Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|3470
Gene name
LocationContig_22:138361..140076
Strand-
Gene length (bp)1715
Transcript length (bp)1608
Coding sequence length (bp)1608
Protein length (aa) 536

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00270 DEAD DEAD/DEAH box helicase 2.6E-46 69 235
PF00271 Helicase_C Helicase conserved C-terminal domain 7.3E-31 275 380
PF04851 ResIII Type III restriction enzyme, res subunit 9.9E-05 89 229

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q4IFI0|RRP3_GIBZE ATP-dependent rRNA helicase RRP3 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=RRP3 PE=3 SV=1 1 445 0.0E+00
sp|A7EML8|RRP3_SCLS1 ATP-dependent rRNA helicase rrp3 OS=Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1) GN=rrp3 PE=3 SV=1 1 445 0.0E+00
sp|Q7RY59|RRP3_NEUCR ATP-dependent rRNA helicase rrp-3 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=rrp-3 PE=3 SV=1 28 445 0.0E+00
sp|Q2H1Q8|RRP3_CHAGB ATP-dependent rRNA helicase RRP3 OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=RRP3 PE=3 SV=1 3 445 0.0E+00
sp|A6RW56|RRP3_BOTFB ATP-dependent rRNA helicase rrp3 OS=Botryotinia fuckeliana (strain B05.10) GN=rrp3 PE=3 SV=1 22 445 0.0E+00
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q4IFI0|RRP3_GIBZE ATP-dependent rRNA helicase RRP3 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=RRP3 PE=3 SV=1 1 445 0.0E+00
sp|A7EML8|RRP3_SCLS1 ATP-dependent rRNA helicase rrp3 OS=Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1) GN=rrp3 PE=3 SV=1 1 445 0.0E+00
sp|Q7RY59|RRP3_NEUCR ATP-dependent rRNA helicase rrp-3 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=rrp-3 PE=3 SV=1 28 445 0.0E+00
sp|Q2H1Q8|RRP3_CHAGB ATP-dependent rRNA helicase RRP3 OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=RRP3 PE=3 SV=1 3 445 0.0E+00
sp|A6RW56|RRP3_BOTFB ATP-dependent rRNA helicase rrp3 OS=Botryotinia fuckeliana (strain B05.10) GN=rrp3 PE=3 SV=1 22 445 0.0E+00
sp|A1D405|RRP3_NEOFI ATP-dependent rRNA helicase rrp3 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=rrp3 PE=3 SV=1 1 443 0.0E+00
sp|Q1E1N5|RRP3_COCIM ATP-dependent rRNA helicase RRP3 OS=Coccidioides immitis (strain RS) GN=RRP3 PE=3 SV=1 1 445 0.0E+00
sp|Q4WJE9|RRP3_ASPFU ATP-dependent rRNA helicase rrp3 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=rrp3 PE=3 SV=1 1 443 0.0E+00
sp|A4RGD1|RRP3_MAGO7 ATP-dependent rRNA helicase RRP3 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=RRP3 PE=3 SV=1 11 445 0.0E+00
sp|A6QRQ7|RRP3_AJECN ATP-dependent rRNA helicase RRP3 OS=Ajellomyces capsulatus (strain NAm1 / WU24) GN=RRP3 PE=3 SV=1 37 443 0.0E+00
sp|A1CR32|RRP3_ASPCL ATP-dependent rRNA helicase rrp3 OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=rrp3 PE=3 SV=1 24 443 0.0E+00
sp|Q2UNB7|RRP3_ASPOR ATP-dependent rRNA helicase rrp3 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=rrp3 PE=3 SV=1 1 437 0.0E+00
sp|Q5B5E7|RRP3_EMENI ATP-dependent rRNA helicase rrp3 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=rrp3 PE=3 SV=1 1 443 0.0E+00
sp|A2RB17|RRP3_ASPNC ATP-dependent rRNA helicase rrp3 OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=rrp3 PE=3 SV=1 45 437 0.0E+00
sp|Q0CIQ3|RRP3_ASPTN ATP-dependent rRNA helicase rrp3 OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=rrp3 PE=3 SV=2 22 445 0.0E+00
sp|Q6CH58|RRP3_YARLI ATP-dependent rRNA helicase RRP3 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=RRP3 PE=3 SV=1 12 438 0.0E+00
sp|Q9P6N8|RRP3_SCHPO ATP-dependent rRNA helicase rrp3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rrp3 PE=3 SV=1 42 443 0.0E+00
sp|Q0UK12|RRP3_PHANO ATP-dependent rRNA helicase RRP3 OS=Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) GN=RRP3 PE=3 SV=2 45 443 0.0E+00
sp|Q9CWX9|DDX47_MOUSE Probable ATP-dependent RNA helicase DDX47 OS=Mus musculus GN=Ddx47 PE=2 SV=2 21 437 0.0E+00
sp|Q29S22|DDX47_BOVIN Probable ATP-dependent RNA helicase DDX47 OS=Bos taurus GN=DDX47 PE=2 SV=1 27 437 0.0E+00
sp|Q9H0S4|DDX47_HUMAN Probable ATP-dependent RNA helicase DDX47 OS=Homo sapiens GN=DDX47 PE=1 SV=1 20 437 0.0E+00
sp|Q4P3U9|RRP3_USTMA ATP-dependent rRNA helicase RRP3 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=RRP3 PE=3 SV=2 47 437 0.0E+00
sp|P34580|DDX47_CAEEL Putative ATP-dependent RNA helicase T26G10.1 OS=Caenorhabditis elegans GN=T26G10.1 PE=3 SV=1 45 443 0.0E+00
sp|P0CR00|RRP3_CRYNJ ATP-dependent rRNA helicase RRP3 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=RRP3 PE=3 SV=1 39 437 2.0E-178
sp|P0CR01|RRP3_CRYNB ATP-dependent rRNA helicase RRP3 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=RRP3 PE=3 SV=1 39 437 2.0E-178
sp|Q5ACU6|RRP3_CANAL ATP-dependent rRNA helicase RRP3 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=RRP3 PE=3 SV=2 45 439 3.0E-171
sp|Q6BQ61|RRP3_DEBHA ATP-dependent rRNA helicase RRP3 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=RRP3 PE=3 SV=2 45 444 5.0E-171
sp|A5DQF1|RRP3_PICGU ATP-dependent rRNA helicase RRP3 OS=Meyerozyma guilliermondii (strain ATCC 6260 / CBS 566 / DSM 6381 / JCM 1539 / NBRC 10279 / NRRL Y-324) GN=RRP3 PE=3 SV=2 46 445 6.0E-170
sp|Q54VT4|DDX47_DICDI Probable ATP-dependent RNA helicase ddx47 OS=Dictyostelium discoideum GN=ddx47 PE=3 SV=1 46 437 2.0E-168
sp|Q75EW9|RRP3_ASHGO ATP-dependent rRNA helicase RRP3 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=RRP3 PE=3 SV=2 5 436 2.0E-165
sp|A6ZSX1|RRP3_YEAS7 ATP-dependent rRNA helicase RRP3 OS=Saccharomyces cerevisiae (strain YJM789) GN=RRP3 PE=3 SV=1 42 436 4.0E-165
sp|P38712|RRP3_YEAST ATP-dependent rRNA helicase RRP3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RRP3 PE=1 SV=2 42 436 1.0E-164
sp|Q8GY84|RH10_ARATH DEAD-box ATP-dependent RNA helicase 10 OS=Arabidopsis thaliana GN=RH10 PE=2 SV=2 37 437 2.0E-164
sp|A7TS37|RRP3_VANPO ATP-dependent rRNA helicase RRP3 OS=Vanderwaltozyma polyspora (strain ATCC 22028 / DSM 70294) GN=RRP3 PE=3 SV=1 46 436 5.0E-164
sp|Q6CT85|RRP3_KLULA ATP-dependent rRNA helicase RRP3 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=RRP3 PE=3 SV=1 23 436 1.0E-163
sp|A3LS22|RRP3_PICST ATP-dependent rRNA helicase RRP3 OS=Scheffersomyces stipitis (strain ATCC 58785 / CBS 6054 / NBRC 10063 / NRRL Y-11545) GN=RRP3 PE=3 SV=3 46 441 8.0E-162
sp|Q6FNK8|RRP3_CANGA ATP-dependent rRNA helicase RRP3 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=RRP3 PE=3 SV=1 46 436 5.0E-161
sp|Q7Y183|RH10_ORYSJ DEAD-box ATP-dependent RNA helicase 10 OS=Oryza sativa subsp. japonica GN=Os03g0669000 PE=2 SV=1 33 437 2.0E-155
sp|A5E6W6|RRP3_LODEL ATP-dependent rRNA helicase RRP3 OS=Lodderomyces elongisporus (strain ATCC 11503 / CBS 2605 / JCM 1781 / NBRC 1676 / NRRL YB-4239) GN=RRP3 PE=3 SV=1 45 428 7.0E-137
sp|Q55BR9|DDX49_DICDI Probable ATP-dependent RNA helicase ddx49 OS=Dictyostelium discoideum GN=ddx49 PE=3 SV=1 45 439 5.0E-116
sp|Q9Y6V7|DDX49_HUMAN Probable ATP-dependent RNA helicase DDX49 OS=Homo sapiens GN=DDX49 PE=1 SV=1 47 438 7.0E-113
sp|Q9SA27|RH36_ARATH DEAD-box ATP-dependent RNA helicase 36 OS=Arabidopsis thaliana GN=RH36 PE=2 SV=1 3 442 2.0E-112
sp|Q4FZF3|DDX49_MOUSE Probable ATP-dependent RNA helicase DDX49 OS=Mus musculus GN=Ddx49 PE=2 SV=1 47 438 3.0E-111
sp|Q8L4E9|RH36_ORYSJ DEAD-box ATP-dependent RNA helicase 36 OS=Oryza sativa subsp. japonica GN=Os07g0633500 PE=3 SV=1 44 436 9.0E-105
sp|Q9HGM5|DBP8_SCHPO ATP-dependent RNA helicase dbp8 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=dbp8 PE=3 SV=1 45 436 8.0E-102
sp|Q8SR63|RRP3_ENCCU ATP-dependent rRNA helicase RRP3 OS=Encephalitozoon cuniculi (strain GB-M1) GN=RRP3 PE=3 SV=1 47 437 3.0E-101
sp|A5DLE0|DBP8_PICGU ATP-dependent RNA helicase DBP8 OS=Meyerozyma guilliermondii (strain ATCC 6260 / CBS 566 / DSM 6381 / JCM 1539 / NBRC 10279 / NRRL Y-324) GN=DBP8 PE=3 SV=2 46 409 2.0E-98
sp|A7TK63|DBP8_VANPO ATP-dependent RNA helicase DBP8 OS=Vanderwaltozyma polyspora (strain ATCC 22028 / DSM 70294) GN=DBP8 PE=3 SV=1 47 409 5.0E-98
sp|Q59PR3|DBP8_CANAL ATP-dependent RNA helicase DBP8 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=DBP8 PE=3 SV=1 46 409 8.0E-98
sp|A5E0U9|DBP8_LODEL ATP-dependent RNA helicase DBP8 OS=Lodderomyces elongisporus (strain ATCC 11503 / CBS 2605 / JCM 1781 / NBRC 1676 / NRRL YB-4239) GN=DBP8 PE=3 SV=1 44 409 4.0E-97
sp|Q6BGU8|DBP8_DEBHA ATP-dependent RNA helicase DBP8 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=DBP8 PE=3 SV=2 46 409 1.0E-96
sp|Q4I662|DBP8_GIBZE ATP-dependent RNA helicase DBP8 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=DBP8 PE=3 SV=1 39 444 2.0E-94
sp|Q756G5|DBP8_ASHGO ATP-dependent RNA helicase DBP8 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=DBP8 PE=3 SV=1 46 411 3.0E-94
sp|P38719|DBP8_YEAST ATP-dependent RNA helicase DBP8 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DBP8 PE=1 SV=1 47 408 4.0E-94
sp|A6ZT77|DBP8_YEAS7 ATP-dependent RNA helicase DBP8 OS=Saccharomyces cerevisiae (strain YJM789) GN=DBP8 PE=3 SV=1 47 408 4.0E-94
sp|Q6C799|DBP8_YARLI ATP-dependent RNA helicase DBP8 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=DBP8 PE=3 SV=1 46 438 1.0E-93
sp|A3LP87|DBP8_PICST ATP-dependent RNA helicase DBP8 OS=Scheffersomyces stipitis (strain ATCC 58785 / CBS 6054 / NBRC 10063 / NRRL Y-11545) GN=DBP8 PE=3 SV=2 46 409 9.0E-93
sp|Q6CXW0|DBP8_KLULA ATP-dependent RNA helicase DBP8 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=DBP8 PE=3 SV=1 47 411 1.0E-91
sp|Q9ZRZ8|RH28_ARATH DEAD-box ATP-dependent RNA helicase 28 OS=Arabidopsis thaliana GN=RH28 PE=2 SV=1 9 429 1.0E-91
sp|Q6FQZ0|DBP8_CANGA ATP-dependent RNA helicase DBP8 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=DBP8 PE=3 SV=1 45 408 1.0E-91
sp|Q0INC5|RH28_ORYSJ DEAD-box ATP-dependent RNA helicase 28 OS=Oryza sativa subsp. japonica GN=Os12g0481100 PE=2 SV=2 25 410 3.0E-91
sp|A6SFV4|DBP8_BOTFB ATP-dependent RNA helicase dbp8 OS=Botryotinia fuckeliana (strain B05.10) GN=dbp8 PE=3 SV=1 5 444 2.0E-90
sp|Q5L3G9|CSHA_GEOKA DEAD-box ATP-dependent RNA helicase CshA OS=Geobacillus kaustophilus (strain HTA426) GN=cshA PE=3 SV=1 46 425 2.0E-89
sp|A7E436|DBP8_SCLS1 ATP-dependent RNA helicase dbp8 OS=Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1) GN=dbp8 PE=3 SV=1 33 444 3.0E-89
sp|A1CKJ0|DBP8_ASPCL ATP-dependent RNA helicase dbp8 OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=dbp8 PE=3 SV=1 5 444 3.0E-89
sp|Q0U8V9|DBP8_PHANO ATP-dependent RNA helicase DBP8 OS=Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) GN=DBP8 PE=3 SV=1 2 444 1.0E-88
sp|Q63GX5|CSHA_BACCZ DEAD-box ATP-dependent RNA helicase CshA OS=Bacillus cereus (strain ZK / E33L) GN=cshA PE=3 SV=1 46 409 2.0E-88
sp|Q6HPE6|CSHA_BACHK DEAD-box ATP-dependent RNA helicase CshA OS=Bacillus thuringiensis subsp. konkukian (strain 97-27) GN=cshA PE=3 SV=1 46 409 2.0E-88
sp|Q81VG0|CSHA_BACAN DEAD-box ATP-dependent RNA helicase CshA OS=Bacillus anthracis GN=cshA PE=3 SV=1 46 409 2.0E-88
sp|A0R8U6|CSHA_BACAH DEAD-box ATP-dependent RNA helicase CshA OS=Bacillus thuringiensis (strain Al Hakam) GN=cshA PE=3 SV=1 46 409 2.0E-88
sp|Q73EU1|CSHA_BACC1 DEAD-box ATP-dependent RNA helicase CshA OS=Bacillus cereus (strain ATCC 10987 / NRS 248) GN=cshA PE=3 SV=1 46 409 2.0E-88
sp|Q81IT9|CSHA_BACCR DEAD-box ATP-dependent RNA helicase CshA OS=Bacillus cereus (strain ATCC 14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL B-3711) GN=cshA PE=2 SV=2 46 409 2.0E-88
sp|Q54TJ4|DDX27_DICDI Probable ATP-dependent RNA helicase ddx27 OS=Dictyostelium discoideum GN=ddx27 PE=3 SV=1 46 427 9.0E-88
sp|A5AA68|DBP8_ASPNC ATP-dependent RNA helicase dbp8 OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=dbp8 PE=3 SV=1 5 444 2.0E-87
sp|Q5B3H7|DBP8_EMENI ATP-dependent RNA helicase dbp8 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=dbp8 PE=3 SV=1 1 444 2.0E-87
sp|Q4WXW1|DBP8_ASPFU ATP-dependent RNA helicase dbp8 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=dbp8 PE=3 SV=1 42 444 2.0E-86
sp|A1D6X9|DBP8_NEOFI ATP-dependent RNA helicase dbp8 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=dbp8 PE=3 SV=1 42 444 3.0E-86
sp|Q0CZN5|DRS1_ASPTN ATP-dependent RNA helicase drs1 OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=drs1 PE=3 SV=1 12 393 1.0E-85
sp|Q2UQI6|DRS1_ASPOR ATP-dependent RNA helicase drs1 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=drs1 PE=3 SV=2 9 393 3.0E-85
sp|Q0V1Z7|DRS1_PHANO ATP-dependent RNA helicase DRS1 OS=Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) GN=DRS1 PE=3 SV=1 62 430 4.0E-85
sp|P0CR02|DBP8_CRYNJ ATP-dependent RNA helicase DBP8 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=DBP8 PE=3 SV=1 22 436 4.0E-85
sp|A7F4L5|DRS1_SCLS1 ATP-dependent RNA helicase drs1 OS=Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1) GN=drs1 PE=3 SV=1 10 427 5.0E-85
sp|Q4WRV2|DRS1_ASPFU ATP-dependent RNA helicase drs1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=drs1 PE=3 SV=1 45 398 1.0E-84
sp|A1D1R8|DRS1_NEOFI ATP-dependent RNA helicase drs1 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=drs1 PE=3 SV=1 40 398 1.0E-84
sp|Q07886|DDX49_DROME Probable ATP-dependent RNA helicase Dbp45A OS=Drosophila melanogaster GN=Dbp45A PE=2 SV=2 47 436 2.0E-84
sp|Q7RYZ7|DBP8_NEUCR ATP-dependent RNA helicase dbp-8 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=dbp-8 PE=3 SV=1 42 425 2.0E-84
sp|Q65N62|CSHA_BACLD DEAD-box ATP-dependent RNA helicase CshA OS=Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / NBRC 12200 / NCIMB 9375 / NRRL NRS-1264 / Gibson 46) GN=cshA PE=3 SV=1 46 409 3.0E-84
sp|P0CR03|DBP8_CRYNB ATP-dependent RNA helicase DBP8 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=DBP8 PE=3 SV=1 22 436 4.0E-84
sp|A1CNV8|DRS1_ASPCL ATP-dependent RNA helicase drs1 OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=drs1 PE=3 SV=1 17 393 7.0E-84
sp|Q0CNX1|DBP8_ASPTN ATP-dependent RNA helicase dbp8 OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=dbp8 PE=3 SV=1 7 444 1.0E-83
sp|P96614|CSHA_BACSU DEAD-box ATP-dependent RNA helicase CshA OS=Bacillus subtilis (strain 168) GN=cshA PE=1 SV=2 46 409 2.0E-83
sp|A2QAX7|DRS1_ASPNC ATP-dependent RNA helicase drs1 OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=drs1 PE=3 SV=1 18 393 3.0E-83
sp|Q49Z29|CSHA_STAS1 DEAD-box ATP-dependent RNA helicase CshA OS=Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229) GN=cshA PE=3 SV=1 45 419 4.0E-83
sp|A1A4H6|DDX27_BOVIN Probable ATP-dependent RNA helicase DDX27 OS=Bos taurus GN=DDX27 PE=2 SV=1 46 430 4.0E-83
sp|Q4I830|DRS1_GIBZE ATP-dependent RNA helicase DRS1 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=DRS1 PE=3 SV=1 46 422 8.0E-83
sp|Q7A0D2|CSHA_STAAW DEAD-box ATP-dependent RNA helicase CshA OS=Staphylococcus aureus (strain MW2) GN=cshA PE=3 SV=1 45 419 1.0E-82
sp|Q6G7M9|CSHA_STAAS DEAD-box ATP-dependent RNA helicase CshA OS=Staphylococcus aureus (strain MSSA476) GN=cshA PE=3 SV=1 45 419 1.0E-82
sp|Q7A4G0|CSHA_STAAN DEAD-box ATP-dependent RNA helicase CshA OS=Staphylococcus aureus (strain N315) GN=cshA PE=1 SV=1 45 419 1.0E-82
sp|Q99SH6|CSHA_STAAM DEAD-box ATP-dependent RNA helicase CshA OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=cshA PE=3 SV=1 45 419 1.0E-82
sp|Q5HEB9|CSHA_STAAC DEAD-box ATP-dependent RNA helicase CshA OS=Staphylococcus aureus (strain COL) GN=cshA PE=3 SV=1 45 419 1.0E-82
sp|Q2FWH5|CSHA_STAA8 DEAD-box ATP-dependent RNA helicase CshA OS=Staphylococcus aureus (strain NCTC 8325) GN=cshA PE=1 SV=1 45 419 1.0E-82
sp|Q2FF45|CSHA_STAA3 DEAD-box ATP-dependent RNA helicase CshA OS=Staphylococcus aureus (strain USA300) GN=cshA PE=3 SV=1 45 419 1.0E-82
sp|Q6GEZ3|CSHA_STAAR DEAD-box ATP-dependent RNA helicase CshA OS=Staphylococcus aureus (strain MRSA252) GN=cshA PE=3 SV=1 45 419 1.0E-82
sp|Q2YUH3|CSHA_STAAB DEAD-box ATP-dependent RNA helicase CshA OS=Staphylococcus aureus (strain bovine RF122 / ET3-1) GN=cshA PE=3 SV=1 45 419 2.0E-82
sp|Q96GQ7|DDX27_HUMAN Probable ATP-dependent RNA helicase DDX27 OS=Homo sapiens GN=DDX27 PE=1 SV=2 46 430 4.0E-82
sp|Q4L7W0|CSHA_STAHJ DEAD-box ATP-dependent RNA helicase CshA OS=Staphylococcus haemolyticus (strain JCSC1435) GN=cshA PE=3 SV=1 45 419 5.0E-82
sp|Q1E2B2|DRS1_COCIM ATP-dependent RNA helicase DRS1 OS=Coccidioides immitis (strain RS) GN=DRS1 PE=3 SV=1 39 393 5.0E-82
sp|Q09903|DRS1_SCHPO ATP-dependent RNA helicase drs1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=drs1 PE=3 SV=1 46 429 6.0E-82
sp|A4R8G3|DBP8_MAGO7 ATP-dependent RNA helicase DBP8 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=DBP8 PE=3 SV=3 3 425 7.0E-82
sp|Q8Y8N0|CSHA_LISMO ATP-dependent RNA helicase CshA OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=cshA PE=2 SV=1 47 425 1.0E-81
sp|A4QYM6|DRS1_MAGO7 ATP-dependent RNA helicase DRS1 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=DRS1 PE=3 SV=1 11 437 1.0E-81
sp|Q6FW42|DRS1_CANGA ATP-dependent RNA helicase DRS1 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=DRS1 PE=3 SV=1 8 395 2.0E-81
sp|Q1E0Z3|DBP8_COCIM ATP-dependent RNA helicase DBP8 OS=Coccidioides immitis (strain RS) GN=DBP8 PE=3 SV=1 5 444 2.0E-81
sp|P93008|RH21_ARATH DEAD-box ATP-dependent RNA helicase 21 OS=Arabidopsis thaliana GN=RH21 PE=2 SV=1 41 414 3.0E-81
sp|A6RUH2|DRS1_BOTFB ATP-dependent RNA helicase drs1 OS=Botryotinia fuckeliana (strain B05.10) GN=drs1 PE=3 SV=1 20 427 3.0E-81
sp|P0CQ92|DRS1_CRYNJ ATP-dependent RNA helicase DRS1 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=DRS1 PE=3 SV=1 26 427 5.0E-81
sp|P0CQ93|DRS1_CRYNB ATP-dependent RNA helicase DRS1 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=DRS1 PE=3 SV=1 26 427 5.0E-81
sp|A7TJM9|DRS1_VANPO ATP-dependent RNA helicase DRS1 OS=Vanderwaltozyma polyspora (strain ATCC 22028 / DSM 70294) GN=DRS1 PE=3 SV=1 46 389 9.0E-81
sp|Q5HME0|CSHA_STAEQ DEAD-box ATP-dependent RNA helicase CshA OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=cshA PE=3 SV=1 45 419 1.0E-80
sp|Q75F95|DRS1_ASHGO ATP-dependent RNA helicase DRS1 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=DRS1 PE=3 SV=1 46 391 4.0E-80
sp|Q8CRP6|CSHA_STAES DEAD-box ATP-dependent RNA helicase CshA OS=Staphylococcus epidermidis (strain ATCC 12228) GN=cshA PE=3 SV=1 45 419 4.0E-80
sp|Q921N6|DDX27_MOUSE Probable ATP-dependent RNA helicase DDX27 OS=Mus musculus GN=Ddx27 PE=1 SV=3 34 430 9.0E-80
sp|Q6CJV1|DRS1_KLULA ATP-dependent RNA helicase DRS1 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=DRS1 PE=3 SV=1 45 389 1.0E-79
sp|A3LSN3|DRS1_PICST ATP-dependent RNA helicase DRS1 OS=Scheffersomyces stipitis (strain ATCC 58785 / CBS 6054 / NBRC 10063 / NRRL Y-11545) GN=DRS1 PE=3 SV=3 46 389 2.0E-79
sp|B9XXL6|RHPA_HELP8 DEAD-box ATP-dependent RNA helicase RhpA OS=Helicobacter pylori (strain B128) GN=rhpA PE=1 SV=1 46 411 2.0E-79
sp|O25029|RHPA_HELPY DEAD-box ATP-dependent RNA helicase RhpA OS=Helicobacter pylori (strain ATCC 700392 / 26695) GN=rhpA PE=1 SV=1 32 411 3.0E-79
sp|Q6BTL5|DRS1_DEBHA ATP-dependent RNA helicase DRS1 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=DRS1 PE=3 SV=1 35 389 7.0E-79
sp|Q89AF9|DEAD_BUCBP ATP-dependent RNA helicase DeaD OS=Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp) GN=deaD PE=3 SV=1 46 436 7.0E-79
sp|P25888|RHLE_ECOLI ATP-dependent RNA helicase RhlE OS=Escherichia coli (strain K12) GN=rhlE PE=1 SV=3 46 408 1.0E-78
sp|P0C2N8|DRS1_NEUCR ATP-dependent RNA helicase drs1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=drh-11 PE=3 SV=1 46 393 1.0E-78
sp|A5DKW3|DRS1_PICGU ATP-dependent RNA helicase DRS1 OS=Meyerozyma guilliermondii (strain ATCC 6260 / CBS 566 / DSM 6381 / JCM 1539 / NBRC 10279 / NRRL Y-324) GN=DRS1 PE=3 SV=2 3 393 2.0E-78
sp|Q2UKX3|DBP8_ASPOR ATP-dependent RNA helicase dbp8 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=dbp8 PE=3 SV=1 50 444 2.0E-78
sp|Q9Z6C9|CSHA_LACRE ATP-dependent RNA helicase CshA OS=Lactobacillus reuteri GN=cshA PE=3 SV=1 47 401 2.0E-78
sp|P57453|DEAD_BUCAI ATP-dependent RNA helicase DeaD OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS) GN=deaD PE=3 SV=1 46 438 3.0E-78
sp|Q814I2|DBPA_BACCR ATP-dependent RNA helicase DbpA OS=Bacillus cereus (strain ATCC 14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL B-3711) GN=dbpA PE=2 SV=1 43 433 1.0E-77
sp|Q8W4R3|RH30_ARATH DEAD-box ATP-dependent RNA helicase 30 OS=Arabidopsis thaliana GN=RH30 PE=2 SV=2 38 399 2.0E-77
sp|P32892|DRS1_YEAST ATP-dependent RNA helicase DRS1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DRS1 PE=1 SV=2 39 391 4.0E-77
sp|A7A0P8|DRS1_YEAS7 ATP-dependent RNA helicase DRS1 OS=Saccharomyces cerevisiae (strain YJM789) GN=DRS1 PE=3 SV=1 39 391 4.0E-77
sp|Q8K9H6|DEAD_BUCAP ATP-dependent RNA helicase DeaD OS=Buchnera aphidicola subsp. Schizaphis graminum (strain Sg) GN=deaD PE=3 SV=1 46 420 4.0E-77
sp|Q9C718|RH20_ARATH DEAD-box ATP-dependent RNA helicase 20 OS=Arabidopsis thaliana GN=RH20 PE=2 SV=1 31 390 6.0E-77
sp|Q5ACK7|DRS1_CANAL ATP-dependent RNA helicase DRS1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=DRS1 PE=3 SV=1 46 395 1.0E-76
sp|P0A9P8|DEAD_SHIFL ATP-dependent RNA helicase DeaD OS=Shigella flexneri GN=deaD PE=3 SV=2 42 404 2.0E-76
sp|P0A9P6|DEAD_ECOLI ATP-dependent RNA helicase DeaD OS=Escherichia coli (strain K12) GN=deaD PE=1 SV=2 42 404 2.0E-76
sp|P0A9P7|DEAD_ECOL6 ATP-dependent RNA helicase DeaD OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=deaD PE=3 SV=2 42 404 2.0E-76
sp|Q8XA87|DEAD_ECO57 ATP-dependent RNA helicase DeaD OS=Escherichia coli O157:H7 GN=deaD PE=3 SV=3 42 404 3.0E-76
sp|A2YV85|RH29_ORYSI DEAD-box ATP-dependent RNA helicase 29 OS=Oryza sativa subsp. indica GN=OsI_028228 PE=2 SV=2 15 428 5.0E-76
sp|P0A4D8|CSHA_STRR6 DEAD-box ATP-dependent RNA helicase CshA OS=Streptococcus pneumoniae (strain ATCC BAA-255 / R6) GN=cshA PE=3 SV=1 47 408 6.0E-76
sp|P0A4D7|CSHA_STRPN DEAD-box ATP-dependent RNA helicase CshA OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) GN=cshA PE=3 SV=1 47 408 6.0E-76
sp|A3BT52|RH29_ORYSJ DEAD-box ATP-dependent RNA helicase 29 OS=Oryza sativa subsp. japonica GN=Os08g0416100 PE=2 SV=2 15 428 1.0E-75
sp|P9WH05|DEAD_MYCTU ATP-dependent RNA helicase DeaD OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=deaD PE=1 SV=1 46 408 3.0E-75
sp|P9WH04|DEAD_MYCTO ATP-dependent RNA helicase DeaD OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=deaD PE=3 SV=1 46 408 3.0E-75
sp|A5DY34|DRS1_LODEL ATP-dependent RNA helicase DRS1 OS=Lodderomyces elongisporus (strain ATCC 11503 / CBS 2605 / JCM 1781 / NBRC 1676 / NRRL YB-4239) GN=DRS1 PE=3 SV=1 45 389 3.0E-75
sp|Q5QMN3|RH20_ORYSJ DEAD-box ATP-dependent RNA helicase 20 OS=Oryza sativa subsp. japonica GN=Os01g0197200 PE=3 SV=2 31 390 5.0E-75
sp|P33906|DEAD_KLEPN ATP-dependent RNA helicase DeaD OS=Klebsiella pneumoniae GN=deaD PE=3 SV=3 46 404 6.0E-75
sp|Q1EB31|DBP4_COCIM ATP-dependent RNA helicase DBP4 OS=Coccidioides immitis (strain RS) GN=DBP4 PE=3 SV=1 45 401 7.0E-75
sp|P42305|DBPA_BACSU ATP-dependent RNA helicase DbpA OS=Bacillus subtilis (strain 168) GN=dbpA PE=1 SV=2 47 416 2.0E-74
sp|A7ESL8|DBP4_SCLS1 ATP-dependent RNA helicase dbp4 OS=Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1) GN=dbp4 PE=3 SV=1 45 401 5.0E-74
sp|Q6CGD1|DBP4_YARLI ATP-dependent RNA helicase DBP4 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=DBP4 PE=3 SV=1 32 402 6.0E-74
sp|Q9BUQ8|DDX23_HUMAN Probable ATP-dependent RNA helicase DDX23 OS=Homo sapiens GN=DDX23 PE=1 SV=3 29 404 7.0E-74
sp|Q9Y7T7|PRP28_SCHPO Pre-mRNA-splicing ATP-dependent RNA helicase prp28 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=prp28 PE=3 SV=1 41 434 9.0E-74
sp|Q6C7D2|HAS1_YARLI ATP-dependent RNA helicase HAS1 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=HAS1 PE=3 SV=1 29 403 2.0E-73
sp|Q53RK8|RH21_ORYSJ DEAD-box ATP-dependent RNA helicase 21 OS=Oryza sativa subsp. japonica GN=Os03g0708600 PE=2 SV=1 5 397 3.0E-73
sp|Q6CEB8|DRS1_YARLI ATP-dependent RNA helicase DRS1 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=DRS1 PE=3 SV=1 45 391 4.0E-73
sp|Q5RC67|DDX23_PONAB Probable ATP-dependent RNA helicase DDX23 OS=Pongo abelii GN=DDX23 PE=2 SV=1 29 404 4.0E-73
sp|P44586|DEAD_HAEIN ATP-dependent RNA helicase DeaD OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=deaD PE=3 SV=1 46 409 2.0E-72
sp|Q6FLF3|DBP2_CANGA ATP-dependent RNA helicase DBP2 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=DBP2 PE=3 SV=1 38 424 3.0E-72
sp|Q0DB53|RH52A_ORYSJ DEAD-box ATP-dependent RNA helicase 52A OS=Oryza sativa subsp. japonica GN=Os06g0602400 PE=2 SV=2 38 396 3.0E-72
sp|Q74Z73|HAS1_ASHGO ATP-dependent RNA helicase HAS1 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=HAS1 PE=3 SV=2 47 403 4.0E-72
sp|Q6CXB7|HAS1_KLULA ATP-dependent RNA helicase HAS1 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=HAS1 PE=3 SV=1 2 403 4.0E-72
sp|Q81DF9|CSHE_BACCR DEAD-box ATP-dependent RNA helicase CshE OS=Bacillus cereus (strain ATCC 14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL B-3711) GN=cshE PE=2 SV=1 45 405 5.0E-72
sp|A2QS00|DBP4_ASPNC ATP-dependent RNA helicase dbp4 OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=dbp4 PE=3 SV=1 42 389 5.0E-72
sp|Q4P9P3|DRS1_USTMA ATP-dependent RNA helicase DRS1 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=DRS1 PE=3 SV=1 43 398 6.0E-72
sp|Q59LU0|DBP2_CANAL ATP-dependent RNA helicase DBP2 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=DBP2 PE=3 SV=2 28 396 7.0E-72
sp|Q0CMM5|DBP4_ASPTN ATP-dependent RNA helicase dbp4 OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=dbp4 PE=3 SV=2 42 420 1.0E-71
sp|A1CTZ2|DBP4_ASPCL ATP-dependent RNA helicase dbp4 OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=dbp4 PE=3 SV=1 32 401 2.0E-71
sp|A1CIQ5|HAS1_ASPCL ATP-dependent RNA helicase has1 OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=has1 PE=3 SV=1 12 403 2.0E-71
sp|Q6FIL3|HAS1_CANGA ATP-dependent RNA helicase HAS1 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=HAS1 PE=3 SV=1 20 403 4.0E-71
sp|Q755N4|DBP2_ASHGO ATP-dependent RNA helicase DBP2 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=DBP2 PE=3 SV=2 38 396 4.0E-71
sp|A5DL80|DBP2_PICGU ATP-dependent RNA helicase DBP2 OS=Meyerozyma guilliermondii (strain ATCC 6260 / CBS 566 / DSM 6381 / JCM 1539 / NBRC 10279 / NRRL Y-324) GN=DBP2 PE=3 SV=3 41 396 4.0E-71
sp|Q5BBY1|HAS1_EMENI ATP-dependent RNA helicase has1 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=has1 PE=3 SV=1 28 403 7.0E-71
sp|Q4IAS1|DBP4_GIBZE ATP-dependent RNA helicase DBP4 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=DBP4 PE=3 SV=1 42 389 7.0E-71
sp|Q4WM60|DBP4_ASPFU ATP-dependent RNA helicase dbp4 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=dbp4 PE=3 SV=1 45 401 1.0E-70
sp|Q6Z4K6|RH52B_ORYSJ DEAD-box ATP-dependent RNA helicase 52B OS=Oryza sativa subsp. japonica GN=PL10B PE=2 SV=1 38 411 1.0E-70
sp|Q9SB89|RH27_ARATH DEAD-box ATP-dependent RNA helicase 27 OS=Arabidopsis thaliana GN=RH27 PE=2 SV=2 45 403 1.0E-70
sp|A1DNF9|DBP4_NEOFI ATP-dependent RNA helicase dbp4 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=dbp4 PE=3 SV=1 42 401 2.0E-70
sp|Q2UHB7|DBP4_ASPOR ATP-dependent RNA helicase dbp4 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=dbp4 PE=3 SV=1 42 389 2.0E-70
sp|Q03532|HAS1_YEAST ATP-dependent RNA helicase HAS1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HAS1 PE=1 SV=1 8 427 3.0E-70
sp|Q0UR48|HAS1_PHANO ATP-dependent RNA helicase HAS1 OS=Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) GN=HAS1 PE=3 SV=1 11 403 3.0E-70
sp|A1CW14|HAS1_NEOFI ATP-dependent RNA helicase has1 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=has1 PE=3 SV=1 12 403 4.0E-70
sp|Q7RZ35|DBP4_NEUCR ATP-dependent RNA helicase dbp-4 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=dbp-4 PE=3 SV=1 47 401 4.0E-70
sp|A4R8B5|HAS1_MAGO7 ATP-dependent RNA helicase HAS1 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=HAS1 PE=3 SV=2 12 403 5.0E-70
sp|Q6C4D4|DBP2_YARLI ATP-dependent RNA helicase DBP2 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=DBP2 PE=3 SV=1 41 391 6.0E-70
sp|O49289|RH29_ARATH Putative DEAD-box ATP-dependent RNA helicase 29 OS=Arabidopsis thaliana GN=RH29 PE=3 SV=1 47 416 7.0E-70
sp|Q54S03|DDX18_DICDI Probable ATP-dependent RNA helicase ddx18 OS=Dictyostelium discoideum GN=ddx18 PE=3 SV=1 47 427 7.0E-70
sp|P44701|SRMB_HAEIN ATP-dependent RNA helicase SrmB OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=srmB PE=3 SV=1 47 401 8.0E-70
sp|Q86XP3|DDX42_HUMAN ATP-dependent RNA helicase DDX42 OS=Homo sapiens GN=DDX42 PE=1 SV=1 32 403 9.0E-70
sp|Q1DMX8|PRP28_COCIM Pre-mRNA-splicing ATP-dependent RNA helicase PRP28 OS=Coccidioides immitis (strain RS) GN=PRP28 PE=3 SV=2 41 406 9.0E-70
sp|Q75HJ0|RH37_ORYSJ DEAD-box ATP-dependent RNA helicase 37 OS=Oryza sativa subsp. japonica GN=PL10A PE=2 SV=1 38 396 1.0E-69
sp|Q810A7|DDX42_MOUSE ATP-dependent RNA helicase DDX42 OS=Mus musculus GN=Ddx42 PE=1 SV=3 32 403 1.0E-69
sp|Q7ZY47|DDX42_XENLA ATP-dependent RNA helicase DDX42 OS=Xenopus laevis GN=ddx42 PE=2 SV=1 32 403 1.0E-69
sp|Q5BFU1|DBP4_EMENI ATP-dependent RNA helicase dbp4 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=dbp4 PE=3 SV=1 45 389 1.0E-69
sp|Q5R7D1|DDX42_PONAB ATP-dependent RNA helicase DDX42 OS=Pongo abelii GN=DDX42 PE=2 SV=1 32 403 1.0E-69
sp|A7E449|DBP2_SCLS1 ATP-dependent RNA helicase dbp2 OS=Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1) GN=dbp2 PE=3 SV=1 39 390 1.0E-69
sp|Q7S9J4|DBP10_NEUCR ATP-dependent RNA helicase dbp-10 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=dbp-10 PE=3 SV=1 1 408 2.0E-69
sp|Q55804|CRHR_SYNY3 RNA helicase CrhR OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=crhR PE=1 SV=1 46 409 2.0E-69
sp|A6SFW7|DBP2_BOTFB ATP-dependent RNA helicase dbp2 OS=Botryotinia fuckeliana (strain B05.10) GN=dbp2 PE=3 SV=2 39 390 2.0E-69
sp|Q9UJV9|DDX41_HUMAN Probable ATP-dependent RNA helicase DDX41 OS=Homo sapiens GN=DDX41 PE=1 SV=2 41 391 2.0E-69
sp|Q6FP38|DBP1_CANGA ATP-dependent RNA helicase DBP1 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=DBP1 PE=3 SV=1 35 433 2.0E-69
sp|Q6C7X8|DBP10_YARLI ATP-dependent RNA helicase DBP10 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=DBP10 PE=3 SV=1 35 408 3.0E-69
sp|Q5F485|DDX42_CHICK ATP-dependent RNA helicase DDX42 OS=Gallus gallus GN=DDX42 PE=2 SV=1 32 403 3.0E-69
sp|Q09916|HAS1_SCHPO ATP-dependent RNA helicase has1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=has1 PE=1 SV=1 47 403 3.0E-69
sp|A5DID7|HAS1_PICGU ATP-dependent RNA helicase HAS1 OS=Meyerozyma guilliermondii (strain ATCC 6260 / CBS 566 / DSM 6381 / JCM 1539 / NBRC 10279 / NRRL Y-324) GN=HAS1 PE=3 SV=2 35 403 3.0E-69
sp|Q54CD8|DDX54_DICDI ATP-dependent RNA helicase ddx54 OS=Dictyostelium discoideum GN=helA PE=3 SV=1 47 408 3.0E-69
sp|A6ZRX0|DBP2_YEAS7 ATP-dependent RNA helicase DBP2 OS=Saccharomyces cerevisiae (strain YJM789) GN=DBP2 PE=3 SV=1 14 391 4.0E-69
sp|Q6BY27|DBP2_DEBHA ATP-dependent RNA helicase DBP2 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=DBP2 PE=3 SV=1 41 396 5.0E-69
sp|P24783|DBP2_YEAST ATP-dependent RNA helicase DBP2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DBP2 PE=1 SV=1 14 391 5.0E-69
sp|Q54IV3|DDX42_DICDI Probable ATP-dependent RNA helicase ddx42 OS=Dictyostelium discoideum GN=ddx42 PE=3 SV=1 46 403 5.0E-69
sp|A5E2Z9|HAS1_LODEL ATP-dependent RNA helicase HAS1 OS=Lodderomyces elongisporus (strain ATCC 11503 / CBS 2605 / JCM 1781 / NBRC 1676 / NRRL YB-4239) GN=HAS1 PE=3 SV=1 13 403 5.0E-69
sp|Q91VN6|DDX41_MOUSE Probable ATP-dependent RNA helicase DDX41 OS=Mus musculus GN=Ddx41 PE=1 SV=2 41 391 5.0E-69
sp|Q58083|H669_METJA Probable ATP-dependent RNA helicase MJ0669 OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=MJ0669 PE=1 SV=1 46 408 5.0E-69
sp|Q8H0U8|RH42_ARATH DEAD-box ATP-dependent RNA helicase 42 OS=Arabidopsis thaliana GN=RH42 PE=1 SV=2 38 393 5.0E-69
sp|A2Q9T6|HAS1_ASPNC ATP-dependent RNA helicase has1 OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=has1 PE=3 SV=1 12 403 5.0E-69
sp|Q1EB38|DBP10_COCIM ATP-dependent RNA helicase DBP10 OS=Coccidioides immitis (strain RS) GN=DBP10 PE=3 SV=1 47 408 6.0E-69
sp|A5DF03|PRP28_PICGU Pre-mRNA-splicing ATP-dependent RNA helicase PRP28 OS=Meyerozyma guilliermondii (strain ATCC 6260 / CBS 566 / DSM 6381 / JCM 1539 / NBRC 10279 / NRRL Y-324) GN=PRP28 PE=3 SV=2 41 412 6.0E-69
sp|A4RGU2|DBP4_MAGO7 ATP-dependent RNA helicase DBP4 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=DBP4 PE=3 SV=1 44 389 6.0E-69
sp|Q501J6|DDX17_MOUSE Probable ATP-dependent RNA helicase DDX17 OS=Mus musculus GN=Ddx17 PE=1 SV=1 64 390 7.0E-69
sp|Q09719|DBP10_SCHPO ATP-dependent RNA helicase dbp10 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=dbp10 PE=1 SV=1 46 393 7.0E-69
sp|Q4I7F9|PRP28_GIBZE Pre-mRNA-splicing ATP-dependent RNA helicase PRP28 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=PRP28 PE=3 SV=1 41 406 7.0E-69
sp|Q95YF3|CGH1_CAEEL ATP-dependent RNA helicase cgh-1 OS=Caenorhabditis elegans GN=cgh-1 PE=1 SV=1 65 412 7.0E-69
sp|Q2U070|DBP2_ASPOR ATP-dependent RNA helicase dbp2 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=dbp2 PE=3 SV=1 41 390 1.0E-68
sp|Q5BFU7|DBP10_EMENI ATP-dependent RNA helicase dbp10 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=dbp10 PE=3 SV=1 13 408 1.0E-68
sp|Q2UUN6|HAS1_ASPOR ATP-dependent RNA helicase has1 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=has1 PE=3 SV=2 7 415 1.0E-68
sp|A1DGZ7|DBP2_NEOFI ATP-dependent RNA helicase dbp2 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=dbp2 PE=3 SV=1 31 390 1.0E-68
sp|Q0UMB9|DBP4_PHANO ATP-dependent RNA helicase DBP4 OS=Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) GN=DBP4 PE=3 SV=1 44 402 1.0E-68
sp|Q6CIV2|DBP2_KLULA ATP-dependent RNA helicase DBP2 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=DBP2 PE=3 SV=1 38 396 1.0E-68
sp|Q1DP69|DBP2_COCIM ATP-dependent RNA helicase DBP2 OS=Coccidioides immitis (strain RS) GN=DBP2 PE=3 SV=2 38 390 2.0E-68
sp|A7TGU7|DHH1_VANPO ATP-dependent RNA helicase DHH1 OS=Vanderwaltozyma polyspora (strain ATCC 22028 / DSM 70294) GN=DHH1 PE=3 SV=1 12 412 2.0E-68
sp|A1CHL3|PRP28_ASPCL Pre-mRNA-splicing ATP-dependent RNA helicase prp28 OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=prp28 PE=3 SV=1 41 406 2.0E-68
sp|A1CX72|PRP28_NEOFI Pre-mRNA-splicing ATP-dependent RNA helicase prp28 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=prp28 PE=3 SV=1 41 406 2.0E-68
sp|Q5GUR8|RHLB_XANOR ATP-dependent RNA helicase RhlB OS=Xanthomonas oryzae pv. oryzae (strain KACC10331 / KXO85) GN=rhlB PE=3 SV=2 46 416 2.0E-68
sp|Q1EA54|HAS1_COCIM ATP-dependent RNA helicase HAS1 OS=Coccidioides immitis (strain RS) GN=HAS1 PE=3 SV=1 9 403 2.0E-68
sp|Q5N7W4|RH30_ORYSJ DEAD-box ATP-dependent RNA helicase 30 OS=Oryza sativa subsp. japonica GN=Os01g0911100 PE=2 SV=2 31 390 2.0E-68
sp|A1C6C4|DBP2_ASPCL ATP-dependent RNA helicase dbp2 OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=dbp2 PE=3 SV=1 31 390 3.0E-68
sp|Q2H720|DBP2_CHAGB ATP-dependent RNA helicase DBP2 OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=DBP2 PE=3 SV=1 36 390 3.0E-68
sp|Q4WQM4|HAS1_ASPFU ATP-dependent RNA helicase has1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=has1 PE=3 SV=2 12 403 3.0E-68
sp|Q4P5U4|DBP4_USTMA ATP-dependent RNA helicase DBP4 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=DBP4 PE=3 SV=2 45 389 3.0E-68
sp|Q4WEB4|FAL1_ASPFU ATP-dependent RNA helicase fal1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=fal1 PE=3 SV=2 27 420 3.0E-68
sp|Q4WPE9|PRP28_ASPFU Pre-mRNA-splicing ATP-dependent RNA helicase prp28 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=prp28 PE=3 SV=1 41 406 4.0E-68
sp|O22907|RH24_ARATH DEAD-box ATP-dependent RNA helicase 24 OS=Arabidopsis thaliana GN=RH24 PE=1 SV=2 45 391 4.0E-68
sp|Q5B0J9|DBP2_EMENI ATP-dependent RNA helicase dbp2 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=dbp2 PE=3 SV=1 31 390 4.0E-68
sp|Q4TVV3|DDX46_DANRE Probable ATP-dependent RNA helicase DDX46 OS=Danio rerio GN=ddx46 PE=2 SV=1 40 419 5.0E-68
sp|Q92841|DDX17_HUMAN Probable ATP-dependent RNA helicase DDX17 OS=Homo sapiens GN=DDX17 PE=1 SV=2 64 390 5.0E-68
sp|Q2UAK1|FAL1_ASPOR ATP-dependent RNA helicase fal1 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=fal1 PE=3 SV=1 27 420 5.0E-68
sp|A1C595|FAL1_ASPCL ATP-dependent RNA helicase fal1 OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=fal1 PE=3 SV=1 38 420 6.0E-68
sp|B5FZY7|IF4A3_TAEGU Eukaryotic initiation factor 4A-III OS=Taeniopygia guttata GN=EIF4A3 PE=2 SV=1 28 412 6.0E-68
sp|O42226|I4A3B_XENLA Eukaryotic initiation factor 4A-III-B OS=Xenopus laevis GN=eif4a3-b PE=2 SV=1 28 412 6.0E-68
sp|A4QU31|FAL1_MAGO7 ATP-dependent RNA helicase FAL1 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=FAL1 PE=3 SV=1 46 420 7.0E-68
sp|P24782|DBP2_SCHPO ATP-dependent RNA helicase dbp2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=dbp2 PE=2 SV=2 41 390 7.0E-68
sp|A4RHF1|DED1_MAGO7 ATP-dependent RNA helicase DED1 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=DED1 PE=3 SV=2 35 393 7.0E-68
sp|Q6BH93|HAS1_DEBHA ATP-dependent RNA helicase HAS1 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=HAS1 PE=3 SV=1 46 415 7.0E-68
sp|Q0CAS8|FAL1_ASPTN ATP-dependent RNA helicase fal1 OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=fal1 PE=3 SV=1 38 420 7.0E-68
sp|Q5ZM36|IF4A3_CHICK Eukaryotic initiation factor 4A-III OS=Gallus gallus GN=EIF4A3 PE=2 SV=1 28 412 7.0E-68
sp|Q8Y7M8|DBPA_LISMO ATP-dependent RNA helicase DbpA OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=dbpA PE=2 SV=1 47 427 7.0E-68
sp|Q3BNH8|RHLB_XANC5 ATP-dependent RNA helicase RhlB OS=Xanthomonas campestris pv. vesicatoria (strain 85-10) GN=rhlB PE=3 SV=1 46 416 8.0E-68
sp|Q7SBC6|DBP2_NEUCR ATP-dependent RNA helicase dbp2 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=drh-1 PE=3 SV=2 38 390 8.0E-68
sp|Q8PFZ3|RHLB_XANAC ATP-dependent RNA helicase RhlB OS=Xanthomonas axonopodis pv. citri (strain 306) GN=rhlB PE=3 SV=1 46 416 8.0E-68
sp|A7EM88|FAL1_SCLS1 ATP-dependent RNA helicase fal1 OS=Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1) GN=fal1 PE=3 SV=1 43 412 8.0E-68
sp|Q3B8Q2|IF4A3_RAT Eukaryotic initiation factor 4A-III OS=Rattus norvegicus GN=Eif4a3 PE=1 SV=1 28 412 9.0E-68
sp|A6M931|IF4A3_PIG Eukaryotic initiation factor 4A-III OS=Sus scrofa GN=EIF4A3 PE=2 SV=1 28 412 9.0E-68
sp|Q2NL22|IF4A3_BOVIN Eukaryotic initiation factor 4A-III OS=Bos taurus GN=EIF4A3 PE=2 SV=3 28 412 9.0E-68
sp|Q10MH8|RH24_ORYSJ DEAD-box ATP-dependent RNA helicase 24 OS=Oryza sativa subsp. japonica GN=Os03g0308500 PE=2 SV=1 39 396 9.0E-68
sp|A5DAC8|DBP3_PICGU ATP-dependent RNA helicase DBP3 OS=Meyerozyma guilliermondii (strain ATCC 6260 / CBS 566 / DSM 6381 / JCM 1539 / NBRC 10279 / NRRL Y-324) GN=DBP3 PE=3 SV=2 65 396 9.0E-68
sp|Q8P4D4|RHLB_XANCP ATP-dependent RNA helicase RhlB OS=Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25) GN=rhlB PE=3 SV=1 46 416 9.0E-68
sp|B0RWT6|RHLB_XANCB ATP-dependent RNA helicase RhlB OS=Xanthomonas campestris pv. campestris (strain B100) GN=rhlB PE=3 SV=1 46 416 9.0E-68
sp|Q4UPY5|RHLB_XANC8 ATP-dependent RNA helicase RhlB OS=Xanthomonas campestris pv. campestris (strain 8004) GN=rhlB PE=3 SV=1 46 416 9.0E-68
sp|B7ZTW1|IF4A3_XENTR Eukaryotic initiation factor 4A-III OS=Xenopus tropicalis GN=eif4a3 PE=2 SV=1 28 412 9.0E-68
sp|P38919|IF4A3_HUMAN Eukaryotic initiation factor 4A-III OS=Homo sapiens GN=EIF4A3 PE=1 SV=4 28 412 9.0E-68
sp|Q91VC3|IF4A3_MOUSE Eukaryotic initiation factor 4A-III OS=Mus musculus GN=Eif4a3 PE=1 SV=3 28 412 9.0E-68
sp|A6S4N4|FAL1_BOTFB ATP-dependent RNA helicase fal1 OS=Botryotinia fuckeliana (strain B05.10) GN=fal1 PE=3 SV=1 43 412 9.0E-68
sp|Q9LU46|RH35_ARATH DEAD-box ATP-dependent RNA helicase 35 OS=Arabidopsis thaliana GN=RH35 PE=2 SV=1 41 395 1.0E-67
sp|A1D071|FAL1_NEOFI ATP-dependent RNA helicase fal1 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=fal1 PE=3 SV=1 38 420 1.0E-67
sp|Q0CZS8|HAS1_ASPTN ATP-dependent RNA helicase has1 OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=has1 PE=3 SV=1 13 389 1.0E-67
sp|A3LNR6|HAS1_PICST ATP-dependent RNA helicase HAS1 OS=Scheffersomyces stipitis (strain ATCC 58785 / CBS 6054 / NBRC 10063 / NRRL Y-11545) GN=HAS1 PE=3 SV=2 47 403 1.0E-67
sp|Q8RXK6|RH8_ARATH DEAD-box ATP-dependent RNA helicase 8 OS=Arabidopsis thaliana GN=RH8 PE=2 SV=1 13 422 1.0E-67
sp|A5AAE5|FAL1_ASPNC ATP-dependent RNA helicase fal1 OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=fal1 PE=3 SV=2 38 420 2.0E-67
sp|Q84UQ1|RH42_ORYSJ DEAD-box ATP-dependent RNA helicase 42 OS=Oryza sativa subsp. japonica GN=Os08g0159900 PE=2 SV=1 38 391 2.0E-67
sp|Q2UH00|PRP28_ASPOR Pre-mRNA-splicing ATP-dependent RNA helicase prp28 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=prp28 PE=3 SV=1 41 397 2.0E-67
sp|Q4X195|DBP2_ASPFU ATP-dependent RNA helicase dbp2 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=dbp2 PE=3 SV=2 31 390 2.0E-67
sp|A6SEH9|DED1_BOTFB ATP-dependent RNA helicase ded1 OS=Botryotinia fuckeliana (strain B05.10) GN=ded1 PE=3 SV=1 35 391 2.0E-67
sp|A7EJY3|DED1_SCLS1 ATP-dependent RNA helicase ded1 OS=Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1) GN=ded1 PE=3 SV=1 35 391 2.0E-67
sp|Q5AUL4|FAL1_EMENI ATP-dependent RNA helicase fal1 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=fal1 PE=3 SV=1 38 420 2.0E-67
sp|P0CQ84|HAS1_CRYNJ ATP-dependent RNA helicase HAS1 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=HAS1 PE=3 SV=1 5 426 2.0E-67
sp|P0CQ85|HAS1_CRYNB ATP-dependent RNA helicase HAS1 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=HAS1 PE=3 SV=1 5 426 2.0E-67
sp|A2QC74|DBP2_ASPNC ATP-dependent RNA helicase dbp2 OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=dbp2 PE=3 SV=1 38 390 2.0E-67
sp|A4R715|DHH1_MAGO7 ATP-dependent RNA helicase DHH1 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=DHH1 PE=3 SV=2 47 413 3.0E-67
sp|Q4I7K4|DED1_GIBZE ATP-dependent RNA helicase DED1 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=DED1 PE=3 SV=1 35 421 3.0E-67
sp|B5DG42|IF4A3_SALSA Eukaryotic initiation factor 4A-III OS=Salmo salar GN=eif4a3 PE=2 SV=1 28 412 3.0E-67
sp|Q4HZ42|DBP10_GIBZE ATP-dependent RNA helicase DBP10 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=DBP10 PE=3 SV=1 12 444 3.0E-67
sp|Q7SH33|PRP5_NEUCR Pre-mRNA-processing ATP-dependent RNA helicase prp-5 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=prp-5 PE=3 SV=1 41 404 3.0E-67
sp|Q9P735|FAL1_NEUCR ATP-dependent RNA helicase fal-1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=fal-1 PE=3 SV=2 46 412 3.0E-67
sp|A3LWX3|DHH1_PICST ATP-dependent RNA helicase DHH1 OS=Scheffersomyces stipitis (strain ATCC 58785 / CBS 6054 / NBRC 10063 / NRRL Y-11545) GN=DHH1 PE=3 SV=1 45 412 3.0E-67
sp|Q755A5|DBP3_ASHGO ATP-dependent RNA helicase DBP3 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=DBP3 PE=3 SV=1 61 432 3.0E-67
sp|Q4P184|FAL1_USTMA ATP-dependent RNA helicase FAL1 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=FAL1 PE=3 SV=1 39 419 4.0E-67
sp|Q4IF76|DBP2_GIBZE ATP-dependent RNA helicase DBP2 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=DBP2 PE=3 SV=1 12 390 4.0E-67
sp|Q54E49|DDX6_DICDI Probable ATP-dependent RNA helicase ddx6 OS=Dictyostelium discoideum GN=ddx6 PE=3 SV=1 12 412 4.0E-67
sp|A5DZE6|DED1_LODEL ATP-dependent RNA helicase DED1 OS=Lodderomyces elongisporus (strain ATCC 11503 / CBS 2605 / JCM 1781 / NBRC 1676 / NRRL YB-4239) GN=DED1 PE=3 SV=1 35 391 4.0E-67
sp|Q0JM17|RH56_ORYSJ DEAD-box ATP-dependent RNA helicase 56 OS=Oryza sativa subsp. japonica GN=Os01g0549700 PE=2 SV=2 47 390 4.0E-67
sp|A4QSS5|DBP2_MAGO7 ATP-dependent RNA helicase DBP2 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=DBP2 PE=3 SV=1 36 390 4.0E-67
sp|Q4IAA0|FAL1_GIBZE ATP-dependent RNA helicase FAL1 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=FAL1 PE=3 SV=1 46 420 4.0E-67
sp|A1CJ18|DHH1_ASPCL ATP-dependent RNA helicase dhh1 OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=dhh1 PE=3 SV=1 47 412 5.0E-67
sp|Q0DBS1|RH51_ORYSJ Putative DEAD-box ATP-dependent RNA helicase 51 OS=Oryza sativa subsp. japonica GN=Os06g0535100 PE=3 SV=2 45 403 5.0E-67
sp|A1CTZ6|DBP10_ASPCL ATP-dependent RNA helicase dbp10 OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=dbp10 PE=3 SV=1 11 408 5.0E-67
sp|A7TGW7|DBP10_VANPO ATP-dependent RNA helicase DBP10 OS=Vanderwaltozyma polyspora (strain ATCC 22028 / DSM 70294) GN=DBP10 PE=3 SV=1 46 408 6.0E-67
sp|Q09181|DHH1_SCHPO Putative ATP-dependent RNA helicase ste13 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ste13 PE=3 SV=1 47 412 6.0E-67
sp|Q5U526|I4A3A_XENLA Eukaryotic initiation factor 4A-III-A OS=Xenopus laevis GN=eif4a3-a PE=2 SV=1 28 412 6.0E-67
sp|Q54KG1|DDX41_DICDI Probable ATP-dependent RNA helicase ddx41 OS=Dictyostelium discoideum GN=ddx41 PE=1 SV=1 38 395 6.0E-67
sp|Q4PHU9|DBP2_USTMA ATP-dependent RNA helicase DBP2 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=DBP2 PE=3 SV=2 38 418 7.0E-67
sp|Q6BJX6|DHH1_DEBHA ATP-dependent RNA helicase DHH1 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=DHH1 PE=3 SV=2 45 412 7.0E-67
sp|Q54CE0|DDX17_DICDI Probable ATP-dependent RNA helicase ddx17 OS=Dictyostelium discoideum GN=ddx17 PE=3 SV=1 65 414 7.0E-67
sp|Q1DTB3|FAL1_COCIM ATP-dependent RNA helicase FAL1 OS=Coccidioides immitis (strain RS) GN=FAL1 PE=3 SV=2 38 412 7.0E-67
sp|A1D8G1|DHH1_NEOFI ATP-dependent RNA helicase dhh1 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=dhh1 PE=3 SV=1 47 412 7.0E-67
sp|Q5JK84|RH15_ORYSJ DEAD-box ATP-dependent RNA helicase 15 OS=Oryza sativa subsp. japonica GN=Os01g0550000 PE=2 SV=1 47 390 7.0E-67
sp|P20447|DBP3_YEAST ATP-dependent RNA helicase DBP3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DBP3 PE=1 SV=2 53 396 8.0E-67
sp|Q4WWD3|DHH1_ASPFU ATP-dependent RNA helicase dhh1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=dhh1 PE=3 SV=1 47 412 8.0E-67
sp|Q9M2E0|RH12_ARATH DEAD-box ATP-dependent RNA helicase 12 OS=Arabidopsis thaliana GN=RH12 PE=2 SV=1 23 422 8.0E-67
sp|Q2R1M8|RH52C_ORYSJ DEAD-box ATP-dependent RNA helicase 52C OS=Oryza sativa subsp. japonica GN=Os11g0599500 PE=3 SV=1 38 396 8.0E-67
sp|A6RGE3|DBP2_AJECN ATP-dependent RNA helicase DBP2 OS=Ajellomyces capsulatus (strain NAm1 / WU24) GN=DBP2 PE=3 SV=1 31 390 1.0E-66
sp|Q0CBE1|DHH1_ASPTN ATP-dependent RNA helicase dhh1 OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=dhh1 PE=3 SV=1 10 412 1.0E-66
sp|Q80Y44|DDX10_MOUSE Probable ATP-dependent RNA helicase DDX10 OS=Mus musculus GN=Ddx10 PE=1 SV=2 47 386 1.0E-66
sp|O00571|DDX3X_HUMAN ATP-dependent RNA helicase DDX3X OS=Homo sapiens GN=DDX3X PE=1 SV=3 35 396 1.0E-66
sp|P16381|DDX3L_MOUSE Putative ATP-dependent RNA helicase Pl10 OS=Mus musculus GN=D1Pas1 PE=1 SV=1 35 430 1.0E-66
sp|Q2U5A2|DHH1_ASPOR ATP-dependent RNA helicase dhh1 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=dhh1 PE=3 SV=1 13 412 1.0E-66
sp|A6QSQ0|FAL1_AJECN ATP-dependent RNA helicase FAL1 OS=Ajellomyces capsulatus (strain NAm1 / WU24) GN=FAL1 PE=3 SV=1 38 412 1.0E-66
sp|P46942|DB10_NICSY ATP-dependent RNA helicase-like protein DB10 OS=Nicotiana sylvestris PE=2 SV=1 39 431 1.0E-66
sp|A3LQ01|DED1_PICST ATP-dependent RNA helicase DED1 OS=Scheffersomyces stipitis (strain ATCC 58785 / CBS 6054 / NBRC 10063 / NRRL Y-11545) GN=DED1 PE=3 SV=3 56 391 1.0E-66
sp|P24346|DDX3_XENLA Putative ATP-dependent RNA helicase an3 OS=Xenopus laevis GN=an3 PE=2 SV=1 35 431 1.0E-66
sp|Q5BCU6|PRP28_EMENI Pre-mRNA-splicing ATP-dependent RNA helicase prp28 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=prp28 PE=3 SV=2 41 397 1.0E-66
sp|P21693|DBPA_ECOLI ATP-dependent RNA helicase DbpA OS=Escherichia coli (strain K12) GN=dbpA PE=1 SV=2 63 409 2.0E-66
sp|A6ZUA1|DBP3_YEAS7 ATP-dependent RNA helicase DBP3 OS=Saccharomyces cerevisiae (strain YJM789) GN=DBP3 PE=3 SV=1 53 396 2.0E-66
sp|Q109G2|RH12_ORYSJ DEAD-box ATP-dependent RNA helicase 12 OS=Oryza sativa subsp. japonica GN=Os10g0503700 PE=2 SV=2 13 414 2.0E-66
sp|Q4R3Q1|IF4A3_MACFA Eukaryotic initiation factor 4A-III OS=Macaca fascicularis GN=EIF4A3 PE=2 SV=3 28 412 2.0E-66
sp|A4RK80|PRP28_MAGO7 Pre-mRNA-splicing ATP-dependent RNA helicase PRP28 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=PRP28 PE=3 SV=1 41 406 2.0E-66
sp|Q0U7S9|DHH1_PHANO ATP-dependent RNA helicase DHH1 OS=Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) GN=DHH1 PE=3 SV=1 47 412 2.0E-66
sp|Q1E5R1|DHH1_COCIM ATP-dependent RNA helicase DHH1 OS=Coccidioides immitis (strain RS) GN=DHH1 PE=3 SV=1 47 412 2.0E-66
sp|Q7SEL0|PRP28_NEUCR Pre-mRNA-splicing ATP-dependent RNA helicase prp-28 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=prp-28 PE=3 SV=1 41 430 2.0E-66
sp|A2QY39|DHH1_ASPNC ATP-dependent RNA helicase dhh1 OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=dhh1 PE=3 SV=1 47 412 2.0E-66
sp|A6RJA2|PRP28_BOTFB Pre-mRNA-splicing ATP-dependent RNA helicase prp28 OS=Botryotinia fuckeliana (strain B05.10) GN=prp28 PE=3 SV=1 41 406 2.0E-66
sp|A6QUM7|DBP10_AJECN ATP-dependent RNA helicase DBP10 OS=Ajellomyces capsulatus (strain NAm1 / WU24) GN=DBP10 PE=3 SV=1 47 408 3.0E-66
sp|Q9LFN6|RH56_ARATH DEAD-box ATP-dependent RNA helicase 56 OS=Arabidopsis thaliana GN=RH56 PE=1 SV=2 32 414 3.0E-66
sp|Q56XG6|RH15_ARATH DEAD-box ATP-dependent RNA helicase 15 OS=Arabidopsis thaliana GN=RH15 PE=1 SV=3 32 414 3.0E-66
sp|Q8SRB2|DBP2_ENCCU ATP-dependent RNA helicase DBP2 OS=Encephalitozoon cuniculi (strain GB-M1) GN=DBP2 PE=3 SV=1 41 393 3.0E-66
sp|Q5Z6G5|RH35B_ORYSJ DEAD-box ATP-dependent RNA helicase 35B OS=Oryza sativa subsp. japonica GN=Os06g0697200 PE=3 SV=1 32 395 3.0E-66
sp|Q6C347|FAL1_YARLI ATP-dependent RNA helicase FAL1 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=FAL1 PE=3 SV=1 46 419 3.0E-66
sp|Q7ZVA6|IF4A3_DANRE Eukaryotic initiation factor 4A-III OS=Danio rerio GN=eif4a3 PE=2 SV=1 28 412 3.0E-66
sp|A7EGG4|PRP28_SCLS1 Pre-mRNA-splicing ATP-dependent RNA helicase prp28 OS=Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1) GN=prp28 PE=3 SV=1 41 435 3.0E-66
sp|Q62095|DDX3Y_MOUSE ATP-dependent RNA helicase DDX3Y OS=Mus musculus GN=Ddx3y PE=1 SV=2 35 396 4.0E-66
sp|Q0UWC8|PRP28_PHANO Pre-mRNA-splicing ATP-dependent RNA helicase PRP28 OS=Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) GN=PRP28 PE=3 SV=1 41 406 4.0E-66
sp|Q2H2J1|DBP4_CHAGB ATP-dependent RNA helicase DBP4 OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=DBP4 PE=3 SV=1 35 389 5.0E-66
sp|Q4R6M5|DDX5_MACFA Probable ATP-dependent RNA helicase DDX5 OS=Macaca fascicularis GN=DDX5 PE=2 SV=1 64 395 5.0E-66
sp|O00148|DX39A_HUMAN ATP-dependent RNA helicase DDX39A OS=Homo sapiens GN=DDX39A PE=1 SV=2 47 390 5.0E-66
sp|Q9LIH9|RH51_ARATH DEAD-box ATP-dependent RNA helicase 51 OS=Arabidopsis thaliana GN=RH51 PE=2 SV=1 46 403 5.0E-66
sp|Q62167|DDX3X_MOUSE ATP-dependent RNA helicase DDX3X OS=Mus musculus GN=Ddx3x PE=1 SV=3 35 422 6.0E-66
sp|Q61656|DDX5_MOUSE Probable ATP-dependent RNA helicase DDX5 OS=Mus musculus GN=Ddx5 PE=1 SV=2 64 395 6.0E-66
sp|Q5A4E2|DED1_CANAL ATP-dependent RNA helicase DED1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=DED1 PE=3 SV=1 35 391 6.0E-66
sp|Q5R4I9|DDX5_PONAB Probable ATP-dependent RNA helicase DDX5 OS=Pongo abelii GN=DDX5 PE=2 SV=1 64 395 6.0E-66
sp|P17844|DDX5_HUMAN Probable ATP-dependent RNA helicase DDX5 OS=Homo sapiens GN=DDX5 PE=1 SV=1 64 395 7.0E-66
sp|P39517|DHH1_YEAST ATP-dependent RNA helicase DHH1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DHH1 PE=1 SV=1 45 433 7.0E-66
sp|A6ZXG9|DHH1_YEAS7 ATP-dependent RNA helicase DHH1 OS=Saccharomyces cerevisiae (strain YJM789) GN=DHH1 PE=3 SV=1 45 433 7.0E-66
sp|Q9V3C0|DDX41_DROME ATP-dependent RNA helicase abstrakt OS=Drosophila melanogaster GN=abs PE=1 SV=1 39 391 7.0E-66
sp|Q6C0X2|DHH1_YARLI ATP-dependent RNA helicase DHH1 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=DHH1 PE=3 SV=1 47 414 8.0E-66
sp|Q13206|DDX10_HUMAN Probable ATP-dependent RNA helicase DDX10 OS=Homo sapiens GN=DDX10 PE=1 SV=2 47 386 8.0E-66
sp|A2QIL2|PRP28_ASPNC Pre-mRNA-splicing ATP-dependent RNA helicase prp28 OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=prp28 PE=3 SV=1 41 406 8.0E-66
sp|Q6FS54|DBP3_CANGA ATP-dependent RNA helicase DBP3 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=DBP3 PE=3 SV=1 61 396 8.0E-66
sp|A5DLR3|DBP10_PICGU ATP-dependent RNA helicase DBP10 OS=Meyerozyma guilliermondii (strain ATCC 6260 / CBS 566 / DSM 6381 / JCM 1539 / NBRC 10279 / NRRL Y-324) GN=DBP10 PE=3 SV=2 14 408 8.0E-66
sp|Q0CMM8|DBP10_ASPTN ATP-dependent RNA helicase dbp10 OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=dbp10 PE=3 SV=1 47 408 8.0E-66
sp|A5DIP0|DHH1_PICGU ATP-dependent RNA helicase DHH1 OS=Meyerozyma guilliermondii (strain ATCC 6260 / CBS 566 / DSM 6381 / JCM 1539 / NBRC 10279 / NRRL Y-324) GN=DHH1 PE=3 SV=1 45 414 9.0E-66
sp|Q4HW67|DHH1_GIBZE ATP-dependent RNA helicase DHH1 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=DHH1 PE=3 SV=1 65 412 9.0E-66
sp|Q9SZB4|RH43_ARATH Putative DEAD-box ATP-dependent RNA helicase 43 OS=Arabidopsis thaliana GN=RH43 PE=3 SV=1 31 396 1.0E-65
sp|Q0DM51|RH3_ORYSJ DEAD-box ATP-dependent RNA helicase 3, chloroplastic OS=Oryza sativa subsp. japonica GN=Os03g0827700 PE=2 SV=2 50 409 1.0E-65
sp|Q2GWJ5|FAL1_CHAGB ATP-dependent RNA helicase FAL1 OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=FAL1 PE=3 SV=1 46 402 1.0E-65
sp|Q8H136|RH14_ARATH DEAD-box ATP-dependent RNA helicase 14 OS=Arabidopsis thaliana GN=RH14 PE=1 SV=2 31 393 1.0E-65
sp|Q0UWA6|DED1_PHANO ATP-dependent RNA helicase DED1 OS=Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) GN=DED1 PE=3 SV=1 35 391 1.0E-65
sp|Q9VHS8|IF4A3_DROME Eukaryotic initiation factor 4A-III OS=Drosophila melanogaster GN=eIF4AIII PE=1 SV=1 39 412 1.0E-65
sp|Q2GQ93|DHH1_CHAGB ATP-dependent RNA helicase DHH1 OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=DHH1 PE=3 SV=1 47 412 1.0E-65
sp|Q0E3X4|RH35A_ORYSJ DEAD-box ATP-dependent RNA helicase 35A OS=Oryza sativa subsp. japonica GN=Os02g0150100 PE=2 SV=2 32 420 1.0E-65
sp|A5DU73|PRP28_LODEL Pre-mRNA-splicing ATP-dependent RNA helicase PRP28 OS=Lodderomyces elongisporus (strain ATCC 11503 / CBS 2605 / JCM 1781 / NBRC 1676 / NRRL YB-4239) GN=PRP28 PE=3 SV=1 38 404 1.0E-65
sp|Q9P6U9|DED1_NEUCR ATP-dependent RNA helicase ded1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=drh-9 PE=3 SV=1 35 391 2.0E-65
sp|Q2HBE7|DED1_CHAGB ATP-dependent RNA helicase DED1 OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=DED1 PE=3 SV=1 38 421 2.0E-65
sp|Q75BS4|DHH1_ASHGO ATP-dependent RNA helicase DHH1 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=DHH1 PE=3 SV=1 45 414 2.0E-65
sp|Q4P6N0|HAS1_USTMA ATP-dependent RNA helicase HAS1 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=HAS1 PE=3 SV=2 47 427 2.0E-65
sp|Q0UY62|DBP3_PHANO ATP-dependent RNA helicase DBP3 OS=Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) GN=DBP3 PE=3 SV=1 46 432 2.0E-65
sp|Q5AK59|HAS1_CANAL ATP-dependent RNA helicase HAS1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=HAS1 PE=3 SV=1 47 403 2.0E-65
sp|Q5U216|DX39A_RAT ATP-dependent RNA helicase DDX39A OS=Rattus norvegicus GN=Ddx39a PE=2 SV=1 47 390 2.0E-65
sp|Q6BLU9|PRP28_DEBHA Pre-mRNA-splicing ATP-dependent RNA helicase PRP28 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=PRP28 PE=3 SV=2 63 397 2.0E-65
sp|Q8VDW0|DX39A_MOUSE ATP-dependent RNA helicase DDX39A OS=Mus musculus GN=Ddx39a PE=1 SV=1 9 390 2.0E-65
sp|Q5AAW3|DHH1_CANAL ATP-dependent RNA helicase DHH1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=DHH1 PE=3 SV=1 45 412 2.0E-65
sp|A5A6J2|DDX5_PANTR Probable ATP-dependent RNA helicase DDX5 OS=Pan troglodytes GN=DDX5 PE=2 SV=1 64 395 2.0E-65
sp|Q6FQU5|DHH1_CANGA ATP-dependent RNA helicase DHH1 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=DHH1 PE=3 SV=1 45 412 3.0E-65
sp|Q10202|DBP3_SCHPO ATP-dependent RNA helicase dbp3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=dbp3 PE=3 SV=1 47 393 3.0E-65
sp|A3GFV3|FAL1_PICST ATP-dependent RNA helicase FAL1 OS=Scheffersomyces stipitis (strain ATCC 58785 / CBS 6054 / NBRC 10063 / NRRL Y-11545) GN=FAL1 PE=3 SV=1 46 419 3.0E-65
sp|Q7XMK8|RH6_ORYSJ DEAD-box ATP-dependent RNA helicase 6 OS=Oryza sativa subsp. japonica GN=Os04g0533000 PE=2 SV=1 47 422 3.0E-65
sp|Q6H7S2|RH8_ORYSJ DEAD-box ATP-dependent RNA helicase 8 OS=Oryza sativa subsp. japonica GN=Os02g0641800 PE=2 SV=2 6 422 3.0E-65
sp|A6R603|SUB2_AJECN ATP-dependent RNA helicase SUB2 OS=Ajellomyces capsulatus (strain NAm1 / WU24) GN=SUB2 PE=3 SV=2 47 412 3.0E-65
sp|Q6CIR0|DBP10_KLULA ATP-dependent RNA helicase DBP10 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=DBP10 PE=3 SV=1 14 408 3.0E-65
sp|P0CQ76|DBP2_CRYNJ ATP-dependent RNA helicase DBP2-A OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=DBP2 PE=3 SV=1 38 418 3.0E-65
sp|P0CQ77|DBP2_CRYNB ATP-dependent RNA helicase DBP2-A OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=DBP2 PE=3 SV=1 38 418 3.0E-65
sp|Q7S2N9|HAS1_NEUCR ATP-dependent RNA helicase has-1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=has-1 PE=3 SV=1 12 403 4.0E-65
sp|Q2HEB0|PRP28_CHAGB Pre-mRNA-splicing ATP-dependent RNA helicase PRP28 OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=PRP28 PE=3 SV=1 41 406 4.0E-65
sp|Q4WP13|DED1_ASPFU ATP-dependent RNA helicase ded1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=ded1 PE=3 SV=1 35 393 5.0E-65
sp|Q4IP34|PRP5_GIBZE Pre-mRNA-processing ATP-dependent RNA helicase PRP5 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=PRP5 PE=3 SV=2 32 390 6.0E-65
sp|Q5AF95|DBP4_CANAL ATP-dependent RNA helicase DBP4 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=DBP4 PE=3 SV=1 47 386 7.0E-65
sp|A6RY31|DHH1_BOTFB ATP-dependent RNA helicase dhh1 OS=Botryotinia fuckeliana (strain B05.10) GN=dhh1 PE=3 SV=1 47 412 8.0E-65
sp|Q4IEK8|HAS1_GIBZE ATP-dependent RNA helicase HAS1 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=HAS1 PE=3 SV=2 45 403 8.0E-65
sp|A1DNG2|DBP10_NEOFI ATP-dependent RNA helicase dbp10 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=dbp10 PE=3 SV=1 47 408 9.0E-65
sp|Q54Y81|DDX23_DICDI ATP-dependent RNA helicase ddx23 OS=Dictyostelium discoideum GN=helB2 PE=2 SV=1 40 414 9.0E-65
sp|Q2GMX1|HAS1_CHAGB ATP-dependent RNA helicase HAS1 OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=HAS1 PE=3 SV=1 10 403 9.0E-65
sp|A7EYW0|DBP3_SCLS1 ATP-dependent RNA helicase dbp3 OS=Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1) GN=dbp3 PE=3 SV=2 47 393 1.0E-64
sp|A2QRY2|DBP10_ASPNC ATP-dependent RNA helicase dbp10 OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=dbp10 PE=3 SV=1 47 408 1.0E-64
sp|Q2UGK3|DED1_ASPOR ATP-dependent RNA helicase ded1 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=ded1 PE=3 SV=1 35 391 1.0E-64
sp|A5E3K3|DBP4_LODEL ATP-dependent RNA helicase DBP4 OS=Lodderomyces elongisporus (strain ATCC 11503 / CBS 2605 / JCM 1781 / NBRC 1676 / NRRL YB-4239) GN=DBP4 PE=3 SV=1 5 386 1.0E-64
sp|Q10055|FAL1_SCHPO ATP-dependent RNA helicase fal1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=tif412 PE=1 SV=1 39 412 1.0E-64
sp|P0CQ82|DBP4_CRYNJ ATP-dependent RNA helicase DBP4 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=DBP4 PE=3 SV=1 47 395 1.0E-64
sp|P0CQ83|DBP4_CRYNB ATP-dependent RNA helicase DBP4 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=DBP4 PE=3 SV=1 47 395 1.0E-64
sp|Q6FJG1|FAL1_CANGA ATP-dependent RNA helicase FAL1 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=FAL1 PE=3 SV=1 46 418 1.0E-64
sp|A7TKR8|DED1_VANPO ATP-dependent RNA helicase DED1 OS=Vanderwaltozyma polyspora (strain ATCC 22028 / DSM 70294) GN=DED1 PE=3 SV=1 28 419 2.0E-64
sp|Q8NJM2|DBP10_ASPFU ATP-dependent RNA helicase dbp10 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=dbp10 PE=3 SV=1 47 408 2.0E-64
sp|Q2UHC1|DBP10_ASPOR ATP-dependent RNA helicase dbp10 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=dbp10 PE=3 SV=1 47 408 2.0E-64
sp|Q94BV4|RH6_ARATH DEAD-box ATP-dependent RNA helicase 6 OS=Arabidopsis thaliana GN=RH6 PE=2 SV=2 47 413 2.0E-64
sp|P0C2N7|DRS1_CHAGB ATP-dependent RNA helicase DRS1 OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=DRS1 PE=3 SV=1 46 427 2.0E-64
sp|Q6BXG0|DBP4_DEBHA ATP-dependent RNA helicase DBP4 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=DBP4 PE=3 SV=2 47 386 2.0E-64
sp|Q879Y6|RHLB_XYLFT ATP-dependent RNA helicase RhlB OS=Xylella fastidiosa (strain Temecula1 / ATCC 700964) GN=rhlB PE=3 SV=1 69 408 2.0E-64
sp|Q9VHP0|DDX3_DROME ATP-dependent RNA helicase bel OS=Drosophila melanogaster GN=bel PE=1 SV=1 35 391 3.0E-64
sp|A5DQS0|DED1_PICGU ATP-dependent RNA helicase DED1 OS=Meyerozyma guilliermondii (strain ATCC 6260 / CBS 566 / DSM 6381 / JCM 1539 / NBRC 10279 / NRRL Y-324) GN=DED1 PE=3 SV=3 56 393 3.0E-64
sp|Q6C9P3|DBP3_YARLI ATP-dependent RNA helicase DBP3 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=DBP3 PE=3 SV=1 65 396 3.0E-64
sp|Q3T147|DX39B_BOVIN Spliceosome RNA helicase DDX39B OS=Bos taurus GN=DDX39B PE=2 SV=1 47 414 3.0E-64
sp|Q6C024|PRP28_YARLI Pre-mRNA-splicing ATP-dependent RNA helicase PRP28 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=PRP28 PE=3 SV=1 63 416 3.0E-64
sp|Q7S5R1|DBP3_NEUCR ATP-dependent RNA helicase dbp-3 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=dbp-3 PE=3 SV=1 65 393 3.0E-64
sp|Q2HAD8|PRP5_CHAGB Pre-mRNA-processing ATP-dependent RNA helicase PRP5 OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=PRP5 PE=3 SV=1 16 391 3.0E-64
sp|Q2H4D0|SUB2_CHAGB ATP-dependent RNA helicase SUB2 OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=SUB2 PE=3 SV=1 47 414 3.0E-64
sp|P0CQ88|PRP28_CRYNJ Pre-mRNA-splicing ATP-dependent RNA helicase PRP28 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=PRP28 PE=3 SV=1 41 406 3.0E-64
sp|P0CQ89|PRP28_CRYNB Pre-mRNA-splicing ATP-dependent RNA helicase PRP28 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=PRP28 PE=3 SV=1 41 406 3.0E-64
sp|Q8LA13|RH11_ARATH DEAD-box ATP-dependent RNA helicase 11 OS=Arabidopsis thaliana GN=RH11 PE=1 SV=1 39 396 4.0E-64
sp|Q9C551|RH5_ARATH DEAD-box ATP-dependent RNA helicase 5 OS=Arabidopsis thaliana GN=RH5 PE=1 SV=1 32 390 4.0E-64
sp|Q5RF43|DDX3Y_PONAB ATP-dependent RNA helicase DDX3Y OS=Pongo abelii GN=DDX3Y PE=2 SV=1 35 396 4.0E-64
sp|Q9LUW5|RH53_ARATH DEAD-box ATP-dependent RNA helicase 53 OS=Arabidopsis thaliana GN=RH53 PE=2 SV=1 21 413 4.0E-64
sp|Q1DI07|SUB2_COCIM ATP-dependent RNA helicase SUB2 OS=Coccidioides immitis (strain RS) GN=SUB2 PE=3 SV=1 47 414 4.0E-64
sp|A1CMQ7|SUB2_ASPCL ATP-dependent RNA helicase sub2 OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=sub2 PE=3 SV=1 47 412 4.0E-64
sp|Q6FL17|SUB2_CANGA ATP-dependent RNA helicase SUB2 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=SUB2 PE=3 SV=1 24 414 4.0E-64
sp|A6QXC1|DBP3_AJECN ATP-dependent RNA helicase DBP3 OS=Ajellomyces capsulatus (strain NAm1 / WU24) GN=DBP3 PE=3 SV=1 64 396 5.0E-64
sp|Q6CB69|DED1_YARLI ATP-dependent RNA helicase DED1 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=DED1 PE=3 SV=1 35 391 5.0E-64
sp|Q75C76|DBP4_ASHGO ATP-dependent RNA helicase DBP4 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=DBP4 PE=3 SV=2 46 397 5.0E-64
sp|Q9UTP9|DBP4_SCHPO ATP-dependent RNA helicase dbp4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=dbp4 PE=1 SV=1 34 402 5.0E-64
sp|Q5ZHZ0|DX39B_CHICK Spliceosome RNA helicase DDX39B OS=Gallus gallus GN=DDX39B PE=2 SV=1 47 414 5.0E-64
sp|Q88NB7|RHLB_PSEPK ATP-dependent RNA helicase RhlB OS=Pseudomonas putida (strain KT2440) GN=rhlB PE=3 SV=1 39 408 5.0E-64
sp|A6SCT6|DBP3_BOTFB ATP-dependent RNA helicase dbp3 OS=Botryotinia fuckeliana (strain B05.10) GN=dbp3 PE=3 SV=1 64 393 6.0E-64
sp|O15523|DDX3Y_HUMAN ATP-dependent RNA helicase DDX3Y OS=Homo sapiens GN=DDX3Y PE=1 SV=2 35 396 6.0E-64
sp|Q4PFD9|PRP5_USTMA Pre-mRNA-processing ATP-dependent RNA helicase PRP5 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=PRP5 PE=3 SV=1 28 420 6.0E-64
sp|A5DWJ1|FAL1_LODEL ATP-dependent RNA helicase FAL1 OS=Lodderomyces elongisporus (strain ATCC 11503 / CBS 2605 / JCM 1781 / NBRC 1676 / NRRL YB-4239) GN=FAL1 PE=3 SV=1 45 419 6.0E-64
sp|Q2GUI4|DBP3_CHAGB ATP-dependent RNA helicase DBP3 OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=DBP3 PE=3 SV=1 64 393 7.0E-64
sp|Q5WR10|DX39B_CANLF Spliceosome RNA helicase DDX39B OS=Canis lupus familiaris GN=DDX39B PE=3 SV=1 47 414 7.0E-64
sp|A2R0B5|SUB2_ASPNC ATP-dependent RNA helicase sub2 OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=sub2 PE=3 SV=1 47 412 7.0E-64
sp|Q2H0R2|DBP10_CHAGB ATP-dependent RNA helicase DBP10 OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=DBP10 PE=3 SV=1 47 389 7.0E-64
sp|A2QI25|DED1_ASPNC ATP-dependent RNA helicase ded1 OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=ded1 PE=3 SV=1 35 391 7.0E-64
sp|A1CXK7|DED1_NEOFI ATP-dependent RNA helicase ded1 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=ded1 PE=3 SV=1 35 391 7.0E-64
sp|Q5RE47|DX39B_PONAB Spliceosome RNA helicase DDX39B OS=Pongo abelii GN=DDX39B PE=2 SV=1 47 414 8.0E-64
sp|Q29024|DX39B_PIG Spliceosome RNA helicase DDX39B OS=Sus scrofa GN=DDX39B PE=3 SV=2 47 414 8.0E-64
sp|P60024|DX39B_PANTR Spliceosome RNA helicase DDX39B OS=Pan troglodytes GN=DDX39B PE=3 SV=1 47 414 8.0E-64
sp|Q5TM17|DX39B_MACMU Spliceosome RNA helicase DDX39B OS=Macaca mulatta GN=DDX39B PE=3 SV=1 47 414 8.0E-64
sp|Q13838|DX39B_HUMAN Spliceosome RNA helicase DDX39B OS=Homo sapiens GN=DDX39B PE=1 SV=1 47 414 8.0E-64
sp|A7ESL7|DBP10_SCLS1 ATP-dependent RNA helicase dbp10 OS=Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1) GN=dbp10 PE=3 SV=2 47 394 8.0E-64
sp|Q63413|DX39B_RAT Spliceosome RNA helicase Ddx39b OS=Rattus norvegicus GN=Ddx39b PE=2 SV=3 47 414 8.0E-64
sp|Q9Z1N5|DX39B_MOUSE Spliceosome RNA helicase Ddx39b OS=Mus musculus GN=Ddx39b PE=1 SV=1 47 414 8.0E-64
sp|Q9PA24|RHLB_XYLFA ATP-dependent RNA helicase RhlB OS=Xylella fastidiosa (strain 9a5c) GN=rhlB PE=3 SV=2 37 408 9.0E-64
sp|A3LRW2|DBP3_PICST ATP-dependent RNA helicase DBP3 OS=Scheffersomyces stipitis (strain ATCC 58785 / CBS 6054 / NBRC 10063 / NRRL Y-11545) GN=DBP3 PE=3 SV=1 65 396 9.0E-64
sp|P24784|DBP1_YEAST ATP-dependent RNA helicase DBP1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DBP1 PE=1 SV=2 28 413 9.0E-64
sp|Q7S5D9|DHH1_NEUCR ATP-dependent RNA helicase dhh1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=drh-10 PE=3 SV=3 65 412 9.0E-64
sp|Q1DJF0|DED1_COCIM ATP-dependent RNA helicase DED1 OS=Coccidioides immitis (strain RS) GN=DED1 PE=3 SV=2 35 391 1.0E-63
sp|Q5A9Z6|FAL1_CANAL ATP-dependent RNA helicase FAL1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=FAL1 PE=3 SV=1 45 419 1.0E-63
sp|Q6BU54|DED1_DEBHA ATP-dependent RNA helicase DED1 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=DED1 PE=3 SV=1 35 391 1.0E-63
sp|A1DL85|SUB2_NEOFI ATP-dependent RNA helicase sub2 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=sub2 PE=3 SV=1 47 412 1.0E-63
sp|P0CQ72|FAL1_CRYNJ ATP-dependent RNA helicase FAL1 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=FAL1 PE=3 SV=1 39 418 1.0E-63
sp|P0CQ73|FAL1_CRYNB ATP-dependent RNA helicase FAL1 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=FAL1 PE=3 SV=1 39 418 1.0E-63
sp|A7TJ36|DBP3_VANPO ATP-dependent RNA helicase DBP3 OS=Vanderwaltozyma polyspora (strain ATCC 22028 / DSM 70294) GN=DBP3 PE=3 SV=1 53 396 1.0E-63
sp|Q757U8|DBP10_ASHGO ATP-dependent RNA helicase DBP10 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=DBP10 PE=3 SV=1 46 408 1.0E-63
sp|Q8L7S8|RH3_ARATH DEAD-box ATP-dependent RNA helicase 3, chloroplastic OS=Arabidopsis thaliana GN=RH3 PE=1 SV=2 50 405 1.0E-63
sp|A6ZPU3|DBP4_YEAS7 ATP-dependent RNA helicase DBP4 OS=Saccharomyces cerevisiae (strain YJM789) GN=DBP4 PE=3 SV=1 45 402 1.0E-63
sp|Q9LYJ9|RH46_ARATH DEAD-box ATP-dependent RNA helicase 46 OS=Arabidopsis thaliana GN=RH46 PE=2 SV=2 31 395 2.0E-63
sp|A6ZWD3|DBP1_YEAS7 ATP-dependent RNA helicase DBP1 OS=Saccharomyces cerevisiae (strain YJM789) GN=DBP1 PE=3 SV=1 28 413 2.0E-63
sp|Q6GVM6|DDX3Y_PANTR ATP-dependent RNA helicase DDX3Y OS=Pan troglodytes GN=DDX3Y PE=2 SV=1 35 430 2.0E-63
sp|Q8TFK8|DED1_CANGA ATP-dependent RNA helicase DED1 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=DED1 PE=3 SV=1 35 391 2.0E-63
sp|Q2U6P7|SUB2_ASPOR ATP-dependent RNA helicase sub2 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=sub2 PE=3 SV=1 47 412 2.0E-63
sp|Q1DZK8|DBP3_COCIM ATP-dependent RNA helicase DBP3 OS=Coccidioides immitis (strain RS) GN=DBP3 PE=3 SV=2 65 396 2.0E-63
sp|Q9LUW6|RH9_ARATH DEAD-box ATP-dependent RNA helicase 9 OS=Arabidopsis thaliana GN=RH9 PE=2 SV=1 49 413 2.0E-63
sp|Q8K4L0|DDX54_MOUSE ATP-dependent RNA helicase DDX54 OS=Mus musculus GN=Ddx54 PE=1 SV=1 47 418 3.0E-63
sp|P20448|DBP4_YEAST ATP-dependent RNA helicase HCA4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HCA4 PE=1 SV=2 45 402 3.0E-63
sp|Q84W89|RH37_ARATH DEAD-box ATP-dependent RNA helicase 37 OS=Arabidopsis thaliana GN=RH37 PE=2 SV=2 41 396 3.0E-63
sp|Q5VQL1|RH14_ORYSJ DEAD-box ATP-dependent RNA helicase 14 OS=Oryza sativa subsp. japonica GN=Os01g0172200 PE=2 SV=1 38 403 3.0E-63
sp|Q5JKF2|RH40_ORYSJ DEAD-box ATP-dependent RNA helicase 40 OS=Oryza sativa subsp. japonica GN=Os01g0549400 PE=2 SV=2 46 403 3.0E-63
sp|Q6CSZ7|DHH1_KLULA ATP-dependent RNA helicase DHH1 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=DHH1 PE=3 SV=1 45 414 3.0E-63
sp|Q6CRF4|DBP4_KLULA ATP-dependent RNA helicase DBP4 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=DBP4 PE=3 SV=1 47 397 3.0E-63
[Show less]

GO

GO Term Description Terminal node
GO:0003676 nucleic acid binding Yes
GO:0005524 ATP binding Yes
GO:0016787 hydrolase activity Yes
GO:0003677 DNA binding Yes
GO:0017076 purine nucleotide binding No
GO:0005488 binding No
GO:0003674 molecular_function No
GO:0035639 purine ribonucleoside triphosphate binding No
GO:0000166 nucleotide binding No
GO:0043167 ion binding No
GO:0032553 ribonucleotide binding No
GO:0097367 carbohydrate derivative binding No
GO:0003824 catalytic activity No
GO:0043168 anion binding No
GO:0097159 organic cyclic compound binding No
GO:1901265 nucleoside phosphate binding No
GO:0032555 purine ribonucleotide binding No
GO:1901363 heterocyclic compound binding No
GO:0032559 adenyl ribonucleotide binding No
GO:0036094 small molecule binding No
GO:0030554 adenyl nucleotide binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 63 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|3470
MGNAKRRKVSHDDESSDDAIASPKPSADSATVDGAAVQEAPEAPKTFKDLGIVDSLCEACEALNYKHPTPIQEKS
IPVALQGRDIIGLAETGSGKTAAFALPMLQALLDKPQPLFGLVLAPTRELAAQIGQAFEALGSLISLRCAVIVGG
LDMVQQAIALGKKPHVIVATPGRLVDHLEKTKGFSLRTLKYLVMDEADRLLDMDFGPSIDKLLKFIPRERRTYLF
SATMSSKVESLQRASLRDPVKVSISFNKYQTVSTLLQHYIFIPQPRKDTYLIFLVNEFAGKSTIIFTRTVYEAQR
VAILLRTLGFGAIPLHGQLSQSARLGALNKFRAGNRDILVATDVAARGLDIPKVDLVLNYDLPQDSKTYIHRVGR
TARAGKSGIALSFVTQYDVELFQRIEAALGKKLDAYPTEKEEVMAFQLRVEEAQRHARVEMKAIIEGRDKXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXSGHVLDDSGHVLDDSGHVSSSIS
LFNCIFLQGY*
Coding >OphauB2|3470
ATGGGTAATGCCAAGCGCCGAAAAGTATCGCACGACGATGAATCCTCAGACGATGCAATTGCGTCTCCCAAGCCC
TCGGCAGACTCTGCAACGGTAGACGGCGCAGCAGTCCAAGAAGCGCCAGAAGCTCCCAAAACATTCAAAGACTTG
GGCATCGTCGACTCGTTGTGTGAAGCCTGCGAAGCCCTCAACTATAAACACCCCACGCCCATTCAAGAAAAGTCA
ATCCCCGTGGCGCTTCAAGGCCGAGATATCATCGGCTTGGCCGAGACGGGCAGCGGCAAAACGGCAGCGTTTGCC
CTGCCCATGCTCCAGGCCTTGCTGGACAAGCCCCAGCCGCTCTTTGGCCTCGTGCTCGCCCCGACTCGAGAACTG
GCGGCGCAAATCGGGCAAGCCTTTGAAGCATTGGGCTCGCTCATTTCTTTGCGCTGCGCCGTCATTGTTGGCGGG
CTTGACATGGTGCAGCAGGCAATTGCGCTGGGAAAGAAGCCTCACGTCATTGTGGCGACGCCTGGGCGCCTGGTG
GACCATCTTGAAAAGACAAAGGGCTTTTCGCTGCGAACGCTAAAGTATCTCGTCATGGACGAGGCGGACCGGCTT
CTCGACATGGACTTTGGCCCGAGCATCGACAAGCTGCTCAAGTTTATCCCGCGCGAGCGGCGCACCTATCTCTTT
TCCGCAACCATGAGCTCCAAGGTGGAGAGTCTGCAGCGGGCGAGTTTGCGCGACCCGGTCAAGGTTAGCATCAGC
TTCAACAAGTACCAGACGGTGTCGACGCTGCTGCAGCACTACATTTTCATCCCGCAGCCTCGCAAGGACACCTAT
CTCATCTTTCTTGTCAATGAGTTTGCAGGAAAGTCTACAATTATATTTACGCGCACCGTCTATGAGGCTCAGCGC
GTAGCCATTCTCCTGCGCACACTTGGCTTTGGCGCGATTCCGCTCCACGGCCAGCTCTCGCAATCGGCCCGCCTG
GGCGCCCTCAACAAGTTTCGTGCCGGCAACCGCGACATTTTGGTGGCGACCGACGTGGCGGCGCGAGGCCTCGAC
ATCCCCAAGGTTGACCTGGTGCTCAACTACGACTTGCCCCAAGACTCCAAGACGTATATCCACCGGGTGGGACGG
ACGGCACGTGCGGGCAAGTCGGGCATTGCGCTCAGCTTTGTCACGCAGTACGACGTGGAGCTCTTTCAGCGCATC
GAGGCTGCCCTGGGCAAGAAGCTGGATGCCTACCCTACAGAAAAGGAGGAGGTGATGGCGTTTCAGCTGCGCGTC
GAGGAGGCACAGCGGCATGCACGGGTGGAGATGAAGGCCATTATTGAGGGCCGGGATAAACNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNTCGGGCCATGTATTAGACGACTCGGGCCATGTATTAGACGACTCGGGCCATGTATCGTCCTCCATTTCT
CTTTTCAACTGCATTTTTCTACAAGGCTATTAA
Transcript >OphauB2|3470
ATGGGTAATGCCAAGCGCCGAAAAGTATCGCACGACGATGAATCCTCAGACGATGCAATTGCGTCTCCCAAGCCC
TCGGCAGACTCTGCAACGGTAGACGGCGCAGCAGTCCAAGAAGCGCCAGAAGCTCCCAAAACATTCAAAGACTTG
GGCATCGTCGACTCGTTGTGTGAAGCCTGCGAAGCCCTCAACTATAAACACCCCACGCCCATTCAAGAAAAGTCA
ATCCCCGTGGCGCTTCAAGGCCGAGATATCATCGGCTTGGCCGAGACGGGCAGCGGCAAAACGGCAGCGTTTGCC
CTGCCCATGCTCCAGGCCTTGCTGGACAAGCCCCAGCCGCTCTTTGGCCTCGTGCTCGCCCCGACTCGAGAACTG
GCGGCGCAAATCGGGCAAGCCTTTGAAGCATTGGGCTCGCTCATTTCTTTGCGCTGCGCCGTCATTGTTGGCGGG
CTTGACATGGTGCAGCAGGCAATTGCGCTGGGAAAGAAGCCTCACGTCATTGTGGCGACGCCTGGGCGCCTGGTG
GACCATCTTGAAAAGACAAAGGGCTTTTCGCTGCGAACGCTAAAGTATCTCGTCATGGACGAGGCGGACCGGCTT
CTCGACATGGACTTTGGCCCGAGCATCGACAAGCTGCTCAAGTTTATCCCGCGCGAGCGGCGCACCTATCTCTTT
TCCGCAACCATGAGCTCCAAGGTGGAGAGTCTGCAGCGGGCGAGTTTGCGCGACCCGGTCAAGGTTAGCATCAGC
TTCAACAAGTACCAGACGGTGTCGACGCTGCTGCAGCACTACATTTTCATCCCGCAGCCTCGCAAGGACACCTAT
CTCATCTTTCTTGTCAATGAGTTTGCAGGAAAGTCTACAATTATATTTACGCGCACCGTCTATGAGGCTCAGCGC
GTAGCCATTCTCCTGCGCACACTTGGCTTTGGCGCGATTCCGCTCCACGGCCAGCTCTCGCAATCGGCCCGCCTG
GGCGCCCTCAACAAGTTTCGTGCCGGCAACCGCGACATTTTGGTGGCGACCGACGTGGCGGCGCGAGGCCTCGAC
ATCCCCAAGGTTGACCTGGTGCTCAACTACGACTTGCCCCAAGACTCCAAGACGTATATCCACCGGGTGGGACGG
ACGGCACGTGCGGGCAAGTCGGGCATTGCGCTCAGCTTTGTCACGCAGTACGACGTGGAGCTCTTTCAGCGCATC
GAGGCTGCCCTGGGCAAGAAGCTGGATGCCTACCCTACAGAAAAGGAGGAGGTGATGGCGTTTCAGCTGCGCGTC
GAGGAGGCACAGCGGCATGCACGGGTGGAGATGAAGGCCATTATTGAGGGCCGGGATAAACNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNTCGGGCCATGTATTAGACGACTCGGGCCATGTATTAGACGACTCGGGCCATGTATCGTCCTCCATTTCT
CTTTTCAACTGCATTTTTCTACAAGGCTATTAA
Gene >OphauB2|3470
ATGGGTAATGCCAAGCGCCGAAAAGTATCGCACGACGATGAATCCTCAGACGATGCAATTGCGTCTCCCAAGCCC
TCGGCAGACTCTGCAACGGTAGACGGCGCAGCAGTCCAAGAAGCGCCAGAAGCTCCCAAAACATTCAAAGACTTG
GTCAGTACTTGGCCCAATAGCTCCAGCTCGGCTTTTTCTGTAGACGCAGACTTGGCACGAAAAGTGACCTTGGCC
TGGGAAATTTACTGACCAAGATTGTTGCTCAGGGCATCGTCGACTCGTTGTGTGAAGCCTGCGAAGCCCTCAACT
ATAAACACCCCACGCCCATTCAAGAAAAGTCAATCCCCGTGGCGCTTCAAGGCCGAGATATCATCGGCTTGGCCG
AGACGGGCAGCGGCAAAACGGCAGCGTTTGCCCTGCCCATGCTCCAGGCCTTGCTGGACAAGCCCCAGCCGCTCT
TTGGCCTCGTGCTCGCCCCGACTCGAGAACTGGCGGCGCAAATCGGGCAAGCCTTTGAAGCATTGGGCTCGCTCA
TTTCTTTGCGCTGCGCCGTCATTGTTGGCGGGCTTGACATGGTGCAGCAGGCAATTGCGCTGGGAAAGAAGCCTC
ACGTCATTGTGGCGACGCCTGGGCGCCTGGTGGACCATCTTGAAAAGACAAAGGGCTTTTCGCTGCGAACGCTAA
AGTATCTCGTCATGGACGAGGCGGACCGGCTTCTCGACATGGACTTTGGCCCGAGCATCGACAAGCTGCTCAAGT
TTATCCCGCGCGAGCGGCGCACCTATCTCTTTTCCGCAACCATGAGCTCCAAGGTGGAGAGTCTGCAGCGGGCGA
GTTTGCGCGACCCGGTCAAGGTTAGCATCAGCTTCAACAAGTACCAGACGGTGTCGACGCTGCTGCAGCACTACA
TTTTCATCCCGCAGCCTCGCAAGGACACCTATCTCATCTTTCTTGTCAATGAGTTTGCAGGAAAGTCTACAATTA
TATTTACGCGCACCGTCTATGAGGCTCAGCGCGTAGCCATTCTCCTGCGCACACTTGGCTTTGGCGCGATTCCGC
TCCACGGCCAGCTCTCGCAATCGGCCCGCCTGGGCGCCCTCAACAAGTTTCGTGCCGGCAACCGCGACATTTTGG
TGGCGACCGACGTGGCGGCGCGAGGCCTCGACATCCCCAAGGTTGACCTGGTGCTCAACTACGACTTGCCCCAAG
ACTCCAAGACGTATATCCACCGGGTGGGACGGACGGCACGTGCGGGCAAGTCGGGCATTGCGCTCAGCTTTGTCA
CGCAGTACGACGTGGAGCTCTTTCAGCGCATCGAGGCTGCCCTGGGCAAGAAGCTGGATGCCTACCCTACAGAAA
AGGAGGAGGTGATGGCGTTTCAGCTGCGCGTCGAGGAGGCACAGCGGCATGCACGGGTGGAGATGAAGGCCATTA
TTGAGGGCCGGGATAAACNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNTCGGGCCATGTATTAGACGACTCGGGCCATGTATTAG
ACGACTCGGGCCATGTATCGTCCTCCATTTCTCTTTTCAACTGCATTTTTCTACAAGGCTATTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail