Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|345
Gene name
LocationContig_102:63850..64703
Strand+
Gene length (bp)853
Transcript length (bp)768
Coding sequence length (bp)768
Protein length (aa) 256

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00565 SNase Staphylococcal nuclease homologue 3.4E-24 128 237

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|C7YQ31|LCL3_NECH7 Probable endonuclease LCL3 OS=Nectria haematococca (strain 77-13-4 / ATCC MYA-4622 / FGSC 9596 / MPVI) GN=LCL3 PE=3 SV=1 1 254 4.0E-112
sp|E3QWM6|LCL3_COLGM Probable endonuclease LCL3 OS=Colletotrichum graminicola (strain M1.001 / M2 / FGSC 10212) GN=LCL3 PE=3 SV=1 2 252 4.0E-83
sp|A4RMK0|LCL3_MAGO7 Probable endonuclease LCL3 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=LCL3 PE=3 SV=2 2 254 4.0E-82
sp|C9SI22|LCL3_VERA1 Probable endonuclease LCL3 OS=Verticillium alfalfae (strain VaMs.102 / ATCC MYA-4576 / FGSC 10136) GN=LCL3 PE=3 SV=1 2 252 5.0E-81
sp|A6RP27|LCL3_BOTFB Probable endonuclease lcl3 OS=Botryotinia fuckeliana (strain B05.10) GN=lcl3 PE=3 SV=1 2 255 1.0E-79
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|C7YQ31|LCL3_NECH7 Probable endonuclease LCL3 OS=Nectria haematococca (strain 77-13-4 / ATCC MYA-4622 / FGSC 9596 / MPVI) GN=LCL3 PE=3 SV=1 1 254 4.0E-112
sp|E3QWM6|LCL3_COLGM Probable endonuclease LCL3 OS=Colletotrichum graminicola (strain M1.001 / M2 / FGSC 10212) GN=LCL3 PE=3 SV=1 2 252 4.0E-83
sp|A4RMK0|LCL3_MAGO7 Probable endonuclease LCL3 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=LCL3 PE=3 SV=2 2 254 4.0E-82
sp|C9SI22|LCL3_VERA1 Probable endonuclease LCL3 OS=Verticillium alfalfae (strain VaMs.102 / ATCC MYA-4576 / FGSC 10136) GN=LCL3 PE=3 SV=1 2 252 5.0E-81
sp|A6RP27|LCL3_BOTFB Probable endonuclease lcl3 OS=Botryotinia fuckeliana (strain B05.10) GN=lcl3 PE=3 SV=1 2 255 1.0E-79
sp|A7ECE0|LCL3_SCLS1 Probable endonuclease lcl3 OS=Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1) GN=lcl3 PE=3 SV=1 58 254 7.0E-74
sp|B2WC78|LCL3_PYRTR Probable endonuclease lcl3 OS=Pyrenophora tritici-repentis (strain Pt-1C-BFP) GN=lcl3 PE=3 SV=1 48 252 1.0E-72
sp|C5FTB4|LCL3_ARTOC Probable endonuclease LCL3 OS=Arthroderma otae (strain ATCC MYA-4605 / CBS 113480) GN=LCL3 PE=3 SV=1 2 252 2.0E-71
sp|Q5BGS2|LCL3_EMENI Probable endonuclease lcl3 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=lcl3 PE=3 SV=1 2 252 5.0E-69
sp|B8MY73|LCL3_ASPFN Probable endonuclease lcl3 OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / NRRL 3357 / JCM 12722 / SRRC 167) GN=lcl3 PE=3 SV=1 2 252 9.0E-69
sp|Q2URN2|LCL3_ASPOR Probable endonuclease lcl3 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=lcl3 PE=3 SV=1 2 252 9.0E-69
sp|E4V094|LCL3_ARTGP Probable endonuclease LCL3 OS=Arthroderma gypseum (strain ATCC MYA-4604 / CBS 118893) GN=LCL3 PE=3 SV=1 2 252 3.0E-68
sp|A1CRW4|LCL3_ASPCL Probable endonuclease lcl3 OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=lcl3 PE=3 SV=1 2 252 5.0E-68
sp|C5P0Z4|LCL3_COCP7 Probable endonuclease LCL3 OS=Coccidioides posadasii (strain C735) GN=LCL3 PE=3 SV=1 26 254 7.0E-68
sp|B6H1W0|LCL3_PENRW Probable endonuclease lcl3 OS=Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255) GN=lcl3 PE=3 SV=1 2 252 1.0E-67
sp|B2AU25|LCL3_PODAN Probable endonuclease LCL3 OS=Podospora anserina (strain S / ATCC MYA-4624 / DSM 980 / FGSC 10383) GN=LCL3 PE=3 SV=1 45 252 4.0E-67
sp|E4ZVE5|LCL3_LEPMJ Probable endonuclease LCL3 OS=Leptosphaeria maculans (strain JN3 / isolate v23.1.3 / race Av1-4-5-6-7-8) GN=LCL3 PE=3 SV=1 2 252 5.0E-67
sp|Q4WK77|LCL3_ASPFU Probable endonuclease lcl3 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=lcl3 PE=3 SV=1 2 252 3.0E-66
sp|A2Q8K8|LCL3_ASPNC Probable endonuclease lcl3 OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=lcl3 PE=3 SV=1 2 252 3.0E-66
sp|B0XMZ5|LCL3_ASPFC Probable endonuclease lcl3 OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=lcl3 PE=3 SV=1 2 252 3.0E-66
sp|Q0UVH1|LCL3_PHANO Probable endonuclease LCL3 OS=Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) GN=LCL3 PE=3 SV=2 38 254 8.0E-66
sp|C4JVW2|LCL3_UNCRE Probable endonuclease LCL3 OS=Uncinocarpus reesii (strain UAMH 1704) GN=LCL3 PE=3 SV=1 25 254 8.0E-66
sp|A1D4S1|LCL3_NEOFI Probable endonuclease lcl3 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=lcl3 PE=3 SV=1 2 252 9.0E-66
sp|Q0CUT8|LCL3_ASPTN Probable endonuclease lcl3 OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=lcl3 PE=3 SV=1 46 252 3.0E-65
sp|B6QNP4|LCL3_TALMQ Probable endonuclease lcl3 OS=Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333) GN=lcl3 PE=3 SV=1 26 252 5.0E-65
sp|C0SEQ8|LCL3_PARBP Probable endonuclease LCL3 OS=Paracoccidioides brasiliensis (strain Pb03) GN=LCL3 PE=3 SV=1 46 254 9.0E-65
sp|C1GKM1|LCL3_PARBD Probable endonuclease LCL3 OS=Paracoccidioides brasiliensis (strain Pb18) GN=LCL3 PE=3 SV=1 46 254 1.0E-64
sp|C1H492|LCL3_PARBA Probable endonuclease LCL3 OS=Paracoccidioides lutzii (strain ATCC MYA-826 / Pb01) GN=LCL3 PE=3 SV=1 46 254 9.0E-64
sp|C5GB89|LCL3_AJEDR Probable endonuclease LCL3 OS=Ajellomyces dermatitidis (strain ER-3 / ATCC MYA-2586) GN=LCL3 PE=3 SV=1 19 216 2.0E-58
sp|Q6C427|LCL3_YARLI Probable endonuclease LCL3 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=LCL3 PE=3 SV=1 50 250 2.0E-54
sp|Q6BSY9|LCL3_DEBHA Probable endonuclease LCL3 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=LCL3 PE=3 SV=2 59 250 6.0E-54
sp|C4Y4X4|LCL3_CLAL4 Probable endonuclease LCL3 OS=Clavispora lusitaniae (strain ATCC 42720) GN=LCL3 PE=3 SV=1 60 252 4.0E-52
sp|Q6FS62|LCL3_CANGA Probable endonuclease LCL3 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=LCL3 PE=3 SV=1 48 253 6.0E-52
sp|C5MC60|LCL3_CANTT Probable endonuclease LCL3 OS=Candida tropicalis (strain ATCC MYA-3404 / T1) GN=LCL3 PE=3 SV=1 59 250 5.0E-51
sp|B9W9Z5|LCL3_CANDC Probable endonuclease LCL3 OS=Candida dubliniensis (strain CD36 / ATCC MYA-646 / CBS 7987 / NCPF 3949 / NRRL Y-17841) GN=LCL3 PE=3 SV=1 59 250 1.0E-50
sp|C4YFU9|LCL3_CANAW Probable endonuclease LCL3 OS=Candida albicans (strain WO-1) GN=LCL3 PE=3 SV=1 59 250 2.0E-50
sp|Q5AKW3|LCL3_CANAL Probable endonuclease LCL3 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=LCL3 PE=3 SV=1 59 250 2.0E-50
sp|A3GI61|LCL3_PICST Probable endonuclease LCL3 OS=Scheffersomyces stipitis (strain ATCC 58785 / CBS 6054 / NBRC 10063 / NRRL Y-11545) GN=LCL3 PE=3 SV=2 23 250 9.0E-50
sp|C4QW04|LCL3_PICPG Probable endonuclease LCL3 OS=Komagataella pastoris (strain GS115 / ATCC 20864) GN=LCL3 PE=3 SV=1 48 236 3.0E-49
sp|A5DNZ8|LCL3_PICGU Probable endonuclease LCL3 OS=Meyerozyma guilliermondii (strain ATCC 6260 / CBS 566 / DSM 6381 / JCM 1539 / NBRC 10279 / NRRL Y-324) GN=LCL3 PE=3 SV=1 59 253 4.0E-49
sp|Q874L8|LCL3_KLUDE Probable endonuclease LCL3 OS=Kluyveromyces delphensis GN=LCL3 PE=3 SV=1 48 252 9.0E-46
sp|C5DZY8|LCL3_ZYGRC Probable endonuclease LCL3 OS=Zygosaccharomyces rouxii (strain ATCC 2623 / CBS 732 / NBRC 1130 / NCYC 568 / NRRL Y-229) GN=LCL3 PE=3 SV=1 60 252 2.0E-45
sp|Q6CMM1|LCL3_KLULA Probable endonuclease LCL3 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=LCL3 PE=3 SV=1 48 252 2.0E-44
sp|C5E2G4|LCL3_LACTC Probable endonuclease LCL3 OS=Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284) GN=LCL3 PE=3 SV=1 49 252 4.0E-44
sp|Q754Z2|LCL3_ASHGO Probable endonuclease LCL3 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=LCL3 PE=3 SV=1 53 255 2.0E-40
sp|O60168|LCL3_SCHPO Probable endonuclease C19F8.04c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC19F8.04c PE=3 SV=1 82 250 4.0E-40
sp|B6JYT1|LCL3_SCHJY Probable endonuclease lcl3 OS=Schizosaccharomyces japonicus (strain yFS275 / FY16936) GN=lcl3 PE=3 SV=1 82 252 5.0E-40
sp|B5VIN9|LCL3_YEAS6 Probable endonuclease LCL3 OS=Saccharomyces cerevisiae (strain AWRI1631) GN=LCL3 PE=3 SV=1 48 252 1.0E-39
sp|C8Z8G3|LCL3_YEAS8 Probable endonuclease LCL3 OS=Saccharomyces cerevisiae (strain Lalvin EC1118 / Prise de mousse) GN=LCL3 PE=3 SV=1 48 252 2.0E-39
sp|P53153|LCL3_YEAST Probable endonuclease LCL3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=LCL3 PE=1 SV=1 48 252 2.0E-39
sp|A6ZU94|LCL3_YEAS7 Probable endonuclease LCL3 OS=Saccharomyces cerevisiae (strain YJM789) GN=LCL3 PE=3 SV=1 48 252 2.0E-39
sp|C7GW31|LCL3_YEAS2 Probable endonuclease LCL3 OS=Saccharomyces cerevisiae (strain JAY291) GN=LCL3 PE=3 SV=1 48 252 2.0E-39
sp|B3LHF1|LCL3_YEAS1 Probable endonuclease LCL3 OS=Saccharomyces cerevisiae (strain RM11-1a) GN=LCL3 PE=3 SV=1 48 252 2.0E-39
sp|E6R427|LCL3_CRYGW Probable endonuclease LCL3 OS=Cryptococcus gattii serotype B (strain WM276 / ATCC MYA-4071) GN=LCL3 PE=3 SV=1 54 252 8.0E-39
sp|A7TE94|LCL3_VANPO Probable endonuclease LCL3 OS=Vanderwaltozyma polyspora (strain ATCC 22028 / DSM 70294) GN=LCL3 PE=3 SV=1 48 255 1.0E-38
sp|D8QGA7|LCL3_SCHCM Probable endonuclease LCL3 OS=Schizophyllum commune (strain H4-8 / FGSC 9210) GN=LCL3 PE=3 SV=1 47 255 1.0E-38
sp|B0D7T0|LCL3_LACBS Probable endonuclease LCL3 OS=Laccaria bicolor (strain S238N-H82 / ATCC MYA-4686) GN=LCL3 PE=3 SV=1 11 254 2.0E-38
sp|A5E1Q5|LCL3_LODEL Probable endonuclease LCL3 OS=Lodderomyces elongisporus (strain ATCC 11503 / CBS 2605 / JCM 1781 / NBRC 1676 / NRRL YB-4239) GN=LCL3 PE=3 SV=1 84 250 5.0E-37
sp|Q942N7|CAN1_ORYSJ Probable staphylococcal-like nuclease CAN1 OS=Oryza sativa subsp. japonica GN=Os01g0166100 PE=2 SV=1 106 238 1.0E-07
sp|F4IZC5|CAN1_ARATH Staphylococcal-like nuclease CAN1 OS=Arabidopsis thaliana GN=CAN1 PE=1 SV=1 128 237 2.0E-06
sp|F4IH31|CAN2_ARATH Staphylococcal-like nuclease CAN2 OS=Arabidopsis thaliana GN=CAN2 PE=1 SV=1 128 237 3.0E-06
sp|Q39635|Y38K_CAPSE Uncharacterized 38.1 kDa protein OS=Capnoides sempervirens PE=2 SV=1 128 237 5.0E-06
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 23 0.5

Transmembrane Domains

Domain # Start End Length
1 43 65 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|345
MWPFWSSGSSKDADRDGGHKTRPVSWQGALETSKTSPLDAAKQWAPMVAISLGSLAVVQFYSTYLRRIPGARYLR
PSDFHRKSLWGRVTSVGDGDNFHLFHMPGGMIAGWGLWRHVPEKRKDLHTISIRIAGVDAPEGAHFGRPGQPYAP
EALEWLSQYILRRNVRAYVYRCDQYDRAVASVYIWRYCIRRDVGLEMIKRGLATVYEATYGAEYGGRKELYLKAE
AKAKRKRLGMWSGKAKSFESPRQYKSKWAK*
Coding >OphauB2|345
ATGTGGCCGTTTTGGTCATCGGGTTCCAGCAAAGATGCGGACAGAGATGGTGGACACAAGACGCGGCCTGTGTCT
TGGCAAGGCGCCCTCGAAACTTCCAAGACGAGCCCTTTAGATGCCGCAAAGCAATGGGCACCCATGGTTGCCATT
TCTCTCGGAAGCTTGGCCGTGGTTCAATTTTACTCTACCTACTTGCGCCGAATTCCAGGAGCACGATACCTTCGG
CCCAGCGACTTCCACAGGAAGAGCTTGTGGGGGCGAGTAACGAGCGTCGGTGATGGCGACAACTTTCACCTGTTT
CATATGCCGGGGGGCATGATTGCAGGCTGGGGTCTGTGGAGACATGTCCCGGAGAAAAGAAAGGACCTTCATACG
ATAAGCATTCGAATTGCCGGTGTCGACGCCCCCGAGGGGGCACATTTTGGCCGCCCTGGCCAGCCATATGCACCT
GAAGCTCTAGAGTGGCTTAGCCAATACATTCTTCGGCGCAACGTGCGGGCATACGTTTATCGTTGTGACCAGTAT
GATCGTGCTGTGGCGAGTGTCTATATCTGGCGGTACTGCATCCGCCGCGACGTTGGTCTCGAGATGATCAAGCGT
GGACTGGCAACGGTATACGAGGCAACATATGGGGCTGAATATGGAGGGCGGAAAGAACTATATCTCAAAGCCGAG
GCCAAGGCCAAGAGGAAACGACTGGGAATGTGGTCTGGTAAAGCAAAGAGCTTTGAGAGTCCAAGGCAGTACAAG
TCGAAGTGGGCCAAATAG
Transcript >OphauB2|345
ATGTGGCCGTTTTGGTCATCGGGTTCCAGCAAAGATGCGGACAGAGATGGTGGACACAAGACGCGGCCTGTGTCT
TGGCAAGGCGCCCTCGAAACTTCCAAGACGAGCCCTTTAGATGCCGCAAAGCAATGGGCACCCATGGTTGCCATT
TCTCTCGGAAGCTTGGCCGTGGTTCAATTTTACTCTACCTACTTGCGCCGAATTCCAGGAGCACGATACCTTCGG
CCCAGCGACTTCCACAGGAAGAGCTTGTGGGGGCGAGTAACGAGCGTCGGTGATGGCGACAACTTTCACCTGTTT
CATATGCCGGGGGGCATGATTGCAGGCTGGGGTCTGTGGAGACATGTCCCGGAGAAAAGAAAGGACCTTCATACG
ATAAGCATTCGAATTGCCGGTGTCGACGCCCCCGAGGGGGCACATTTTGGCCGCCCTGGCCAGCCATATGCACCT
GAAGCTCTAGAGTGGCTTAGCCAATACATTCTTCGGCGCAACGTGCGGGCATACGTTTATCGTTGTGACCAGTAT
GATCGTGCTGTGGCGAGTGTCTATATCTGGCGGTACTGCATCCGCCGCGACGTTGGTCTCGAGATGATCAAGCGT
GGACTGGCAACGGTATACGAGGCAACATATGGGGCTGAATATGGAGGGCGGAAAGAACTATATCTCAAAGCCGAG
GCCAAGGCCAAGAGGAAACGACTGGGAATGTGGTCTGGTAAAGCAAAGAGCTTTGAGAGTCCAAGGCAGTACAAG
TCGAAGTGGGCCAAATAG
Gene >OphauB2|345
ATGTGGCCGTTTTGGTCATCGGGTTCCAGCAAAGATGCGGACAGAGATGGTGGACACAAGACGCGGCCTGTGTCT
TGGCAAGGCGCCCTCGAAACTTCCAAGACGAGCCCTTTAGATGCCGCAAAGCAATGGGCACCCATGGTTGCCATT
TCTCTCGGAAGCTTGGCCGTGGTTCAATTTTACTCTACCTACTTGCGCCGAATTCCAGGAGCACGATACCTTCGG
CCCAGCGACTTCCACAGGAAGAGCTTGTGGGGGCGAGTAACGAGCGTCGGTGATGGCGACAACTTTCACCTGTTT
CATATGCCGGGGGGCATGATTGCAGGCTGGGGTCTGTGGAGACATGTCCCGGAGAAAAGAAAGGACCTTCATACG
GTATGTTTAAACAAAAGACGGTTCCTGTGGTTTATGGTGGGATGCTGGTCCAAGAGCTGACGTGTCTAATTTTGC
TTGGTTACAGATAAGCATTCGAATTGCCGGTGTCGACGCCCCCGAGGGGGCACATTTTGGCCGCCCTGGCCAGCC
ATATGCACCTGAAGCTCTAGAGTGGCTTAGCCAATACATTCTTCGGCGCAACGTGCGGGCATACGTTTATCGTTG
TGACCAGTATGATCGTGCTGTGGCGAGTGTCTATATCTGGCGGTACTGCATCCGCCGCGACGTTGGTCTCGAGAT
GATCAAGCGTGGACTGGCAACGGTATACGAGGCAACATATGGGGCTGAATATGGAGGGCGGAAAGAACTATATCT
CAAAGCCGAGGCCAAGGCCAAGAGGAAACGACTGGGAATGTGGTCTGGTAAAGCAAAGAGCTTTGAGAGTCCAAG
GCAGTACAAGTCGAAGTGGGCCAAATAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail