1 PE=3 SV=1 35 391 4.0E-67
sp|Q0JM17|RH56_ORYSJ DEAD-box ATP-dependent RNA helicase 56 OS=Oryza sativa subsp. japonica GN=Os01g0549700 PE=2 SV=2 47 390 4.0E-67
sp|A4QSS5|DBP2_MAGO7 ATP-dependent RNA helicase DBP2 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=DBP2 PE=3 SV=1 36 390 4.0E-67
sp|Q4IAA0|FAL1_GIBZE ATP-dependent RNA helicase FAL1 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=FAL1 PE=3 SV=1 46 420 4.0E-67
sp|A1CJ18|DHH1_ASPCL ATP-dependent RNA helicase dhh1 OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=dhh1 PE=3 SV=1 47 412 5.0E-67
sp|Q0DBS1|RH51_ORYSJ Putative DEAD-box ATP-dependent RNA helicase 51 OS=Oryza sativa subsp. japonica GN=Os06g0535100 PE=3 SV=2 45 403 5.0E-67
sp|A1CTZ6|DBP10_ASPCL ATP-dependent RNA helicase dbp10 OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=dbp10 PE=3 SV=1 11 408 5.0E-67
sp|A7TGW7|DBP10_VANPO ATP-dependent RNA helicase DBP10 OS=Vanderwaltozyma polyspora (strain ATCC 22028 / DSM 70294) GN=DBP10 PE=3 SV=1 46 408 6.0E-67
sp|Q09181|DHH1_SCHPO Putative ATP-dependent RNA helicase ste13 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ste13 PE=3 SV=1 47 412 6.0E-67
sp|Q5U526|I4A3A_XENLA Eukaryotic initiation factor 4A-III-A OS=Xenopus laevis GN=eif4a3-a PE=2 SV=1 28 412 6.0E-67
sp|Q54KG1|DDX41_DICDI Probable ATP-dependent RNA helicase ddx41 OS=Dictyostelium discoideum GN=ddx41 PE=1 SV=1 38 395 6.0E-67
sp|Q4PHU9|DBP2_USTMA ATP-dependent RNA helicase DBP2 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=DBP2 PE=3 SV=2 38 418 7.0E-67
sp|Q6BJX6|DHH1_DEBHA ATP-dependent RNA helicase DHH1 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=DHH1 PE=3 SV=2 45 412 7.0E-67
sp|Q54CE0|DDX17_DICDI Probable ATP-dependent RNA helicase ddx17 OS=Dictyostelium discoideum GN=ddx17 PE=3 SV=1 65 414 7.0E-67
sp|Q1DTB3|FAL1_COCIM ATP-dependent RNA helicase FAL1 OS=Coccidioides immitis (strain RS) GN=FAL1 PE=3 SV=2 38 412 7.0E-67
sp|A1D8G1|DHH1_NEOFI ATP-dependent RNA helicase dhh1 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=dhh1 PE=3 SV=1 47 412 7.0E-67
sp|Q5JK84|RH15_ORYSJ DEAD-box ATP-dependent RNA helicase 15 OS=Oryza sativa subsp. japonica GN=Os01g0550000 PE=2 SV=1 47 390 7.0E-67
sp|P20447|DBP3_YEAST ATP-dependent RNA helicase DBP3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DBP3 PE=1 SV=2 53 396 8.0E-67
sp|Q4WWD3|DHH1_ASPFU ATP-dependent RNA helicase dhh1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=dhh1 PE=3 SV=1 47 412 8.0E-67
sp|Q9M2E0|RH12_ARATH DEAD-box ATP-dependent RNA helicase 12 OS=Arabidopsis thaliana GN=RH12 PE=2 SV=1 23 422 8.0E-67
sp|Q2R1M8|RH52C_ORYSJ DEAD-box ATP-dependent RNA helicase 52C OS=Oryza sativa subsp. japonica GN=Os11g0599500 PE=3 SV=1 38 396 8.0E-67
sp|A6RGE3|DBP2_AJECN ATP-dependent RNA helicase DBP2 OS=Ajellomyces capsulatus (strain NAm1 / WU24) GN=DBP2 PE=3 SV=1 31 390 1.0E-66
sp|Q0CBE1|DHH1_ASPTN ATP-dependent RNA helicase dhh1 OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=dhh1 PE=3 SV=1 10 412 1.0E-66
sp|Q80Y44|DDX10_MOUSE Probable ATP-dependent RNA helicase DDX10 OS=Mus musculus GN=Ddx10 PE=1 SV=2 47 386 1.0E-66
sp|O00571|DDX3X_HUMAN ATP-dependent RNA helicase DDX3X OS=Homo sapiens GN=DDX3X PE=1 SV=3 35 396 1.0E-66
sp|P16381|DDX3L_MOUSE Putative ATP-dependent RNA helicase Pl10 OS=Mus musculus GN=D1Pas1 PE=1 SV=1 35 430 1.0E-66
sp|Q2U5A2|DHH1_ASPOR ATP-dependent RNA helicase dhh1 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=dhh1 PE=3 SV=1 13 412 1.0E-66
sp|A6QSQ0|FAL1_AJECN ATP-dependent RNA helicase FAL1 OS=Ajellomyces capsulatus (strain NAm1 / WU24) GN=FAL1 PE=3 SV=1 38 412 1.0E-66
sp|P46942|DB10_NICSY ATP-dependent RNA helicase-like protein DB10 OS=Nicotiana sylvestris PE=2 SV=1 39 431 1.0E-66
sp|A3LQ01|DED1_PICST ATP-dependent RNA helicase DED1 OS=Scheffersomyces stipitis (strain ATCC 58785 / CBS 6054 / NBRC 10063 / NRRL Y-11545) GN=DED1 PE=3 SV=3 56 391 1.0E-66
sp|P24346|DDX3_XENLA Putative ATP-dependent RNA helicase an3 OS=Xenopus laevis GN=an3 PE=2 SV=1 35 431 1.0E-66
sp|Q5BCU6|PRP28_EMENI Pre-mRNA-splicing ATP-dependent RNA helicase prp28 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=prp28 PE=3 SV=2 41 397 1.0E-66
sp|P21693|DBPA_ECOLI ATP-dependent RNA helicase DbpA OS=Escherichia coli (strain K12) GN=dbpA PE=1 SV=2 63 409 2.0E-66
sp|A6ZUA1|DBP3_YEAS7 ATP-dependent RNA helicase DBP3 OS=Saccharomyces cerevisiae (strain YJM789) GN=DBP3 PE=3 SV=1 53 396 2.0E-66
sp|Q109G2|RH12_ORYSJ DEAD-box ATP-dependent RNA helicase 12 OS=Oryza sativa subsp. japonica GN=Os10g0503700 PE=2 SV=2 13 414 2.0E-66
sp|Q4R3Q1|IF4A3_MACFA Eukaryotic initiation factor 4A-III OS=Macaca fascicularis GN=EIF4A3 PE=2 SV=3 28 412 2.0E-66
sp|A4RK80|PRP28_MAGO7 Pre-mRNA-splicing ATP-dependent RNA helicase PRP28 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=PRP28 PE=3 SV=1 41 406 2.0E-66
sp|Q0U7S9|DHH1_PHANO ATP-dependent RNA helicase DHH1 OS=Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) GN=DHH1 PE=3 SV=1 47 412 2.0E-66
sp|Q1E5R1|DHH1_COCIM ATP-dependent RNA helicase DHH1 OS=Coccidioides immitis (strain RS) GN=DHH1 PE=3 SV=1 47 412 2.0E-66
sp|Q7SEL0|PRP28_NEUCR Pre-mRNA-splicing ATP-dependent RNA helicase prp-28 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=prp-28 PE=3 SV=1 41 430 2.0E-66
sp|A2QY39|DHH1_ASPNC ATP-dependent RNA helicase dhh1 OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=dhh1 PE=3 SV=1 47 412 2.0E-66
sp|A6RJA2|PRP28_BOTFB Pre-mRNA-splicing ATP-dependent RNA helicase prp28 OS=Botryotinia fuckeliana (strain B05.10) GN=prp28 PE=3 SV=1 41 406 2.0E-66
sp|A6QUM7|DBP10_AJECN ATP-dependent RNA helicase DBP10 OS=Ajellomyces capsulatus (strain NAm1 / WU24) GN=DBP10 PE=3 SV=1 47 408 3.0E-66
sp|Q9LFN6|RH56_ARATH DEAD-box ATP-dependent RNA helicase 56 OS=Arabidopsis thaliana GN=RH56 PE=1 SV=2 32 414 3.0E-66
sp|Q56XG6|RH15_ARATH DEAD-box ATP-dependent RNA helicase 15 OS=Arabidopsis thaliana GN=RH15 PE=1 SV=3 32 414 3.0E-66
sp|Q8SRB2|DBP2_ENCCU ATP-dependent RNA helicase DBP2 OS=Encephalitozoon cuniculi (strain GB-M1) GN=DBP2 PE=3 SV=1 41 393 3.0E-66
sp|Q5Z6G5|RH35B_ORYSJ DEAD-box ATP-dependent RNA helicase 35B OS=Oryza sativa subsp. japonica GN=Os06g0697200 PE=3 SV=1 32 395 3.0E-66
sp|Q6C347|FAL1_YARLI ATP-dependent RNA helicase FAL1 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=FAL1 PE=3 SV=1 46 419 3.0E-66
sp|Q7ZVA6|IF4A3_DANRE Eukaryotic initiation factor 4A-III OS=Danio rerio GN=eif4a3 PE=2 SV=1 28 412 3.0E-66
sp|A7EGG4|PRP28_SCLS1 Pre-mRNA-splicing ATP-dependent RNA helicase prp28 OS=Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1) GN=prp28 PE=3 SV=1 41 435 3.0E-66
sp|Q62095|DDX3Y_MOUSE ATP-dependent RNA helicase DDX3Y OS=Mus musculus GN=Ddx3y PE=1 SV=2 35 396 4.0E-66
sp|Q0UWC8|PRP28_PHANO Pre-mRNA-splicing ATP-dependent RNA helicase PRP28 OS=Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) GN=PRP28 PE=3 SV=1 41 406 4.0E-66
sp|Q2H2J1|DBP4_CHAGB ATP-dependent RNA helicase DBP4 OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=DBP4 PE=3 SV=1 35 389 5.0E-66
sp|Q4R6M5|DDX5_MACFA Probable ATP-dependent RNA helicase DDX5 OS=Macaca fascicularis GN=DDX5 PE=2 SV=1 64 395 5.0E-66
sp|O00148|DX39A_HUMAN ATP-dependent RNA helicase DDX39A OS=Homo sapiens GN=DDX39A PE=1 SV=2 47 390 5.0E-66
sp|Q9LIH9|RH51_ARATH DEAD-box ATP-dependent RNA helicase 51 OS=Arabidopsis thaliana GN=RH51 PE=2 SV=1 46 403 5.0E-66
sp|Q62167|DDX3X_MOUSE ATP-dependent RNA helicase DDX3X OS=Mus musculus GN=Ddx3x PE=1 SV=3 35 422 6.0E-66
sp|Q61656|DDX5_MOUSE Probable ATP-dependent RNA helicase DDX5 OS=Mus musculus GN=Ddx5 PE=1 SV=2 64 395 6.0E-66
sp|Q5A4E2|DED1_CANAL ATP-dependent RNA helicase DED1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=DED1 PE=3 SV=1 35 391 6.0E-66
sp|Q5R4I9|DDX5_PONAB Probable ATP-dependent RNA helicase DDX5 OS=Pongo abelii GN=DDX5 PE=2 SV=1 64 395 6.0E-66
sp|P17844|DDX5_HUMAN Probable ATP-dependent RNA helicase DDX5 OS=Homo sapiens GN=DDX5 PE=1 SV=1 64 395 7.0E-66
sp|P39517|DHH1_YEAST ATP-dependent RNA helicase DHH1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DHH1 PE=1 SV=1 45 433 7.0E-66
sp|A6ZXG9|DHH1_YEAS7 ATP-dependent RNA helicase DHH1 OS=Saccharomyces cerevisiae (strain YJM789) GN=DHH1 PE=3 SV=1 45 433 7.0E-66
sp|Q9V3C0|DDX41_DROME ATP-dependent RNA helicase abstrakt OS=Drosophila melanogaster GN=abs PE=1 SV=1 39 391 7.0E-66
sp|Q6C0X2|DHH1_YARLI ATP-dependent RNA helicase DHH1 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=DHH1 PE=3 SV=1 47 414 8.0E-66
sp|Q13206|DDX10_HUMAN Probable ATP-dependent RNA helicase DDX10 OS=Homo sapiens GN=DDX10 PE=1 SV=2 47 386 8.0E-66
sp|A2QIL2|PRP28_ASPNC Pre-mRNA-splicing ATP-dependent RNA helicase prp28 OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=prp28 PE=3 SV=1 41 406 8.0E-66
sp|Q6FS54|DBP3_CANGA ATP-dependent RNA helicase DBP3 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=DBP3 PE=3 SV=1 61 396 8.0E-66
sp|A5DLR3|DBP10_PICGU ATP-dependent RNA helicase DBP10 OS=Meyerozyma guilliermondii (strain ATCC 6260 / CBS 566 / DSM 6381 / JCM 1539 / NBRC 10279 / NRRL Y-324) GN=DBP10 PE=3 SV=2 14 408 8.0E-66
sp|Q0CMM8|DBP10_ASPTN ATP-dependent RNA helicase dbp10 OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=dbp10 PE=3 SV=1 47 408 8.0E-66
sp|A5DIP0|DHH1_PICGU ATP-dependent RNA helicase DHH1 OS=Meyerozyma guilliermondii (strain ATCC 6260 / CBS 566 / DSM 6381 / JCM 1539 / NBRC 10279 / NRRL Y-324) GN=DHH1 PE=3 SV=1 45 414 9.0E-66
sp|Q4HW67|DHH1_GIBZE ATP-dependent RNA helicase DHH1 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=DHH1 PE=3 SV=1 65 412 9.0E-66
sp|Q9SZB4|RH43_ARATH Putative DEAD-box ATP-dependent RNA helicase 43 OS=Arabidopsis thaliana GN=RH43 PE=3 SV=1 31 396 1.0E-65
sp|Q0DM51|RH3_ORYSJ DEAD-box ATP-dependent RNA helicase 3, chloroplastic OS=Oryza sativa subsp. japonica GN=Os03g0827700 PE=2 SV=2 50 409 1.0E-65
sp|Q2GWJ5|FAL1_CHAGB ATP-dependent RNA helicase FAL1 OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=FAL1 PE=3 SV=1 46 402 1.0E-65
sp|Q8H136|RH14_ARATH DEAD-box ATP-dependent RNA helicase 14 OS=Arabidopsis thaliana GN=RH14 PE=1 SV=2 31 393 1.0E-65
sp|Q0UWA6|DED1_PHANO ATP-dependent RNA helicase DED1 OS=Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) GN=DED1 PE=3 SV=1 35 391 1.0E-65
sp|Q9VHS8|IF4A3_DROME Eukaryotic initiation factor 4A-III OS=Drosophila melanogaster GN=eIF4AIII PE=1 SV=1 39 412 1.0E-65
sp|Q2GQ93|DHH1_CHAGB ATP-dependent RNA helicase DHH1 OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=DHH1 PE=3 SV=1 47 412 1.0E-65
sp|Q0E3X4|RH35A_ORYSJ DEAD-box ATP-dependent RNA helicase 35A OS=Oryza sativa subsp. japonica GN=Os02g0150100 PE=2 SV=2 32 420 1.0E-65
sp|A5DU73|PRP28_LODEL Pre-mRNA-splicing ATP-dependent RNA helicase PRP28 OS=Lodderomyces elongisporus (strain ATCC 11503 / CBS 2605 / JCM 1781 / NBRC 1676 / NRRL YB-4239) GN=PRP28 PE=3 SV=1 38 404 1.0E-65
sp|Q9P6U9|DED1_NEUCR ATP-dependent RNA helicase ded1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=drh-9 PE=3 SV=1 35 391 2.0E-65
sp|Q2HBE7|DED1_CHAGB ATP-dependent RNA helicase DED1 OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=DED1 PE=3 SV=1 38 421 2.0E-65
sp|Q75BS4|DHH1_ASHGO ATP-dependent RNA helicase DHH1 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=DHH1 PE=3 SV=1 45 414 2.0E-65
sp|Q4P6N0|HAS1_USTMA ATP-dependent RNA helicase HAS1 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=HAS1 PE=3 SV=2 47 427 2.0E-65
sp|Q0UY62|DBP3_PHANO ATP-dependent RNA helicase DBP3 OS=Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) GN=DBP3 PE=3 SV=1 46 432 2.0E-65
sp|Q5AK59|HAS1_CANAL ATP-dependent RNA helicase HAS1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=HAS1 PE=3 SV=1 47 403 2.0E-65
sp|Q5U216|DX39A_RAT ATP-dependent RNA helicase DDX39A OS=Rattus norvegicus GN=Ddx39a PE=2 SV=1 47 390 2.0E-65
sp|Q6BLU9|PRP28_DEBHA Pre-mRNA-splicing ATP-dependent RNA helicase PRP28 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=PRP28 PE=3 SV=2 63 397 2.0E-65
sp|Q8VDW0|DX39A_MOUSE ATP-dependent RNA helicase DDX39A OS=Mus musculus GN=Ddx39a PE=1 SV=1 9 390 2.0E-65
sp|Q5AAW3|DHH1_CANAL ATP-dependent RNA helicase DHH1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=DHH1 PE=3 SV=1 45 412 2.0E-65
sp|A5A6J2|DDX5_PANTR Probable ATP-dependent RNA helicase DDX5 OS=Pan troglodytes GN=DDX5 PE=2 SV=1 64 395 2.0E-65
sp|Q6FQU5|DHH1_CANGA ATP-dependent RNA helicase DHH1 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=DHH1 PE=3 SV=1 45 412 3.0E-65
sp|Q10202|DBP3_SCHPO ATP-dependent RNA helicase dbp3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=dbp3 PE=3 SV=1 47 393 3.0E-65
sp|A3GFV3|FAL1_PICST ATP-dependent RNA helicase FAL1 OS=Scheffersomyces stipitis (strain ATCC 58785 / CBS 6054 / NBRC 10063 / NRRL Y-11545) GN=FAL1 PE=3 SV=1 46 419 3.0E-65
sp|Q7XMK8|RH6_ORYSJ DEAD-box ATP-dependent RNA helicase 6 OS=Oryza sativa subsp. japonica GN=Os04g0533000 PE=2 SV=1 47 422 3.0E-65
sp|Q6H7S2|RH8_ORYSJ DEAD-box ATP-dependent RNA helicase 8 OS=Oryza sativa subsp. japonica GN=Os02g0641800 PE=2 SV=2 6 422 3.0E-65
sp|A6R603|SUB2_AJECN ATP-dependent RNA helicase SUB2 OS=Ajellomyces capsulatus (strain NAm1 / WU24) GN=SUB2 PE=3 SV=2 47 412 3.0E-65
sp|Q6CIR0|DBP10_KLULA ATP-dependent RNA helicase DBP10 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=DBP10 PE=3 SV=1 14 408 3.0E-65
sp|P0CQ76|DBP2_CRYNJ ATP-dependent RNA helicase DBP2-A OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=DBP2 PE=3 SV=1 38 418 3.0E-65
sp|P0CQ77|DBP2_CRYNB ATP-dependent RNA helicase DBP2-A OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=DBP2 PE=3 SV=1 38 418 3.0E-65
sp|Q7S2N9|HAS1_NEUCR ATP-dependent RNA helicase has-1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=has-1 PE=3 SV=1 12 403 4.0E-65
sp|Q2HEB0|PRP28_CHAGB Pre-mRNA-splicing ATP-dependent RNA helicase PRP28 OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=PRP28 PE=3 SV=1 41 406 4.0E-65
sp|Q4WP13|DED1_ASPFU ATP-dependent RNA helicase ded1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=ded1 PE=3 SV=1 35 393 5.0E-65
sp|Q4IP34|PRP5_GIBZE Pre-mRNA-processing ATP-dependent RNA helicase PRP5 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=PRP5 PE=3 SV=2 32 390 6.0E-65
sp|Q5AF95|DBP4_CANAL ATP-dependent RNA helicase DBP4 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=DBP4 PE=3 SV=1 47 386 7.0E-65
sp|A6RY31|DHH1_BOTFB ATP-dependent RNA helicase dhh1 OS=Botryotinia fuckeliana (strain B05.10) GN=dhh1 PE=3 SV=1 47 412 8.0E-65
sp|Q4IEK8|HAS1_GIBZE ATP-dependent RNA helicase HAS1 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=HAS1 PE=3 SV=2 45 403 8.0E-65
sp|A1DNG2|DBP10_NEOFI ATP-dependent RNA helicase dbp10 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=dbp10 PE=3 SV=1 47 408 9.0E-65
sp|Q54Y81|DDX23_DICDI ATP-dependent RNA helicase ddx23 OS=Dictyostelium discoideum GN=helB2 PE=2 SV=1 40 414 9.0E-65
sp|Q2GMX1|HAS1_CHAGB ATP-dependent RNA helicase HAS1 OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=HAS1 PE=3 SV=1 10 403 9.0E-65
sp|A7EYW0|DBP3_SCLS1 ATP-dependent RNA helicase dbp3 OS=Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1) GN=dbp3 PE=3 SV=2 47 393 1.0E-64
sp|A2QRY2|DBP10_ASPNC ATP-dependent RNA helicase dbp10 OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=dbp10 PE=3 SV=1 47 408 1.0E-64
sp|Q2UGK3|DED1_ASPOR ATP-dependent RNA helicase ded1 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=ded1 PE=3 SV=1 35 391 1.0E-64
sp|A5E3K3|DBP4_LODEL ATP-dependent RNA helicase DBP4 OS=Lodderomyces elongisporus (strain ATCC 11503 / CBS 2605 / JCM 1781 / NBRC 1676 / NRRL YB-4239) GN=DBP4 PE=3 SV=1 5 386 1.0E-64
sp|Q10055|FAL1_SCHPO ATP-dependent RNA helicase fal1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=tif412 PE=1 SV=1 39 412 1.0E-64
sp|P0CQ82|DBP4_CRYNJ ATP-dependent RNA helicase DBP4 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=DBP4 PE=3 SV=1 47 395 1.0E-64
sp|P0CQ83|DBP4_CRYNB ATP-dependent RNA helicase DBP4 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=DBP4 PE=3 SV=1 47 395 1.0E-64
sp|Q6FJG1|FAL1_CANGA ATP-dependent RNA helicase FAL1 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=FAL1 PE=3 SV=1 46 418 1.0E-64
sp|A7TKR8|DED1_VANPO ATP-dependent RNA helicase DED1 OS=Vanderwaltozyma polyspora (strain ATCC 22028 / DSM 70294) GN=DED1 PE=3 SV=1 28 419 2.0E-64
sp|Q8NJM2|DBP10_ASPFU ATP-dependent RNA helicase dbp10 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=dbp10 PE=3 SV=1 47 408 2.0E-64
sp|Q2UHC1|DBP10_ASPOR ATP-dependent RNA helicase dbp10 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=dbp10 PE=3 SV=1 47 408 2.0E-64
sp|Q94BV4|RH6_ARATH DEAD-box ATP-dependent RNA helicase 6 OS=Arabidopsis thaliana GN=RH6 PE=2 SV=2 47 413 2.0E-64
sp|P0C2N7|DRS1_CHAGB ATP-dependent RNA helicase DRS1 OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=DRS1 PE=3 SV=1 46 427 2.0E-64
sp|Q6BXG0|DBP4_DEBHA ATP-dependent RNA helicase DBP4 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=DBP4 PE=3 SV=2 47 386 2.0E-64
sp|Q879Y6|RHLB_XYLFT ATP-dependent RNA helicase RhlB OS=Xylella fastidiosa (strain Temecula1 / ATCC 700964) GN=rhlB PE=3 SV=1 69 408 2.0E-64
sp|Q9VHP0|DDX3_DROME ATP-dependent RNA helicase bel OS=Drosophila melanogaster GN=bel PE=1 SV=1 35 391 3.0E-64
sp|A5DQS0|DED1_PICGU ATP-dependent RNA helicase DED1 OS=Meyerozyma guilliermondii (strain ATCC 6260 / CBS 566 / DSM 6381 / JCM 1539 / NBRC 10279 / NRRL Y-324) GN=DED1 PE=3 SV=3 56 393 3.0E-64
sp|Q6C9P3|DBP3_YARLI ATP-dependent RNA helicase DBP3 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=DBP3 PE=3 SV=1 65 396 3.0E-64
sp|Q3T147|DX39B_BOVIN Spliceosome RNA helicase DDX39B OS=Bos taurus GN=DDX39B PE=2 SV=1 47 414 3.0E-64
sp|Q6C024|PRP28_YARLI Pre-mRNA-splicing ATP-dependent RNA helicase PRP28 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=PRP28 PE=3 SV=1 63 416 3.0E-64
sp|Q7S5R1|DBP3_NEUCR ATP-dependent RNA helicase dbp-3 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=dbp-3 PE=3 SV=1 65 393 3.0E-64
sp|Q2HAD8|PRP5_CHAGB Pre-mRNA-processing ATP-dependent RNA helicase PRP5 OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=PRP5 PE=3 SV=1 16 391 3.0E-64
sp|Q2H4D0|SUB2_CHAGB ATP-dependent RNA helicase SUB2 OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=SUB2 PE=3 SV=1 47 414 3.0E-64
sp|P0CQ88|PRP28_CRYNJ Pre-mRNA-splicing ATP-dependent RNA helicase PRP28 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=PRP28 PE=3 SV=1 41 406 3.0E-64
sp|P0CQ89|PRP28_CRYNB Pre-mRNA-splicing ATP-dependent RNA helicase PRP28 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=PRP28 PE=3 SV=1 41 406 3.0E-64
sp|Q8LA13|RH11_ARATH DEAD-box ATP-dependent RNA helicase 11 OS=Arabidopsis thaliana GN=RH11 PE=1 SV=1 39 396 4.0E-64
sp|Q9C551|RH5_ARATH DEAD-box ATP-dependent RNA helicase 5 OS=Arabidopsis thaliana GN=RH5 PE=1 SV=1 32 390 4.0E-64
sp|Q5RF43|DDX3Y_PONAB ATP-dependent RNA helicase DDX3Y OS=Pongo abelii GN=DDX3Y PE=2 SV=1 35 396 4.0E-64
sp|Q9LUW5|RH53_ARATH DEAD-box ATP-dependent RNA helicase 53 OS=Arabidopsis thaliana GN=RH53 PE=2 SV=1 21 413 4.0E-64
sp|Q1DI07|SUB2_COCIM ATP-dependent RNA helicase SUB2 OS=Coccidioides immitis (strain RS) GN=SUB2 PE=3 SV=1 47 414 4.0E-64
sp|A1CMQ7|SUB2_ASPCL ATP-dependent RNA helicase sub2 OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=sub2 PE=3 SV=1 47 412 4.0E-64
sp|Q6FL17|SUB2_CANGA ATP-dependent RNA helicase SUB2 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=SUB2 PE=3 SV=1 24 414 4.0E-64
sp|A6QXC1|DBP3_AJECN ATP-dependent RNA helicase DBP3 OS=Ajellomyces capsulatus (strain NAm1 / WU24) GN=DBP3 PE=3 SV=1 64 396 5.0E-64
sp|Q6CB69|DED1_YARLI ATP-dependent RNA helicase DED1 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=DED1 PE=3 SV=1 35 391 5.0E-64
sp|Q75C76|DBP4_ASHGO ATP-dependent RNA helicase DBP4 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=DBP4 PE=3 SV=2 46 397 5.0E-64
sp|Q9UTP9|DBP4_SCHPO ATP-dependent RNA helicase dbp4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=dbp4 PE=1 SV=1 34 402 5.0E-64
sp|Q5ZHZ0|DX39B_CHICK Spliceosome RNA helicase DDX39B OS=Gallus gallus GN=DDX39B PE=2 SV=1 47 414 5.0E-64
sp|Q88NB7|RHLB_PSEPK ATP-dependent RNA helicase RhlB OS=Pseudomonas putida (strain KT2440) GN=rhlB PE=3 SV=1 39 408 5.0E-64
sp|A6SCT6|DBP3_BOTFB ATP-dependent RNA helicase dbp3 OS=Botryotinia fuckeliana (strain B05.10) GN=dbp3 PE=3 SV=1 64 393 6.0E-64
sp|O15523|DDX3Y_HUMAN ATP-dependent RNA helicase DDX3Y OS=Homo sapiens GN=DDX3Y PE=1 SV=2 35 396 6.0E-64
sp|Q4PFD9|PRP5_USTMA Pre-mRNA-processing ATP-dependent RNA helicase PRP5 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=PRP5 PE=3 SV=1 28 420 6.0E-64
sp|A5DWJ1|FAL1_LODEL ATP-dependent RNA helicase FAL1 OS=Lodderomyces elongisporus (strain ATCC 11503 / CBS 2605 / JCM 1781 / NBRC 1676 / NRRL YB-4239) GN=FAL1 PE=3 SV=1 45 419 6.0E-64
sp|Q2GUI4|DBP3_CHAGB ATP-dependent RNA helicase DBP3 OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=DBP3 PE=3 SV=1 64 393 7.0E-64
sp|Q5WR10|DX39B_CANLF Spliceosome RNA helicase DDX39B OS=Canis lupus familiaris GN=DDX39B PE=3 SV=1 47 414 7.0E-64
sp|A2R0B5|SUB2_ASPNC ATP-dependent RNA helicase sub2 OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=sub2 PE=3 SV=1 47 412 7.0E-64
sp|Q2H0R2|DBP10_CHAGB ATP-dependent RNA helicase DBP10 OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=DBP10 PE=3 SV=1 47 389 7.0E-64
sp|A2QI25|DED1_ASPNC ATP-dependent RNA helicase ded1 OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=ded1 PE=3 SV=1 35 391 7.0E-64
sp|A1CXK7|DED1_NEOFI ATP-dependent RNA helicase ded1 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=ded1 PE=3 SV=1 35 391 7.0E-64
sp|Q5RE47|DX39B_PONAB Spliceosome RNA helicase DDX39B OS=Pongo abelii GN=DDX39B PE=2 SV=1 47 414 8.0E-64
sp|Q29024|DX39B_PIG Spliceosome RNA helicase DDX39B OS=Sus scrofa GN=DDX39B PE=3 SV=2 47 414 8.0E-64
sp|P60024|DX39B_PANTR Spliceosome RNA helicase DDX39B OS=Pan troglodytes GN=DDX39B PE=3 SV=1 47 414 8.0E-64
sp|Q5TM17|DX39B_MACMU Spliceosome RNA helicase DDX39B OS=Macaca mulatta GN=DDX39B PE=3 SV=1 47 414 8.0E-64
sp|Q13838|DX39B_HUMAN Spliceosome RNA helicase DDX39B OS=Homo sapiens GN=DDX39B PE=1 SV=1 47 414 8.0E-64
sp|A7ESL7|DBP10_SCLS1 ATP-dependent RNA helicase dbp10 OS=Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1) GN=dbp10 PE=3 SV=2 47 394 8.0E-64
sp|Q63413|DX39B_RAT Spliceosome RNA helicase Ddx39b OS=Rattus norvegicus GN=Ddx39b PE=2 SV=3 47 414 8.0E-64
sp|Q9Z1N5|DX39B_MOUSE Spliceosome RNA helicase Ddx39b OS=Mus musculus GN=Ddx39b PE=1 SV=1 47 414 8.0E-64
sp|Q9PA24|RHLB_XYLFA ATP-dependent RNA helicase RhlB OS=Xylella fastidiosa (strain 9a5c) GN=rhlB PE=3 SV=2 37 408 9.0E-64
sp|A3LRW2|DBP3_PICST ATP-dependent RNA helicase DBP3 OS=Scheffersomyces stipitis (strain ATCC 58785 / CBS 6054 / NBRC 10063 / NRRL Y-11545) GN=DBP3 PE=3 SV=1 65 396 9.0E-64
sp|P24784|DBP1_YEAST ATP-dependent RNA helicase DBP1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DBP1 PE=1 SV=2 28 413 9.0E-64
sp|Q7S5D9|DHH1_NEUCR ATP-dependent RNA helicase dhh1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=drh-10 PE=3 SV=3 65 412 9.0E-64
sp|Q1DJF0|DED1_COCIM ATP-dependent RNA helicase DED1 OS=Coccidioides immitis (strain RS) GN=DED1 PE=3 SV=2 35 391 1.0E-63
sp|Q5A9Z6|FAL1_CANAL ATP-dependent RNA helicase FAL1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=FAL1 PE=3 SV=1 45 419 1.0E-63
sp|Q6BU54|DED1_DEBHA ATP-dependent RNA helicase DED1 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=DED1 PE=3 SV=1 35 391 1.0E-63
sp|A1DL85|SUB2_NEOFI ATP-dependent RNA helicase sub2 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=sub2 PE=3 SV=1 47 412 1.0E-63
sp|P0CQ72|FAL1_CRYNJ ATP-dependent RNA helicase FAL1 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=FAL1 PE=3 SV=1 39 418 1.0E-63
sp|P0CQ73|FAL1_CRYNB ATP-dependent RNA helicase FAL1 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=FAL1 PE=3 SV=1 39 418 1.0E-63
sp|A7TJ36|DBP3_VANPO ATP-dependent RNA helicase DBP3 OS=Vanderwaltozyma polyspora (strain ATCC 22028 / DSM 70294) GN=DBP3 PE=3 SV=1 53 396 1.0E-63
sp|Q757U8|DBP10_ASHGO ATP-dependent RNA helicase DBP10 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=DBP10 PE=3 SV=1 46 408 1.0E-63
sp|Q8L7S8|RH3_ARATH DEAD-box ATP-dependent RNA helicase 3, chloroplastic OS=Arabidopsis thaliana GN=RH3 PE=1 SV=2 50 405 1.0E-63
sp|A6ZPU3|DBP4_YEAS7 ATP-dependent RNA helicase DBP4 OS=Saccharomyces cerevisiae (strain YJM789) GN=DBP4 PE=3 SV=1 45 402 1.0E-63
sp|Q9LYJ9|RH46_ARATH DEAD-box ATP-dependent RNA helicase 46 OS=Arabidopsis thaliana GN=RH46 PE=2 SV=2 31 395 2.0E-63
sp|A6ZWD3|DBP1_YEAS7 ATP-dependent RNA helicase DBP1 OS=Saccharomyces cerevisiae (strain YJM789) GN=DBP1 PE=3 SV=1 28 413 2.0E-63
sp|Q6GVM6|DDX3Y_PANTR ATP-dependent RNA helicase DDX3Y OS=Pan troglodytes GN=DDX3Y PE=2 SV=1 35 430 2.0E-63
sp|Q8TFK8|DED1_CANGA ATP-dependent RNA helicase DED1 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=DED1 PE=3 SV=1 35 391 2.0E-63
sp|Q2U6P7|SUB2_ASPOR ATP-dependent RNA helicase sub2 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=sub2 PE=3 SV=1 47 412 2.0E-63
sp|Q1DZK8|DBP3_COCIM ATP-dependent RNA helicase DBP3 OS=Coccidioides immitis (strain RS) GN=DBP3 PE=3 SV=2 65 396 2.0E-63
sp|Q9LUW6|RH9_ARATH DEAD-box ATP-dependent RNA helicase 9 OS=Arabidopsis thaliana GN=RH9 PE=2 SV=1 49 413 2.0E-63
sp|Q8K4L0|DDX54_MOUSE ATP-dependent RNA helicase DDX54 OS=Mus musculus GN=Ddx54 PE=1 SV=1 47 418 3.0E-63
sp|P20448|DBP4_YEAST ATP-dependent RNA helicase HCA4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HCA4 PE=1 SV=2 45 402 3.0E-63
sp|Q84W89|RH37_ARATH DEAD-box ATP-dependent RNA helicase 37 OS=Arabidopsis thaliana GN=RH37 PE=2 SV=2 41 396 3.0E-63
sp|Q5VQL1|RH14_ORYSJ DEAD-box ATP-dependent RNA helicase 14 OS=Oryza sativa subsp. japonica GN=Os01g0172200 PE=2 SV=1 38 403 3.0E-63
sp|Q5JKF2|RH40_ORYSJ DEAD-box ATP-dependent RNA helicase 40 OS=Oryza sativa subsp. japonica GN=Os01g0549400 PE=2 SV=2 46 403 3.0E-63
sp|Q6CSZ7|DHH1_KLULA ATP-dependent RNA helicase DHH1 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=DHH1 PE=3 SV=1 45 414 3.0E-63
sp|Q6CRF4|DBP4_KLULA ATP-dependent RNA helicase DBP4 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=DBP4 PE=3 SV=1 47 397 3.0E-63
[Show less]

GO

GO Term Description Terminal node
GO:0003676 nucleic acid binding Yes
GO:0005524 ATP binding Yes
GO:0016787 hydrolase activity Yes
GO:0003677 DNA binding Yes
GO:0017076 purine nucleotide binding No
GO:0005488 binding No
GO:0003674 molecular_function No
GO:0035639 purine ribonucleoside triphosphate binding No
GO:0000166 nucleotide binding No
GO:0043167 ion binding No
GO:0032553 ribonucleotide binding No
GO:0097367 carbohydrate derivative binding No
GO:0003824 catalytic activity No
GO:0043168 anion binding No
GO:0097159 organic cyclic compound binding No
GO:1901265 nucleoside phosphate binding No
GO:0032555 purine ribonucleotide binding No
GO:1901363 heterocyclic compound binding No
GO:0032559 adenyl ribonucleotide binding No
GO:0036094 small molecule binding No
GO:0030554 adenyl nucleotide binding No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup2941
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|1909
Ophiocordyceps australis map64 (Brazil) OphauB2|3470 (this protein)
Ophiocordyceps camponoti-floridani Ophcf2|04576
Ophiocordyceps camponoti-rufipedis Ophun1|3940
Ophiocordyceps kimflemingae Ophio5|7143
Ophiocordyceps subramaniannii Hirsu2|4946

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|3470
MGNAKRRKVSHDDESSDDAIASPKPSADSATVDGAAVQEAPEAPKTFKDLGIVDSLCEACEALNYKHPTPIQEKS
IPVALQGRDIIGLAETGSGKTAAFALPMLQALLDKPQPLFGLVLAPTRELAAQIGQAFEALGSLISLRCAVIVGG
LDMVQQAIALGKKPHVIVATPGRLVDHLEKTKGFSLRTLKYLVMDEADRLLDMDFGPSIDKLLKFIPRERRTYLF
SATMSSKVESLQRASLRDPVKVSISFNKYQTVSTLLQHYIFIPQPRKDTYLIFLVNEFAGKSTIIFTRTVYEAQR
VAILLRTLGFGAIPLHGQLSQSARLGALNKFRAGNRDILVATDVAARGLDIPKVDLVLNYDLPQDSKTYIHRVGR
TARAGKSGIALSFVTQYDVELFQRIEAALGKKLDAYPTEKEEVMAFQLRVEEAQRHARVEMKAIIEGRDKXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXSGHVLDDSGHVLDDSGHVSSSIS
LFNCIFLQGY*
Coding >OphauB2|3470
ATGGGTAATGCCAAGCGCCGAAAAGTATCGCACGACGATGAATCCTCAGACGATGCAATTGCGTCTCCCAAGCCC
TCGGCAGACTCTGCAACGGTAGACGGCGCAGCAGTCCAAGAAGCGCCAGAAGCTCCCAAAACATTCAAAGACTTG
GGCATCGTCGACTCGTTGTGTGAAGCCTGCGAAGCCCTCAACTATAAACACCCCACGCCCATTCAAGAAAAGTCA
ATCCCCGTGGCGCTTCAAGGCCGAGATATCATCGGCTTGGCCGAGACGGGCAGCGGCAAAACGGCAGCGTTTGCC
CTGCCCATGCTCCAGGCCTTGCTGGACAAGCCCCAGCCGCTCTTTGGCCTCGTGCTCGCCCCGACTCGAGAACTG
GCGGCGCAAATCGGGCAAGCCTTTGAAGCATTGGGCTCGCTCATTTCTTTGCGCTGCGCCGTCATTGTTGGCGGG
CTTGACATGGTGCAGCAGGCAATTGCGCTGGGAAAGAAGCCTCACGTCATTGTGGCGACGCCTGGGCGCCTGGTG
GACCATCTTGAAAAGACAAAGGGCTTTTCGCTGCGAACGCTAAAGTATCTCGTCATGGACGAGGCGGACCGGCTT
CTCGACATGGACTTTGGCCCGAGCATCGACAAGCTGCTCAAGTTTATCCCGCGCGAGCGGCGCACCTATCTCTTT
TCCGCAACCATGAGCTCCAAGGTGGAGAGTCTGCAGCGGGCGAGTTTGCGCGACCCGGTCAAGGTTAGCATCAGC
TTCAACAAGTACCAGACGGTGTCGACGCTGCTGCAGCACTACATTTTCATCCCGCAGCCTCGCAAGGACACCTAT
CTCATCTTTCTTGTCAATGAGTTTGCAGGAAAGTCTACAATTATATTTACGCGCACCGTCTATGAGGCTCAGCGC
GTAGCCATTCTCCTGCGCACACTTGGCTTTGGCGCGATTCCGCTCCACGGCCAGCTCTCGCAATCGGCCCGCCTG
GGCGCCCTCAACAAGTTTCGTGCCGGCAACCGCGACATTTTGGTGGCGACCGACGTGGCGGCGCGAGGCCTCGAC
ATCCCCAAGGTTGACCTGGTGCTCAACTACGACTTGCCCCAAGACTCCAAGACGTATATCCACCGGGTGGGACGG
ACGGCACGTGCGGGCAAGTCGGGCATTGCGCTCAGCTTTGTCACGCAGTACGACGTGGAGCTCTTTCAGCGCATC
GAGGCTGCCCTGGGCAAGAAGCTGGATGCCTACCCTACAGAAAAGGAGGAGGTGATGGCGTTTCAGCTGCGCGTC
GAGGAGGCACAGCGGCATGCACGGGTGGAGATGAAGGCCATTATTGAGGGCCGGGATAAACNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNTCGGGCCATGTATTAGACGACTCGGGCCATGTATTAGACGACTCGGGCCATGTATCGTCCTCCATTTCT
CTTTTCAACTGCATTTTTCTACAAGGCTATTAA
Transcript >OphauB2|3470
ATGGGTAATGCCAAGCGCCGAAAAGTATCGCACGACGATGAATCCTCAGACGATGCAATTGCGTCTCCCAAGCCC
TCGGCAGACTCTGCAACGGTAGACGGCGCAGCAGTCCAAGAAGCGCCAGAAGCTCCCAAAACATTCAAAGACTTG
GGCATCGTCGACTCGTTGTGTGAAGCCTGCGAAGCCCTCAACTATAAACACCCCACGCCCATTCAAGAAAAGTCA
ATCCCCGTGGCGCTTCAAGGCCGAGATATCATCGGCTTGGCCGAGACGGGCAGCGGCAAAACGGCAGCGTTTGCC
CTGCCCATGCTCCAGGCCTTGCTGGACAAGCCCCAGCCGCTCTTTGGCCTCGTGCTCGCCCCGACTCGAGAACTG
GCGGCGCAAATCGGGCAAGCCTTTGAAGCATTGGGCTCGCTCATTTCTTTGCGCTGCGCCGTCATTGTTGGCGGG
CTTGACATGGTGCAGCAGGCAATTGCGCTGGGAAAGAAGCCTCACGTCATTGTGGCGACGCCTGGGCGCCTGGTG
GACCATCTTGAAAAGACAAAGGGCTTTTCGCTGCGAACGCTAAAGTATCTCGTCATGGACGAGGCGGACCGGCTT
CTCGACATGGACTTTGGCCCGAGCATCGACAAGCTGCTCAAGTTTATCCCGCGCGAGCGGCGCACCTATCTCTTT
TCCGCAACCATGAGCTCCAAGGTGGAGAGTCTGCAGCGGGCGAGTTTGCGCGACCCGGTCAAGGTTAGCATCAGC
TTCAACAAGTACCAGACGGTGTCGACGCTGCTGCAGCACTACATTTTCATCCCGCAGCCTCGCAAGGACACCTAT
CTCATCTTTCTTGTCAATGAGTTTGCAGGAAAGTCTACAATTATATTTACGCGCACCGTCTATGAGGCTCAGCGC
GTAGCCATTCTCCTGCGCACACTTGGCTTTGGCGCGATTCCGCTCCACGGCCAGCTCTCGCAATCGGCCCGCCTG
GGCGCCCTCAACAAGTTTCGTGCCGGCAACCGCGACATTTTGGTGGCGACCGACGTGGCGGCGCGAGGCCTCGAC
ATCCCCAAGGTTGACCTGGTGCTCAACTACGACTTGCCCCAAGACTCCAAGACGTATATCCACCGGGTGGGACGG
ACGGCACGTGCGGGCAAGTCGGGCATTGCGCTCAGCTTTGTCACGCAGTACGACGTGGAGCTCTTTCAGCGCATC
GAGGCTGCCCTGGGCAAGAAGCTGGATGCCTACCCTACAGAAAAGGAGGAGGTGATGGCGTTTCAGCTGCGCGTC
GAGGAGGCACAGCGGCATGCACGGGTGGAGATGAAGGCCATTATTGAGGGCCGGGATAAACNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNTCGGGCCATGTATTAGACGACTCGGGCCATGTATTAGACGACTCGGGCCATGTATCGTCCTCCATTTCT
CTTTTCAACTGCATTTTTCTACAAGGCTATTAA
Gene >OphauB2|3470
ATGGGTAATGCCAAGCGCCGAAAAGTATCGCACGACGATGAATCCTCAGACGATGCAATTGCGTCTCCCAAGCCC
TCGGCAGACTCTGCAACGGTAGACGGCGCAGCAGTCCAAGAAGCGCCAGAAGCTCCCAAAACATTCAAAGACTTG
GTCAGTACTTGGCCCAATAGCTCCAGCTCGGCTTTTTCTGTAGACGCAGACTTGGCACGAAAAGTGACCTTGGCC
TGGGAAATTTACTGACCAAGATTGTTGCTCAGGGCATCGTCGACTCGTTGTGTGAAGCCTGCGAAGCCCTCAACT
ATAAACACCCCACGCCCATTCAAGAAAAGTCAATCCCCGTGGCGCTTCAAGGCCGAGATATCATCGGCTTGGCCG
AGACGGGCAGCGGCAAAACGGCAGCGTTTGCCCTGCCCATGCTCCAGGCCTTGCTGGACAAGCCCCAGCCGCTCT
TTGGCCTCGTGCTCGCCCCGACTCGAGAACTGGCGGCGCAAATCGGGCAAGCCTTTGAAGCATTGGGCTCGCTCA
TTTCTTTGCGCTGCGCCGTCATTGTTGGCGGGCTTGACATGGTGCAGCAGGCAATTGCGCTGGGAAAGAAGCCTC
ACGTCATTGTGGCGACGCCTGGGCGCCTGGTGGACCATCTTGAAAAGACAAAGGGCTTTTCGCTGCGAACGCTAA
AGTATCTCGTCATGGACGAGGCGGACCGGCTTCTCGACATGGACTTTGGCCCGAGCATCGACAAGCTGCTCAAGT
TTATCCCGCGCGAGCGGCGCACCTATCTCTTTTCCGCAACCATGAGCTCCAAGGTGGAGAGTCTGCAGCGGGCGA
GTTTGCGCGACCCGGTCAAGGTTAGCATCAGCTTCAACAAGTACCAGACGGTGTCGACGCTGCTGCAGCACTACA
TTTTCATCCCGCAGCCTCGCAAGGACACCTATCTCATCTTTCTTGTCAATGAGTTTGCAGGAAAGTCTACAATTA
TATTTACGCGCACCGTCTATGAGGCTCAGCGCGTAGCCATTCTCCTGCGCACACTTGGCTTTGGCGCGATTCCGC
TCCACGGCCAGCTCTCGCAATCGGCCCGCCTGGGCGCCCTCAACAAGTTTCGTGCCGGCAACCGCGACATTTTGG
TGGCGACCGACGTGGCGGCGCGAGGCCTCGACATCCCCAAGGTTGACCTGGTGCTCAACTACGACTTGCCCCAAG
ACTCCAAGACGTATATCCACCGGGTGGGACGGACGGCACGTGCGGGCAAGTCGGGCATTGCGCTCAGCTTTGTCA
CGCAGTACGACGTGGAGCTCTTTCAGCGCATCGAGGCTGCCCTGGGCAAGAAGCTGGATGCCTACCCTACAGAAA
AGGAGGAGGTGATGGCGTTTCAGCTGCGCGTCGAGGAGGCACAGCGGCATGCACGGGTGGAGATGAAGGCCATTA
TTGAGGGCCGGGATAAACNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNTCGGGCCATGTATTAGACGACTCGGGCCATGTATTAG
ACGACTCGGGCCATGTATCGTCCTCCATTTCTCTTTTCAACTGCATTTTTCTACAAGGCTATTAA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail