Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|3398
Gene name
LocationContig_217:11321..12010
Strand+
Gene length (bp)689
Transcript length (bp)345
Coding sequence length (bp)345
Protein length (aa) 115

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01253 SUI1 Translation initiation factor SUI1 5.4E-27 26 98

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P32911|SUI1_YEAST Eukaryotic translation initiation factor eIF-1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SUI1 PE=1 SV=1 1 114 7.0E-43
sp|Q755R1|SUI1_ASHGO Protein translation factor SUI1 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=SUI1A PE=3 SV=1 1 114 3.0E-41
sp|P79060|SUI1_SCHPO Protein translation factor sui1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sui1 PE=3 SV=3 2 114 7.0E-39
sp|Q0D5W6|SUI1_ORYSJ Protein translation factor SUI1 homolog OS=Oryza sativa subsp. japonica GN=GOS2 PE=3 SV=1 10 114 2.0E-35
sp|A6MZM2|SUI1_ORYSI Protein translation factor SUI1 homolog OS=Oryza sativa subsp. indica GN=GOS2 PE=2 SV=1 10 114 2.0E-35
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P32911|SUI1_YEAST Eukaryotic translation initiation factor eIF-1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SUI1 PE=1 SV=1 1 114 7.0E-43
sp|Q755R1|SUI1_ASHGO Protein translation factor SUI1 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=SUI1A PE=3 SV=1 1 114 3.0E-41
sp|P79060|SUI1_SCHPO Protein translation factor sui1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sui1 PE=3 SV=3 2 114 7.0E-39
sp|Q0D5W6|SUI1_ORYSJ Protein translation factor SUI1 homolog OS=Oryza sativa subsp. japonica GN=GOS2 PE=3 SV=1 10 114 2.0E-35
sp|A6MZM2|SUI1_ORYSI Protein translation factor SUI1 homolog OS=Oryza sativa subsp. indica GN=GOS2 PE=2 SV=1 10 114 2.0E-35
sp|P56330|SUI1_MAIZE Protein translation factor SUI1 homolog OS=Zea mays GN=TIF PE=3 SV=1 10 114 2.0E-35
sp|Q9SM41|SUI1_SPOST Protein translation factor SUI1 homolog OS=Sporobolus stapfianus PE=3 SV=1 10 114 7.0E-35
sp|Q94JV4|SUI12_ARATH Protein translation factor SUI1 homolog 2 OS=Arabidopsis thaliana GN=At1g54290 PE=3 SV=1 10 114 6.0E-34
sp|P41568|SUI11_ARATH Protein translation factor SUI1 homolog 1 OS=Arabidopsis thaliana GN=At4g27130 PE=1 SV=2 10 114 7.0E-34
sp|O48650|SUI1_SALBA Protein translation factor SUI1 homolog OS=Salix bakko PE=3 SV=1 10 114 8.0E-34
sp|Q9SQF4|SUI1_BRAOL Protein translation factor SUI1 homolog OS=Brassica oleracea PE=3 SV=1 10 114 4.0E-33
sp|P42678|SUI1_ANOGA Protein translation factor SUI1 homolog OS=Anopheles gambiae GN=AGAP006459 PE=3 SV=1 1 114 1.0E-32
sp|Q9VZS3|SUI1_DROME Protein translation factor SUI1 homolog OS=Drosophila melanogaster GN=CG17737 PE=1 SV=1 1 114 1.0E-31
sp|O82569|SUI1_PIMBR Protein translation factor SUI1 homolog OS=Pimpinella brachycarpa PE=3 SV=1 10 114 3.0E-31
sp|Q5RFF4|EIF1_PONAB Eukaryotic translation initiation factor 1 OS=Pongo abelii GN=EIF1 PE=3 SV=1 2 114 7.0E-30
sp|Q5E938|EIF1_BOVIN Eukaryotic translation initiation factor 1 OS=Bos taurus GN=EIF1 PE=3 SV=1 2 114 7.0E-30
sp|P41567|EIF1_HUMAN Eukaryotic translation initiation factor 1 OS=Homo sapiens GN=EIF1 PE=1 SV=1 2 114 7.0E-30
sp|P48024|EIF1_MOUSE Eukaryotic translation initiation factor 1 OS=Mus musculus GN=Eif1 PE=1 SV=2 2 114 1.0E-29
sp|P61220|EIF1B_PIG Eukaryotic translation initiation factor 1b OS=Sus scrofa GN=EIF1B PE=3 SV=1 2 114 3.0E-28
sp|Q9CXU9|EIF1B_MOUSE Eukaryotic translation initiation factor 1b OS=Mus musculus GN=Eif1b PE=1 SV=2 2 114 3.0E-28
sp|Q4R4X9|EIF1B_MACFA Eukaryotic translation initiation factor 1b OS=Macaca fascicularis GN=EIF1B PE=3 SV=1 2 114 3.0E-28
sp|O60739|EIF1B_HUMAN Eukaryotic translation initiation factor 1b OS=Homo sapiens GN=EIF1B PE=1 SV=2 2 114 3.0E-28
sp|P51971|EIF1_CHICK Eukaryotic translation initiation factor 1 (Fragment) OS=Gallus gallus GN=EIF1 PE=3 SV=1 33 114 6.0E-21
sp|Q5UQD7|SUI1_MIMIV Protein translation factor SUI1 homolog OS=Acanthamoeba polyphaga mimivirus GN=MIMI_R464 PE=3 SV=1 10 96 2.0E-09
sp|Q5UZP9|SUI1_HALMA Protein translation factor SUI1 homolog OS=Haloarcula marismortui (strain ATCC 43049 / DSM 3752 / JCM 8966 / VKM B-1809) GN=sui1 PE=3 SV=1 21 98 5.0E-07
sp|B8GDE2|SUI1_METPE Protein translation factor SUI1 homolog OS=Methanosphaerula palustris (strain ATCC BAA-1556 / DSM 19958 / E1-9c) GN=Mpal_1990 PE=3 SV=1 21 106 9.0E-07
sp|Q9HME3|SUI1_HALSA Protein translation factor SUI1 homolog OS=Halobacterium salinarum (strain ATCC 700922 / JCM 11081 / NRC-1) GN=VNG_2584C PE=3 SV=1 21 98 1.0E-06
sp|B0R868|SUI1_HALS3 Protein translation factor SUI1 homolog OS=Halobacterium salinarum (strain ATCC 29341 / DSM 671 / R1) GN=OE_4626R PE=3 SV=1 21 98 1.0E-06
sp|A0RWW9|SUI1_CENSY Protein translation factor SUI1 homolog OS=Cenarchaeum symbiosum (strain A) GN=CENSYa_1212 PE=3 SV=1 19 112 6.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0006413 translational initiation Yes
GO:0003743 translation initiation factor activity Yes
GO:0009987 cellular process No
GO:0003674 molecular_function No
GO:0045182 translation regulator activity No
GO:0008152 metabolic process No
GO:0005488 binding No
GO:0008135 translation factor activity, RNA binding No
GO:0008150 biological_process No
GO:0044237 cellular metabolic process No
GO:1901363 heterocyclic compound binding No
GO:0090079 translation regulator activity, nucleic acid binding No
GO:0097159 organic cyclic compound binding No
GO:0003676 nucleic acid binding No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup5239
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|1754
Ophiocordyceps australis map64 (Brazil) OphauB2|3398 (this protein)
Ophiocordyceps camponoti-floridani Ophcf2|06261
Ophiocordyceps camponoti-rufipedis Ophun1|1717
Ophiocordyceps kimflemingae Ophio5|2308
Ophiocordyceps subramaniannii Hirsu2|4374

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|3398
MSIENLKNKDPFAEADEDAGDTKQKQSYIHIRIQQRNGRKTLTTVQGLPKKFDQRKILKVIKKKFACNGTIVNDV
EMGEVIQLQGDQRKVVQEFLVDKEEGLELDSKTIKIHGF*
Coding >OphauB2|3398
ATGTCCATCGAAAATCTCAAGAACAAGGACCCCTTCGCCGAAGCCGACGAAGACGCAGGCGACACCAAGCAGAAA
CAGAGTTATATCCATATACGCATCCAACAGCGTAATGGGCGCAAAACATTGACCACTGTTCAAGGTCTACCAAAG
AAATTTGATCAGAGGAAAATTCTTAAAGTCATCAAGAAGAAATTTGCCTGCAATGGCACCATCGTCAATGATGTG
GAAATGGGCGAGGTGATCCAACTTCAAGGAGATCAGCGCAAAGTTGTCCAGGAATTTCTCGTCGACAAGGAAGAG
GGTCTCGAGCTAGACTCCAAGACGATCAAAATTCACGGTTTCTAA
Transcript >OphauB2|3398
ATGTCCATCGAAAATCTCAAGAACAAGGACCCCTTCGCCGAAGCCGACGAAGACGCAGGCGACACCAAGCAGAAA
CAGAGTTATATCCATATACGCATCCAACAGCGTAATGGGCGCAAAACATTGACCACTGTTCAAGGTCTACCAAAG
AAATTTGATCAGAGGAAAATTCTTAAAGTCATCAAGAAGAAATTTGCCTGCAATGGCACCATCGTCAATGATGTG
GAAATGGGCGAGGTGATCCAACTTCAAGGAGATCAGCGCAAAGTTGTCCAGGAATTTCTCGTCGACAAGGAAGAG
GGTCTCGAGCTAGACTCCAAGACGATCAAAATTCACGGTTTCTAA
Gene >OphauB2|3398
ATGTCCATCGAAAATCTCAAGAACAAGGGTAAGCATAACTAGATGCGGCTCACGACGCGTCTTGCCCATTTTTTT
CTACGGCCTCGCCTGCGTGTTTACCAATGACTCCCTACCCCGTGCGGGCCCCGTCTTGGCCGCCAAGACGCACGC
ATCCTTAACTAACACTTTGTTCTCTACGGCAAATCTGACTAACATGGCTTTTTATAGACCCCTTCGCCGAAGCCG
ACGAAGACGCAGGCGACACCAAGCAGAAACAGAGTTATATCCATATACGCATCCAACGTACGTCCTATAGGCCTG
TTTCCTCGTTGTTGGCATCTCCTCGTTTGATCAAGACAATTTTGTTATGCCGTCTGCTGTCTTTGACGCTAACGT
GACATTACAGAGCGTAATGGGCGCAAAACATTGACCACTGTTCAAGGTCTACCAAAGAAATTTGATCAGAGGAAA
ATTCTTAAAGTCATCAAGAAGAAATTTGGTTAGTACACACACTCATGCTCCTCAACTTGCATCGCATCACTTACA
AGTAATGCTCGATAGCCTGCAATGGCACCATCGTCAATGATGTGGAAATGGGCGAGGTGATCCAACTTCAAGGAG
ATCAGCGCAAAGTTGTCCAGGAATTTCTCGTCGACAAGGAAGAGGGTCTCGAGCTAGACTCCAAGACGATCAAAA
TTCACGGTTTCTAA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail