Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|3393
Gene name
LocationContig_216:25715..26444
Strand-
Gene length (bp)729
Transcript length (bp)729
Coding sequence length (bp)729
Protein length (aa) 243

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01822 WSC WSC domain 2.6E-17 31 107
PF01822 WSC WSC domain 8.2E-18 137 213

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|D4AUF4|WSCD2_ARTBC WSC domain-containing protein ARB_07870 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_07870 PE=1 SV=1 20 223 2.0E-42
sp|P84675|PFM_CHAGB Putative fungistatic metabolite OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=CHGG_05463 PE=1 SV=2 29 221 8.0E-31
sp|D4AUF1|WSCD1_ARTBC WSC domain-containing protein ARB_07867 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_07867 PE=1 SV=1 17 230 7.0E-25
sp|D4AUF1|WSCD1_ARTBC WSC domain-containing protein ARB_07867 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_07867 PE=1 SV=1 6 221 2.0E-20
sp|D4AUF4|WSCD2_ARTBC WSC domain-containing protein ARB_07870 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_07870 PE=1 SV=1 129 234 5.0E-18
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|D4AUF4|WSCD2_ARTBC WSC domain-containing protein ARB_07870 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_07870 PE=1 SV=1 20 223 2.0E-42
sp|P84675|PFM_CHAGB Putative fungistatic metabolite OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=CHGG_05463 PE=1 SV=2 29 221 8.0E-31
sp|D4AUF1|WSCD1_ARTBC WSC domain-containing protein ARB_07867 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_07867 PE=1 SV=1 17 230 7.0E-25
sp|D4AUF1|WSCD1_ARTBC WSC domain-containing protein ARB_07867 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_07867 PE=1 SV=1 6 221 2.0E-20
sp|D4AUF4|WSCD2_ARTBC WSC domain-containing protein ARB_07870 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_07870 PE=1 SV=1 129 234 5.0E-18
sp|P84675|PFM_CHAGB Putative fungistatic metabolite OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=CHGG_05463 PE=1 SV=2 129 232 2.0E-12
sp|A2BGL3|WSCD2_DANRE WSC domain-containing protein 2 OS=Danio rerio GN=wscd2 PE=3 SV=1 31 221 3.0E-10
sp|A2BGL3|WSCD2_DANRE WSC domain-containing protein 2 OS=Danio rerio GN=wscd2 PE=3 SV=1 123 225 8.0E-10
sp|Q2TBF2|WSCD2_HUMAN WSC domain-containing protein 2 OS=Homo sapiens GN=WSCD2 PE=2 SV=2 137 225 3.0E-09
sp|D4PHA7|WSCD2_MOUSE WSC domain-containing protein 2 OS=Mus musculus GN=Wscd2 PE=2 SV=1 137 225 4.0E-09
sp|Q2TBF2|WSCD2_HUMAN WSC domain-containing protein 2 OS=Homo sapiens GN=WSCD2 PE=2 SV=2 31 221 6.0E-09
sp|D4PHA7|WSCD2_MOUSE WSC domain-containing protein 2 OS=Mus musculus GN=Wscd2 PE=2 SV=1 31 221 1.0E-08
sp|Q7KVA1|XYLT_DROME Xylosyltransferase oxt OS=Drosophila melanogaster GN=oxt PE=2 SV=1 137 221 1.0E-08
sp|Q5QQ53|XYLT_DROPS Xylosyltransferase oxt OS=Drosophila pseudoobscura pseudoobscura GN=oxt PE=2 SV=1 21 133 4.0E-08
sp|Q5QQ53|XYLT_DROPS Xylosyltransferase oxt OS=Drosophila pseudoobscura pseudoobscura GN=oxt PE=2 SV=1 137 221 5.0E-08
sp|Q658N2|WSCD1_HUMAN WSC domain-containing protein 1 OS=Homo sapiens GN=WSCD1 PE=2 SV=1 29 184 6.0E-08
sp|Q80XH4|WSCD1_MOUSE WSC domain-containing protein 1 OS=Mus musculus GN=Wscd1 PE=2 SV=1 2 184 9.0E-08
sp|Q7KVA1|XYLT_DROME Xylosyltransferase oxt OS=Drosophila melanogaster GN=oxt PE=2 SV=1 9 115 1.0E-07
sp|Q505J3|WSCD1_RAT WSC domain-containing protein 1 OS=Rattus norvegicus GN=Wscd1 PE=2 SV=1 31 184 1.0E-07
sp|Q0IIY2|WSCD1_XENTR WSC domain-containing protein 1 OS=Xenopus tropicalis GN=wscd1 PE=2 SV=1 4 115 3.0E-07
sp|Q658N2|WSCD1_HUMAN WSC domain-containing protein 1 OS=Homo sapiens GN=WSCD1 PE=2 SV=1 128 228 4.0E-07
sp|Q5QQ52|XYLT_CAEBR Xylosyltransferase sqv-6 OS=Caenorhabditis briggsae GN=sqv-6 PE=2 SV=1 15 130 4.0E-07
sp|Q80XH4|WSCD1_MOUSE WSC domain-containing protein 1 OS=Mus musculus GN=Wscd1 PE=2 SV=1 137 228 7.0E-07
sp|Q505J3|WSCD1_RAT WSC domain-containing protein 1 OS=Rattus norvegicus GN=Wscd1 PE=2 SV=1 137 225 2.0E-06
sp|Q8NCW0|KREM2_HUMAN Kremen protein 2 OS=Homo sapiens GN=KREMEN2 PE=2 SV=1 137 225 3.0E-06
sp|Q8K1S7|KREM2_MOUSE Kremen protein 2 OS=Mus musculus GN=Kremen2 PE=1 SV=1 137 225 6.0E-06
[Show less]

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup4826
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|3481
Ophiocordyceps australis map64 (Brazil) OphauB2|3393 (this protein)
Ophiocordyceps australis map64 (Brazil) OphauB2|510
Ophiocordyceps australis map64 (Brazil) OphauB2|6706
Ophiocordyceps subramaniannii Hirsu2|10702

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|3393
MELYSTTSAPATPTPTATLTHKATVAPYTLVGCWAEAKGTRALEQKATTSGSMSNEACAAFCAGYKYFGTEYGSE
CYCGSYVGETSAAAPLAECNMPCGGDGYAYCGASNRLELYMNANATGGRPEQPPAAGAFHLVGCQSEGTGTRALA
DKVTAADDMTNAKCAGLCAGYKFFGTEYGRECYCGNVLDASSKAAPASECRMLCSGSAAEYCGASNRLSVYTKSL
LPPPAGPVVKRRARASE*
Coding >OphauB2|3393
ATGGAGCTCTACTCAACAACCAGCGCGCCCGCCACGCCTACGCCCACGGCCACGCTCACGCACAAGGCCACCGTG
GCGCCCTACACCCTTGTTGGCTGCTGGGCCGAGGCCAAGGGCACGCGCGCGCTCGAGCAAAAGGCCACAACGAGC
GGCAGCATGAGCAACGAGGCGTGTGCCGCCTTTTGCGCCGGCTACAAGTACTTTGGCACCGAGTACGGCTCCGAG
TGCTACTGCGGCAGCTACGTGGGCGAGACGAGCGCCGCGGCGCCCCTTGCCGAGTGCAACATGCCTTGCGGGGGC
GATGGCTACGCCTACTGCGGCGCCAGCAACCGCCTGGAGCTCTACATGAATGCAAACGCCACGGGCGGCCGGCCC
GAGCAGCCGCCTGCAGCAGGCGCCTTCCATCTCGTCGGCTGCCAGTCCGAGGGCACCGGCACGCGCGCCCTCGCC
GACAAGGTGACGGCCGCCGACGACATGACGAATGCAAAGTGCGCTGGCTTGTGTGCCGGCTACAAGTTTTTTGGC
ACCGAGTACGGGCGCGAGTGCTACTGCGGCAACGTGCTCGATGCGTCGAGCAAGGCGGCGCCTGCAAGCGAGTGT
CGCATGCTGTGCAGCGGCAGCGCGGCCGAATACTGTGGCGCGTCGAATCGCTTGTCCGTGTATACCAAGAGTCTG
CTGCCGCCGCCAGCTGGGCCTGTTGTCAAGAGGCGAGCAAGAGCGTCGGAGTAG
Transcript >OphauB2|3393
ATGGAGCTCTACTCAACAACCAGCGCGCCCGCCACGCCTACGCCCACGGCCACGCTCACGCACAAGGCCACCGTG
GCGCCCTACACCCTTGTTGGCTGCTGGGCCGAGGCCAAGGGCACGCGCGCGCTCGAGCAAAAGGCCACAACGAGC
GGCAGCATGAGCAACGAGGCGTGTGCCGCCTTTTGCGCCGGCTACAAGTACTTTGGCACCGAGTACGGCTCCGAG
TGCTACTGCGGCAGCTACGTGGGCGAGACGAGCGCCGCGGCGCCCCTTGCCGAGTGCAACATGCCTTGCGGGGGC
GATGGCTACGCCTACTGCGGCGCCAGCAACCGCCTGGAGCTCTACATGAATGCAAACGCCACGGGCGGCCGGCCC
GAGCAGCCGCCTGCAGCAGGCGCCTTCCATCTCGTCGGCTGCCAGTCCGAGGGCACCGGCACGCGCGCCCTCGCC
GACAAGGTGACGGCCGCCGACGACATGACGAATGCAAAGTGCGCTGGCTTGTGTGCCGGCTACAAGTTTTTTGGC
ACCGAGTACGGGCGCGAGTGCTACTGCGGCAACGTGCTCGATGCGTCGAGCAAGGCGGCGCCTGCAAGCGAGTGT
CGCATGCTGTGCAGCGGCAGCGCGGCCGAATACTGTGGCGCGTCGAATCGCTTGTCCGTGTATACCAAGAGTCTG
CTGCCGCCGCCAGCTGGGCCTGTTGTCAAGAGGCGAGCAAGAGCGTCGGAGTAG
Gene >OphauB2|3393
ATGGAGCTCTACTCAACAACCAGCGCGCCCGCCACGCCTACGCCCACGGCCACGCTCACGCACAAGGCCACCGTG
GCGCCCTACACCCTTGTTGGCTGCTGGGCCGAGGCCAAGGGCACGCGCGCGCTCGAGCAAAAGGCCACAACGAGC
GGCAGCATGAGCAACGAGGCGTGTGCCGCCTTTTGCGCCGGCTACAAGTACTTTGGCACCGAGTACGGCTCCGAG
TGCTACTGCGGCAGCTACGTGGGCGAGACGAGCGCCGCGGCGCCCCTTGCCGAGTGCAACATGCCTTGCGGGGGC
GATGGCTACGCCTACTGCGGCGCCAGCAACCGCCTGGAGCTCTACATGAATGCAAACGCCACGGGCGGCCGGCCC
GAGCAGCCGCCTGCAGCAGGCGCCTTCCATCTCGTCGGCTGCCAGTCCGAGGGCACCGGCACGCGCGCCCTCGCC
GACAAGGTGACGGCCGCCGACGACATGACGAATGCAAAGTGCGCTGGCTTGTGTGCCGGCTACAAGTTTTTTGGC
ACCGAGTACGGGCGCGAGTGCTACTGCGGCAACGTGCTCGATGCGTCGAGCAAGGCGGCGCCTGCAAGCGAGTGT
CGCATGCTGTGCAGCGGCAGCGCGGCCGAATACTGTGGCGCGTCGAATCGCTTGTCCGTGTATACCAAGAGTCTG
CTGCCGCCGCCAGCTGGGCCTGTTGTCAAGAGGCGAGCAAGAGCGTCGGAGTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail