Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|3452
Gene name
LocationContig_22:89641..90556
Strand+
Gene length (bp)915
Transcript length (bp)864
Coding sequence length (bp)864
Protein length (aa) 288

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF05997 Nop52 Nucleolar protein,Nop52 4.9E-42 12 212

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|P35178|RRP1_YEAST Ribosomal RNA-processing protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RRP1 PE=1 SV=2 11 205 6.0E-21
sp|Q9Y7M6|RRP1_SCHPO Ribosomal RNA-processing protein 1 homolog OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC9B6.07 PE=3 SV=1 11 205 2.0E-17
sp|P56183|RRP1_MOUSE Ribosomal RNA processing protein 1 homolog A OS=Mus musculus GN=Rrp1 PE=1 SV=2 15 207 3.0E-10

GO

GO Term Description Terminal node
GO:0006364 rRNA processing Yes
GO:0030688 preribosome, small subunit precursor Yes
GO:0030684 preribosome No
GO:0043170 macromolecule metabolic process No
GO:0005575 cellular_component No
GO:0006725 cellular aromatic compound metabolic process No
GO:0008150 biological_process No
GO:0006396 RNA processing No
GO:0034641 cellular nitrogen compound metabolic process No
GO:0006807 nitrogen compound metabolic process No
GO:1901360 organic cyclic compound metabolic process No
GO:0090304 nucleic acid metabolic process No
GO:0034470 ncRNA processing No
GO:1990904 ribonucleoprotein complex No
GO:0016072 rRNA metabolic process No
GO:0071704 organic substance metabolic process No
GO:0044237 cellular metabolic process No
GO:0008152 metabolic process No
GO:0009987 cellular process No
GO:0044238 primary metabolic process No
GO:0032991 protein-containing complex No
GO:0046483 heterocycle metabolic process No
GO:0034660 ncRNA metabolic process No
GO:0016070 RNA metabolic process No
GO:0006139 nucleobase-containing compound metabolic process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 67 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|3452
MAVHDVEASQTPFIKNLASSDRRLRTQSLAALHAYLSSRTRLTDLDATRLWTGLFWALWMTDRVRPQAKLADELA
DLVFAFTRPEHPSQIPQDAAPTSPDKSAPQAQLQTSSPLDASSLQDLSTTWLRAGWSVLSTNWSRIDALRLDKFL
LLARRLLAAHLRLASHPPLLHVLRTHVLDVADETGVALGLRLHVLDIWVDELERIGALKPAAPDMAEGADQQDAR
KDGEAESRLARAVGDAVDEVASSRVKSVRARAEESSRDERLPWVGVTTVMDDGAQDWDGFDD*
Coding >OphauB2|3452
ATGGCCGTCCATGACGTAGAGGCGTCGCAAACGCCCTTTATCAAAAACCTCGCGTCGAGCGACCGCAGACTTCGC
ACCCAGTCCCTCGCAGCTCTGCATGCCTACCTCTCCAGCCGAACACGCCTCACAGACCTCGACGCAACGCGCCTC
TGGACAGGCTTATTCTGGGCTCTATGGATGACGGATCGCGTGCGCCCCCAGGCCAAGCTGGCAGACGAATTGGCA
GACCTAGTCTTTGCATTTACTCGGCCAGAGCATCCCTCACAAATACCCCAAGACGCAGCACCCACATCACCTGAC
AAATCAGCACCGCAAGCCCAACTCCAAACTTCATCACCGCTAGACGCCTCTTCTCTCCAAGACCTATCCACCACC
TGGCTCCGCGCCGGCTGGTCCGTCCTCTCTACAAACTGGTCCCGCATCGACGCCCTCCGCCTCGACAAATTCCTC
CTCCTCGCCCGCCGCCTCTTGGCCGCCCACCTCCGCCTCGCCTCGCATCCTCCCCTCCTCCACGTCTTGCGCACC
CATGTCCTCGACGTTGCCGACGAGACTGGCGTCGCGCTCGGCCTGCGCCTGCACGTTTTGGATATCTGGGTCGAT
GAGCTGGAGCGCATCGGCGCCCTCAAACCTGCCGCGCCGGACATGGCAGAGGGTGCCGATCAGCAGGATGCGAGG
AAGGATGGCGAAGCAGAGAGTAGACTGGCGCGTGCAGTGGGAGACGCGGTTGACGAGGTTGCGTCTAGTCGGGTA
AAGAGCGTGAGGGCGCGGGCAGAGGAGAGTAGTCGTGATGAGCGGCTTCCTTGGGTGGGCGTTACAACGGTCATG
GATGATGGTGCCCAAGACTGGGACGGCTTTGACGATTGA
Transcript >OphauB2|3452
ATGGCCGTCCATGACGTAGAGGCGTCGCAAACGCCCTTTATCAAAAACCTCGCGTCGAGCGACCGCAGACTTCGC
ACCCAGTCCCTCGCAGCTCTGCATGCCTACCTCTCCAGCCGAACACGCCTCACAGACCTCGACGCAACGCGCCTC
TGGACAGGCTTATTCTGGGCTCTATGGATGACGGATCGCGTGCGCCCCCAGGCCAAGCTGGCAGACGAATTGGCA
GACCTAGTCTTTGCATTTACTCGGCCAGAGCATCCCTCACAAATACCCCAAGACGCAGCACCCACATCACCTGAC
AAATCAGCACCGCAAGCCCAACTCCAAACTTCATCACCGCTAGACGCCTCTTCTCTCCAAGACCTATCCACCACC
TGGCTCCGCGCCGGCTGGTCCGTCCTCTCTACAAACTGGTCCCGCATCGACGCCCTCCGCCTCGACAAATTCCTC
CTCCTCGCCCGCCGCCTCTTGGCCGCCCACCTCCGCCTCGCCTCGCATCCTCCCCTCCTCCACGTCTTGCGCACC
CATGTCCTCGACGTTGCCGACGAGACTGGCGTCGCGCTCGGCCTGCGCCTGCACGTTTTGGATATCTGGGTCGAT
GAGCTGGAGCGCATCGGCGCCCTCAAACCTGCCGCGCCGGACATGGCAGAGGGTGCCGATCAGCAGGATGCGAGG
AAGGATGGCGAAGCAGAGAGTAGACTGGCGCGTGCAGTGGGAGACGCGGTTGACGAGGTTGCGTCTAGTCGGGTA
AAGAGCGTGAGGGCGCGGGCAGAGGAGAGTAGTCGTGATGAGCGGCTTCCTTGGGTGGGCGTTACAACGGTCATG
GATGATGGTGCCCAAGACTGGGACGGCTTTGACGATTGA
Gene >OphauB2|3452
ATGGCCGTCCATGACGTAGAGGCGTCGCAAACGCCCTTTATCAAAAACCTCGCGTCGAGCGGTACGCATAACCCA
TACCTATAAAACCCGTCTTTGCTTCTAATCTTTACAGACCGCAGACTTCGCACCCAGTCCCTCGCAGCTCTGCAT
GCCTACCTCTCCAGCCGAACACGCCTCACAGACCTCGACGCAACGCGCCTCTGGACAGGCTTATTCTGGGCTCTA
TGGATGACGGATCGCGTGCGCCCCCAGGCCAAGCTGGCAGACGAATTGGCAGACCTAGTCTTTGCATTTACTCGG
CCAGAGCATCCCTCACAAATACCCCAAGACGCAGCACCCACATCACCTGACAAATCAGCACCGCAAGCCCAACTC
CAAACTTCATCACCGCTAGACGCCTCTTCTCTCCAAGACCTATCCACCACCTGGCTCCGCGCCGGCTGGTCCGTC
CTCTCTACAAACTGGTCCCGCATCGACGCCCTCCGCCTCGACAAATTCCTCCTCCTCGCCCGCCGCCTCTTGGCC
GCCCACCTCCGCCTCGCCTCGCATCCTCCCCTCCTCCACGTCTTGCGCACCCATGTCCTCGACGTTGCCGACGAG
ACTGGCGTCGCGCTCGGCCTGCGCCTGCACGTTTTGGATATCTGGGTCGATGAGCTGGAGCGCATCGGCGCCCTC
AAACCTGCCGCGCCGGACATGGCAGAGGGTGCCGATCAGCAGGATGCGAGGAAGGATGGCGAAGCAGAGAGTAGA
CTGGCGCGTGCAGTGGGAGACGCGGTTGACGAGGTTGCGTCTAGTCGGGTAAAGAGCGTGAGGGCGCGGGCAGAG
GAGAGTAGTCGTGATGAGCGGCTTCCTTGGGTGGGCGTTACAACGGTCATGGATGATGGTGCCCAAGACTGGGAC
GGCTTTGACGATTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail