Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|3402
Gene name
LocationContig_217:17775..19539
Strand+
Gene length (bp)1764
Transcript length (bp)1431
Coding sequence length (bp)1431
Protein length (aa) 477

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01565 FAD_binding_4 FAD binding domain 1.8E-20 47 181

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|D4B1P2|A2372_ARTBC Uncharacterized FAD-linked oxidoreductase ARB_02372 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_02372 PE=1 SV=1 24 472 8.0E-36
sp|D7UQ40|SOL5_ALTSO Bifunctional solanapyrone synthase OS=Alternaria solani GN=sol5 PE=1 SV=1 8 239 2.0E-18
sp|P08159|HDNO_ARTOX 6-hydroxy-D-nicotine oxidase OS=Arthrobacter oxydans PE=1 SV=2 44 248 3.0E-17
sp|P43485|MCRA_STRLA Mitomycin radical oxidase OS=Streptomyces lavendulae GN=mcrA PE=1 SV=2 23 279 1.0E-16
sp|Q6Z955|CKX11_ORYSJ Cytokinin dehydrogenase 11 OS=Oryza sativa subsp. japonica GN=CKX11 PE=2 SV=1 41 296 2.0E-13
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|D4B1P2|A2372_ARTBC Uncharacterized FAD-linked oxidoreductase ARB_02372 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_02372 PE=1 SV=1 24 472 8.0E-36
sp|D7UQ40|SOL5_ALTSO Bifunctional solanapyrone synthase OS=Alternaria solani GN=sol5 PE=1 SV=1 8 239 2.0E-18
sp|P08159|HDNO_ARTOX 6-hydroxy-D-nicotine oxidase OS=Arthrobacter oxydans PE=1 SV=2 44 248 3.0E-17
sp|P43485|MCRA_STRLA Mitomycin radical oxidase OS=Streptomyces lavendulae GN=mcrA PE=1 SV=2 23 279 1.0E-16
sp|Q6Z955|CKX11_ORYSJ Cytokinin dehydrogenase 11 OS=Oryza sativa subsp. japonica GN=CKX11 PE=2 SV=1 41 296 2.0E-13
sp|Q54H55|Y8969_DICDI FAD-linked oxidoreductase DDB_G0289697 OS=Dictyostelium discoideum GN=DDB_G0289697 PE=2 SV=1 17 218 3.0E-11
sp|O22213|CKX1_ARATH Cytokinin dehydrogenase 1 OS=Arabidopsis thaliana GN=CKX1 PE=1 SV=1 6 214 4.0E-10
sp|Q9FUJ3|CKX2_ARATH Cytokinin dehydrogenase 2 OS=Arabidopsis thaliana GN=CKX2 PE=1 SV=2 45 214 4.0E-09
sp|P58710|GGLO_MOUSE L-gulonolactone oxidase OS=Mus musculus GN=Gulo PE=1 SV=3 29 203 5.0E-09
sp|Q9LY71|CKX6_ARATH Cytokinin dehydrogenase 6 OS=Arabidopsis thaliana GN=CKX6 PE=2 SV=2 7 248 2.0E-08
sp|Q796Y5|YGAK_BACSU Uncharacterized FAD-linked oxidoreductase YgaK OS=Bacillus subtilis (strain 168) GN=ygaK PE=3 SV=4 24 251 5.0E-08
sp|Q3ZC33|GGLO_BOVIN L-gulonolactone oxidase OS=Bos taurus GN=GULO PE=2 SV=3 29 224 7.0E-08
sp|A3AVP1|CKX8_ORYSJ Cytokinin dehydrogenase 8 OS=Oryza sativa subsp. japonica GN=CKX8 PE=3 SV=1 45 215 2.0E-07
sp|A2XVN3|CKX8_ORYSI Cytokinin dehydrogenase 8 OS=Oryza sativa subsp. indica GN=CKX8 PE=3 SV=1 45 215 2.0E-07
sp|Q75K78|CKX9_ORYSJ Cytokinin dehydrogenase 9 OS=Oryza sativa subsp. japonica GN=CKX9 PE=2 SV=1 45 214 1.0E-06
sp|Q9FUJ1|CKX7_ARATH Cytokinin dehydrogenase 7 OS=Arabidopsis thaliana GN=CKX7 PE=1 SV=1 44 205 2.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0050660 flavin adenine dinucleotide binding Yes
GO:0016491 oxidoreductase activity Yes
GO:0003824 catalytic activity No
GO:0003674 molecular_function No
GO:0005488 binding No
GO:0036094 small molecule binding No
GO:0043168 anion binding No
GO:1901363 heterocyclic compound binding No
GO:1901265 nucleoside phosphate binding No
GO:0097159 organic cyclic compound binding No
GO:0043167 ion binding No
GO:0000166 nucleotide binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 19 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|3402
MSLAAEAAIASLEAAGLASITLKPGHDDYETRANSSWSRTVRCRPWAIVQPRSTNDVCAAVKAIVATPNCNFAIR
SGGHSPWPGAASINQGILIDLGQMVGTTYHAHTQIASILPGGTWTQVYTELEKHGRLVAGGREGHIGVGGLVLGG
GLGFQTCRVGFTCDQVVNFVLVDSTGTALDVNASSHPDLFRALKGGGNNFGIVTRFDMATFAAPPAFLHGSVTFA
LHAAPHLAKAYVNYVSCLNHRPDSHVLVAWETRPNQDCLIRLMVFGLDGIKDHPDLLPLINCPGAHTDLQLSTVA
TNVGQFLMPSDKENIWFSATFRANPQVILHAARIYPPLLALIKSHVPSGDFFSLLTFQPLPASFAQRSHQNVIGI
DAADGDCILLALVLQVASPSLCNDIVIPAAKALVANLEDFARSLDAFVPWRYANYCSPHQDPAASFGARNLSFVR
HVAARYDPQAIFQNRVPGGFKIPPPQ*
Coding >OphauB2|3402
ATGTCATTGGCTGCAGAAGCCGCCATTGCCAGCCTCGAGGCGGCCGGCCTGGCTTCCATAACCCTCAAGCCCGGC
CACGACGACTACGAGACGCGAGCCAACTCGTCGTGGTCTCGTACCGTGCGCTGTCGCCCCTGGGCCATTGTCCAA
CCTCGCAGCACCAATGACGTCTGTGCTGCTGTCAAGGCCATTGTCGCTACCCCCAATTGTAACTTTGCTATACGC
AGTGGCGGCCATAGCCCCTGGCCCGGCGCCGCCAGTATCAACCAGGGCATCCTCATCGACCTTGGCCAAATGGTG
GGCACCACTTACCATGCCCACACTCAGATTGCCTCGATTCTTCCTGGAGGCACCTGGACCCAAGTCTATACAGAA
CTCGAGAAGCATGGACGCCTGGTAGCTGGAGGCCGCGAGGGCCATATTGGCGTCGGCGGCCTCGTGCTCGGCGGC
GGCCTGGGCTTCCAGACTTGCCGCGTCGGTTTCACATGCGACCAAGTCGTCAACTTTGTCCTCGTCGACAGTACT
GGCACTGCCCTTGATGTCAACGCTTCCTCGCACCCTGACCTCTTCCGCGCTCTCAAGGGCGGCGGCAACAACTTT
GGCATCGTCACCCGCTTCGACATGGCCACCTTTGCTGCCCCTCCTGCCTTTTTGCATGGCTCCGTCACTTTTGCT
CTCCATGCCGCTCCACACCTCGCCAAAGCCTATGTGAATTATGTCTCTTGCCTCAACCACCGGCCCGACAGCCAC
GTCCTTGTCGCCTGGGAAACCCGCCCCAACCAAGACTGCCTCATTCGTCTCATGGTCTTTGGCCTCGACGGTATT
AAAGACCATCCTGACCTGCTGCCCCTCATCAACTGCCCCGGCGCTCATACCGACCTGCAACTCTCCACTGTTGCC
ACCAACGTTGGCCAGTTTCTCATGCCCTCTGACAAAGAAAACATTTGGTTCTCCGCCACCTTTAGGGCAAACCCC
CAAGTCATCCTCCACGCTGCCAGGATTTACCCTCCTCTGCTCGCTCTCATCAAATCCCACGTTCCCTCGGGTGAC
TTCTTTTCTCTCTTGACCTTTCAGCCTCTGCCAGCCTCGTTTGCTCAACGCTCCCATCAAAATGTCATTGGCATC
GATGCCGCCGACGGAGACTGCATCCTTTTGGCCCTGGTACTCCAAGTCGCGTCGCCGTCACTCTGTAATGACATT
GTTATCCCCGCTGCCAAGGCCCTCGTTGCCAACTTGGAAGACTTTGCTCGCTCTCTAGATGCCTTTGTTCCTTGG
CGCTATGCCAACTACTGCTCGCCCCATCAGGACCCAGCCGCTTCCTTTGGCGCTCGCAATCTTTCCTTTGTCCGC
CATGTCGCTGCTCGCTACGATCCTCAGGCAATCTTCCAAAACAGAGTCCCAGGTGGCTTCAAAATTCCTCCACCC
CAATAA
Transcript >OphauB2|3402
ATGTCATTGGCTGCAGAAGCCGCCATTGCCAGCCTCGAGGCGGCCGGCCTGGCTTCCATAACCCTCAAGCCCGGC
CACGACGACTACGAGACGCGAGCCAACTCGTCGTGGTCTCGTACCGTGCGCTGTCGCCCCTGGGCCATTGTCCAA
CCTCGCAGCACCAATGACGTCTGTGCTGCTGTCAAGGCCATTGTCGCTACCCCCAATTGTAACTTTGCTATACGC
AGTGGCGGCCATAGCCCCTGGCCCGGCGCCGCCAGTATCAACCAGGGCATCCTCATCGACCTTGGCCAAATGGTG
GGCACCACTTACCATGCCCACACTCAGATTGCCTCGATTCTTCCTGGAGGCACCTGGACCCAAGTCTATACAGAA
CTCGAGAAGCATGGACGCCTGGTAGCTGGAGGCCGCGAGGGCCATATTGGCGTCGGCGGCCTCGTGCTCGGCGGC
GGCCTGGGCTTCCAGACTTGCCGCGTCGGTTTCACATGCGACCAAGTCGTCAACTTTGTCCTCGTCGACAGTACT
GGCACTGCCCTTGATGTCAACGCTTCCTCGCACCCTGACCTCTTCCGCGCTCTCAAGGGCGGCGGCAACAACTTT
GGCATCGTCACCCGCTTCGACATGGCCACCTTTGCTGCCCCTCCTGCCTTTTTGCATGGCTCCGTCACTTTTGCT
CTCCATGCCGCTCCACACCTCGCCAAAGCCTATGTGAATTATGTCTCTTGCCTCAACCACCGGCCCGACAGCCAC
GTCCTTGTCGCCTGGGAAACCCGCCCCAACCAAGACTGCCTCATTCGTCTCATGGTCTTTGGCCTCGACGGTATT
AAAGACCATCCTGACCTGCTGCCCCTCATCAACTGCCCCGGCGCTCATACCGACCTGCAACTCTCCACTGTTGCC
ACCAACGTTGGCCAGTTTCTCATGCCCTCTGACAAAGAAAACATTTGGTTCTCCGCCACCTTTAGGGCAAACCCC
CAAGTCATCCTCCACGCTGCCAGGATTTACCCTCCTCTGCTCGCTCTCATCAAATCCCACGTTCCCTCGGGTGAC
TTCTTTTCTCTCTTGACCTTTCAGCCTCTGCCAGCCTCGTTTGCTCAACGCTCCCATCAAAATGTCATTGGCATC
GATGCCGCCGACGGAGACTGCATCCTTTTGGCCCTGGTACTCCAAGTCGCGTCGCCGTCACTCTGTAATGACATT
GTTATCCCCGCTGCCAAGGCCCTCGTTGCCAACTTGGAAGACTTTGCTCGCTCTCTAGATGCCTTTGTTCCTTGG
CGCTATGCCAACTACTGCTCGCCCCATCAGGACCCAGCCGCTTCCTTTGGCGCTCGCAATCTTTCCTTTGTCCGC
CATGTCGCTGCTCGCTACGATCCTCAGGCAATCTTCCAAAACAGAGTCCCAGGTGGCTTCAAAATTCCTCCACCC
CAATAA
Gene >OphauB2|3402
ATGTCATTGGCTGCAGAAGCCGCCATTGCCAGCCTCGAGGCGGCCGGCCTGGCTTCCATAACCCTCAAGCCCGGC
CACGACGACTACGAGACGCGAGCCAACTCGTCGTGGTCTCGTACCGTGCGCTGTCGCCCCTGGGCCATTGTCCAA
CCTCGCAGCACCAATGACGTCTGTGCTGCTGTCAAGGCCATTGTCGCTACCCCCAATTGTAACTTTGCTATACGC
AGGTAAAGCCGCCCTCTTTGATTCTTGTTGGTCTCACCTACCACTCATGCCAGTCTAGTGGCGGCCATAGCCCCT
GGCCCGGCGCCGCCAGTATCAACCAGGGCATCCTCATCGACCTTGGCCAAATGGTGGGCACCACTTACCATGCCC
ACACTCAGATTGCCTCGATTCTTCCTGGAGGCACCTGGACCCAAGTCTATACAGAACTCGAGAAGCGTACCTCTT
CCTCTTGACTCCCTCTTGACTCCCCCTTGACTCCCCCTTGACTCCCTCGACTCCACTTGCCGCTGACAGAAACAA
CCCAGATGGACGCCTGGTAGCTGGAGGCCGCGAGGGCCATATTGGCGTCGGCGGCCTCGTGCTCGGCGGCGGCCT
GGGCTTCCAGACTTGCCGCGTCGGTTTCACATGCGGTGCGTCCACTCTTTGTGTCTCTCGTCCTGTCTCGCGCCA
TGCGCTAAACCTCCAAGCTAGACCAAGTCGTCAACTTTGTCCTCGTCGACAGTACTGGCACTGCCCTTGATGTCA
ACGCTTCCTCGCACCCTGACCTCTTCCGCGCTCTCAAGGGCGGCGGCAACAACTTTGGCATCGTCACCCGCTTCG
ACATGGCCACCTTTGCTGCCCCTCCTGCCTTTTTGCATGGCTCCGTCACTTTTGCTCTCCATGCCGCTCCACACC
TCGCCAAAGCCTATGTGAATTATGTCTCTTGCCTCAACCACCGGCCCGACAGCCACGTCCTTGTCGCCTGGGAAA
CCCGCCCCAACCAAGACTGCCTCATTCGTCTCATGGTCTTTGGCCTCGACGGTATTAAAGACCATCCTGACCTGC
TGCCCCTCATCAACTGCCCCGGCGCTCATACCGACCTGCAACTCTCCACTGTTGCCACCAACGTTGGCCAGTTTC
TCATGCCCTCTGACAAAGAGTAAGCAGTCTGCTCACCGTCGTCTCCCTATGCCTCTTGCTTTCCCTCTTCCTCTC
CTTGTCCCTCTCCTTGTCCCTCTCCTTGGCCACTTGTTCCCAGGCTGATATTGGCTGCGCCTTTGAAAAAGAAAC
ATTTGGTTCTCCGCCACCTTTAGGGCAAACCCCCAAGTCATCCTCCACGCTGCCAGGATTTACCCTCCTCTGCTC
GCTCTCATCAAATCCCACGTTCCCTCGGGTGACTTCTTTTCTCTCTTGACCTTTCAGCCTCTGCCAGCCTCGTTT
GCTCAACGCTCCCATCAAAATGTCATTGGCATCGATGCCGCCGACGGAGACTGCATCCTTTTGGCCCTGGTACTC
CAAGTCGCGTCGCCGTCACTCTGTAATGACATTGTTATCCCCGCTGCCAAGGCCCTCGTTGCCAACTTGGAAGAC
TTTGCTCGCTCTCTAGATGCCTTTGTTCCTTGGCGCTATGCCAACTACTGCTCGCCCCATCAGGACCCAGCCGCT
TCCTTTGGCGCTCGCAATCTTTCCTTTGTCCGCCATGTCGCTGCTCGCTACGATCCTCAGGCAATCTTCCAAAAC
AGAGTCCCAGGTGGCTTCAAAATTCCTCCACCCCAATAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail