Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|344
Gene name
LocationContig_102:62220..63426
Strand+
Gene length (bp)1206
Transcript length (bp)960
Coding sequence length (bp)960
Protein length (aa) 320

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF04045 P34-Arc Arp2/3 complex, 34 kD subunit p34-Arc 3.6E-104 52 301

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O14241|ARPC2_SCHPO Actin-related protein 2/3 complex subunit 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=arc2 PE=1 SV=1 1 314 4.0E-120
sp|Q9CVB6|ARPC2_MOUSE Actin-related protein 2/3 complex subunit 2 OS=Mus musculus GN=Arpc2 PE=1 SV=3 1 317 3.0E-93
sp|Q5R5Z5|ARPC2_PONAB Actin-related protein 2/3 complex subunit 2 OS=Pongo abelii GN=ARPC2 PE=2 SV=1 1 317 3.0E-92
sp|O15144|ARPC2_HUMAN Actin-related protein 2/3 complex subunit 2 OS=Homo sapiens GN=ARPC2 PE=1 SV=1 1 317 3.0E-92
sp|Q3MHR7|ARPC2_BOVIN Actin-related protein 2/3 complex subunit 2 OS=Bos taurus GN=ARPC2 PE=1 SV=1 1 317 8.0E-92
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O14241|ARPC2_SCHPO Actin-related protein 2/3 complex subunit 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=arc2 PE=1 SV=1 1 314 4.0E-120
sp|Q9CVB6|ARPC2_MOUSE Actin-related protein 2/3 complex subunit 2 OS=Mus musculus GN=Arpc2 PE=1 SV=3 1 317 3.0E-93
sp|Q5R5Z5|ARPC2_PONAB Actin-related protein 2/3 complex subunit 2 OS=Pongo abelii GN=ARPC2 PE=2 SV=1 1 317 3.0E-92
sp|O15144|ARPC2_HUMAN Actin-related protein 2/3 complex subunit 2 OS=Homo sapiens GN=ARPC2 PE=1 SV=1 1 317 3.0E-92
sp|Q3MHR7|ARPC2_BOVIN Actin-related protein 2/3 complex subunit 2 OS=Bos taurus GN=ARPC2 PE=1 SV=1 1 317 8.0E-92
sp|P85970|ARPC2_RAT Actin-related protein 2/3 complex subunit 2 OS=Rattus norvegicus GN=Arpc2 PE=1 SV=1 1 316 1.0E-90
sp|Q7PVX8|ARPC2_ANOGA Probable actin-related protein 2/3 complex subunit 2 OS=Anopheles gambiae GN=Arc-p34 PE=3 SV=2 1 314 8.0E-89
sp|Q9VIM5|ARPC2_DROME Actin-related protein 2/3 complex subunit 2 OS=Drosophila melanogaster GN=Arpc2 PE=2 SV=2 1 315 2.0E-86
sp|Q8WTM6|ARPC2_CAEEL Probable actin-related protein 2/3 complex subunit 2 OS=Caenorhabditis elegans GN=arx-4 PE=3 SV=1 1 317 7.0E-76
sp|P53731|ARPC2_YEAST Actin-related protein 2/3 complex subunit 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ARC35 PE=1 SV=1 1 312 6.0E-68
sp|O96623|ARPC2_DICDI Actin-related protein 2/3 complex subunit 2 OS=Dictyostelium discoideum GN=arcB PE=1 SV=1 1 315 3.0E-64
sp|Q8LGI3|ARC2A_ARATH Actin-related protein 2/3 complex subunit 2A OS=Arabidopsis thaliana GN=ARPC2A PE=1 SV=1 1 318 2.0E-34
sp|F4IVU1|ARC2B_ARATH Actin-related protein 2/3 complex subunit 2B OS=Arabidopsis thaliana GN=ARPC2B PE=2 SV=1 1 315 4.0E-21
[Show less]

GO

GO Term Description Terminal node
GO:0005885 Arp2/3 protein complex Yes
GO:0030833 regulation of actin filament polymerization Yes
GO:0034314 Arp2/3 complex-mediated actin nucleation Yes
GO:0015629 actin cytoskeleton Yes
GO:1902903 regulation of supramolecular fiber organization No
GO:0008064 regulation of actin polymerization or depolymerization No
GO:0043226 organelle No
GO:0050789 regulation of biological process No
GO:0032970 regulation of actin filament-based process No
GO:0051128 regulation of cellular component organization No
GO:0090066 regulation of anatomical structure size No
GO:0043228 non-membrane-bounded organelle No
GO:0044087 regulation of cellular component biogenesis No
GO:0032535 regulation of cellular component size No
GO:0008150 biological_process No
GO:0016043 cellular component organization No
GO:0032956 regulation of actin cytoskeleton organization No
GO:0005575 cellular_component No
GO:0033043 regulation of organelle organization No
GO:0043229 intracellular organelle No
GO:0009987 cellular process No
GO:0043232 intracellular non-membrane-bounded organelle No
GO:0032271 regulation of protein polymerization No
GO:0043254 regulation of protein-containing complex assembly No
GO:0007015 actin filament organization No
GO:0051493 regulation of cytoskeleton organization No
GO:0030832 regulation of actin filament length No
GO:0032991 protein-containing complex No
GO:0071840 cellular component organization or biogenesis No
GO:0065008 regulation of biological quality No
GO:0097435 supramolecular fiber organization No
GO:0110053 regulation of actin filament organization No
GO:0005856 cytoskeleton No
GO:0050794 regulation of cellular process No
GO:0065007 biological regulation No
GO:0045010 actin nucleation No
GO:0110165 cellular anatomical entity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 17 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|344
MLLLDYQNVLIQSVLTERFSGAPPVSIDQTVSDFDGVIFHISTPESKSKILLSLQIKCFKDLVRYGAEQVLRREY
GDFLAPVEPGYDFSVMVDLENLPAEKEERDALAMKFALLKRNAMAAPFEQAYEEYYKLKEEASKFTSEEAPQGVR
EGGEIKAIHYRDEEAIYVKASHDRVTIIFSTVFREETDKVFGKVFIQEFVDARRRAIQNAPQVLFRQDPPLELQG
VPGVRDTGTGEIGYVTFVLFPRHLTPQRMPIVVSHIQTFRDYFHYHIKASKAYIHSRMRKRTADFLQVLRRARPE
NEERERKTASGRSFKTQGN*
Coding >OphauB2|344
ATGCTTCTTCTCGACTATCAGAATGTCCTTATTCAGTCGGTCCTCACCGAGCGCTTCTCCGGTGCTCCTCCTGTG
TCCATTGACCAAACCGTGTCGGATTTTGACGGCGTCATCTTTCACATCTCGACTCCCGAATCCAAATCAAAAATT
CTCCTATCTCTCCAGATAAAATGCTTCAAGGATCTTGTTCGCTACGGAGCTGAGCAGGTCTTACGGCGCGAATAC
GGCGATTTCCTGGCACCGGTCGAGCCAGGCTATGACTTCTCCGTCATGGTCGACTTAGAGAATCTCCCCGCTGAA
AAGGAGGAACGCGACGCTTTGGCTATGAAGTTTGCTTTACTAAAACGCAATGCCATGGCTGCCCCTTTTGAGCAA
GCCTACGAGGAATATTACAAATTGAAAGAGGAGGCATCCAAATTCACATCAGAAGAGGCACCACAAGGCGTACGC
GAGGGCGGTGAGATCAAAGCCATTCATTATCGAGACGAGGAAGCCATATACGTCAAAGCCAGCCACGATCGAGTC
ACCATCATTTTCAGTACAGTATTTCGCGAGGAGACAGACAAAGTATTTGGCAAAGTCTTTATCCAGGAGTTTGTC
GATGCTCGGAGGAGAGCAATTCAGAATGCTCCTCAGGTTCTCTTTCGACAAGACCCACCTCTCGAATTACAAGGT
GTTCCAGGTGTGCGCGATACTGGCACAGGCGAGATTGGATACGTCACGTTTGTTCTTTTCCCGAGACACCTTACT
CCGCAACGGATGCCAATTGTTGTCTCCCATATTCAGACATTCAGGGACTACTTTCATTACCACATAAAAGCATCC
AAAGCATATATCCACTCGCGCATGCGGAAACGTACTGCCGACTTTTTACAAGTTCTACGCCGCGCACGTCCCGAA
AACGAGGAAAGAGAAAGAAAGACTGCAAGTGGCAGATCGTTCAAGACTCAAGGAAACTGA
Transcript >OphauB2|344
ATGCTTCTTCTCGACTATCAGAATGTCCTTATTCAGTCGGTCCTCACCGAGCGCTTCTCCGGTGCTCCTCCTGTG
TCCATTGACCAAACCGTGTCGGATTTTGACGGCGTCATCTTTCACATCTCGACTCCCGAATCCAAATCAAAAATT
CTCCTATCTCTCCAGATAAAATGCTTCAAGGATCTTGTTCGCTACGGAGCTGAGCAGGTCTTACGGCGCGAATAC
GGCGATTTCCTGGCACCGGTCGAGCCAGGCTATGACTTCTCCGTCATGGTCGACTTAGAGAATCTCCCCGCTGAA
AAGGAGGAACGCGACGCTTTGGCTATGAAGTTTGCTTTACTAAAACGCAATGCCATGGCTGCCCCTTTTGAGCAA
GCCTACGAGGAATATTACAAATTGAAAGAGGAGGCATCCAAATTCACATCAGAAGAGGCACCACAAGGCGTACGC
GAGGGCGGTGAGATCAAAGCCATTCATTATCGAGACGAGGAAGCCATATACGTCAAAGCCAGCCACGATCGAGTC
ACCATCATTTTCAGTACAGTATTTCGCGAGGAGACAGACAAAGTATTTGGCAAAGTCTTTATCCAGGAGTTTGTC
GATGCTCGGAGGAGAGCAATTCAGAATGCTCCTCAGGTTCTCTTTCGACAAGACCCACCTCTCGAATTACAAGGT
GTTCCAGGTGTGCGCGATACTGGCACAGGCGAGATTGGATACGTCACGTTTGTTCTTTTCCCGAGACACCTTACT
CCGCAACGGATGCCAATTGTTGTCTCCCATATTCAGACATTCAGGGACTACTTTCATTACCACATAAAAGCATCC
AAAGCATATATCCACTCGCGCATGCGGAAACGTACTGCCGACTTTTTACAAGTTCTACGCCGCGCACGTCCCGAA
AACGAGGAAAGAGAAAGAAAGACTGCAAGTGGCAGATCGTTCAAGACTCAAGGAAACTGA
Gene >OphauB2|344
ATGCTTCTTCTCGACTATCAGAATGTCCTTATTCAGTCGGTCCTCACCGAGCGCTTCTCCGGGTATGTAACTTGC
TATTCAATTATACAAGATGTCATGGCTAATGCTGACGATGCACGACATACATAGTGCTCCTCCTGTGTCCATTGA
CCAAACCGTGTCGGATTTTGACGGCGTCATCTTTCACATCTCGACTCCCGAATCCAAATCAAAAATTCTCCTATC
TCTCCAGATAAAATGCTTCAAGGATCTTGTTCGCTACGGAGCTGAGCAGGTCTTACGGCGCGAATACGGCGATTT
CCTGGCACCGGTCGAGCCAGGCTATGACTTCTCCGTCATGGTCGACTTAGAGAATCTCCCCGCTGAAAAGGGTCA
GTCATGTGCTTTGTGCTTTTGCATCCTCCTCCTAAGTTGCTGGTTGACAAAAGGAGCTTCTTAGAGGAACGCGAC
GCTTTGGCTATGAAGTTTGCTTTACTAAAACGCAATGCCATGGCTGCCCCTTTTGAGCAAGCCTACGAGGAATAT
TACAAATTGAAAGAGGAGGCATCCAAATTCACATCAGAAGAGGCACCACAAGGCGTACGCGAGGGCGGTGAGATC
AAAGCCATTCATTATCGAGACGAGGAAGCCATATACGTCAAAGCCAGCCACGATCGAGTCACCATCATTTTCAGT
ACAGTATTTCGCGAGGAGACAGACAAAGTATTTGGCAAAGTCTTTATCCAGGAGTTTGTCGATGCTCGGAGGAGA
GCAATTCAGAATGCTCCTCAGGTTCTCTTTCGACAAGACCCACCTCTCGAATTACAAGGTGTTCCAGGTGTGCGC
GATACTGGCACAGGCGAGATTGGATACGTCACGTTTGGTAAGATGCCTGTCTGCATTACAACCTGGCCCTGTGGC
GCTAATTTTCTTTGTTTAGTTCTTTTCCCGAGACACCTTACTCCGCAACGGATGCCAATTGTTGTCTCCCATATT
CAGACATTCAGGGACTACTTTCATTACCACATAAAAGCATCCAAAGCATATATCCACTCGCGCATGCGGAAACGT
ACTGCCGACTTTTTACAAGGTACATTGCCCGCCATCCTGCCAGCAATGAATATTTGCTAACTTGTCGACTTAGTT
CTACGCCGCGCACGTCCCGAAAACGAGGAAAGAGAAAGAAAGACTGCAAGTGGCAGATCGTTCAAGACTCAAGGA
AACTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail