Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|3392
Gene name
LocationContig_216:23306..25488
Strand+
Gene length (bp)2182
Transcript length (bp)1935
Coding sequence length (bp)1935
Protein length (aa) 645

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01375 Enterotoxin_a Heat-labile enterotoxin alpha chain 7.7E-12 36 174

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|A2PU44|CHELT_VIBCL NAD(+)--arginine ADP-ribosyltransferase Chelt OS=Vibrio cholerae GN=A51_B1772 PE=1 SV=1 37 189 6.0E-11
sp|P43528|E2BA_ECOLX Heat-labile enterotoxin IIB, A chain OS=Escherichia coli PE=1 SV=2 33 174 1.0E-07

GO

GO Term Description Terminal node
GO:0090729 toxin activity Yes
GO:0005615 extracellular space Yes
GO:0110165 cellular anatomical entity No
GO:0003674 molecular_function No
GO:0005575 cellular_component No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 26 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|3392
MCLTYTKAAALLWLMWLQLSGTSLGYQTSRRPAKIVYRGDYRPPQDVRNAGGFWPSGKYQDDALAFSIPRHMEGD
DVSIAAPNSTENWTTAFVSVSDNVTTAARHGHWIYTIRATPNMLDPNPDNAPETEIFALGGIQWTQVIGYQFLDT
ARQKRTKFLRSPDYRRDSFQGTAVTLLVPSGFYRDEGLQAAVELMNRSQVGSLVGWTGKFPLSFEPLAPRDKVPF
WGFPPKFHCPLPFLEPSHALNDVDMLAAADYLVQERPECSSDQQDVNEQQALSKMHDLLEVAVWGLPTTGFLRQI
IEAEEPIKRVFETMVQDDGICALVEACESIFDGNIEMRQYQRGFRKFCRKSKDIRACAHVKDVELGFELSDRYFA
GTYDRVGVTISGPKGKTAFEIGTGLSRGFKQWFPVNVRELGGEKTLSLTDGPLDMIFTATGHAFGSTNDAFLVEN
PLEVLLRGHCVGSGYGAEVKQFNNLLAWWQHDKSSTIAQRTKPQKVATLRVDASDWVTRPPCHLIDELHVHFSMS
QPHYAVEYVMPALTFGVGRRIVLAKNQQHGPALTPRIDLGRSFGASVVSLRDLDVVQVVEEAKNGTLHQSHWKLE
SLSFWGRCADSGKVVHMDKWNEVKEALGPSGMWSGRIDINDWHG*
Coding >OphauB2|3392
ATGTGCTTGACGTATACGAAAGCAGCTGCACTGCTCTGGCTCATGTGGCTACAGCTCAGCGGCACGAGCCTTGGA
TACCAAACCTCTAGACGGCCGGCTAAAATTGTTTACCGTGGCGATTACCGGCCCCCGCAAGATGTTAGAAACGCG
GGAGGCTTCTGGCCCTCGGGCAAGTATCAAGATGATGCGTTGGCATTCTCGATTCCTCGCCACATGGAGGGAGAT
GATGTCTCAATCGCGGCGCCCAATTCAACGGAAAATTGGACAACGGCCTTTGTATCCGTCTCGGACAATGTGACA
ACGGCAGCCAGACATGGGCATTGGATCTACACGATTCGTGCCACGCCAAACATGCTGGATCCCAACCCTGACAAT
GCCCCAGAGACTGAGATTTTTGCTCTGGGCGGCATTCAGTGGACTCAGGTGATTGGATATCAATTCTTGGACACT
GCTCGTCAAAAGCGCACAAAGTTTTTGCGCAGTCCCGACTATCGGCGAGACTCGTTTCAAGGCACTGCCGTCACG
CTGCTTGTGCCCTCGGGGTTTTACCGTGACGAGGGATTGCAGGCCGCTGTTGAACTCATGAATAGGTCTCAAGTC
GGAAGTTTGGTTGGATGGACGGGCAAATTCCCCCTCAGCTTTGAGCCCTTGGCGCCTAGAGACAAGGTTCCCTTT
TGGGGGTTTCCGCCAAAGTTTCACTGTCCCTTGCCTTTTCTAGAGCCGAGCCATGCGCTCAACGATGTTGATATG
CTAGCAGCTGCAGATTACTTGGTGCAGGAGCGTCCAGAGTGCAGTTCGGACCAACAGGATGTGAATGAACAGCAG
GCCTTGAGCAAGATGCACGACTTGTTGGAGGTGGCTGTCTGGGGCTTGCCCACTACTGGCTTTTTGCGGCAGATT
ATCGAGGCAGAAGAGCCCATTAAAAGGGTCTTTGAGACGATGGTGCAGGACGATGGCATTTGTGCACTAGTGGAA
GCTTGCGAATCCATATTCGACGGGAATATCGAAATGCGCCAATATCAGCGAGGCTTCCGCAAGTTTTGCCGCAAA
AGCAAGGATATTCGTGCCTGCGCTCACGTCAAGGATGTAGAGCTTGGCTTTGAGCTGTCGGATCGCTATTTTGCG
GGCACGTACGACCGCGTCGGCGTCACCATTAGCGGGCCCAAGGGCAAGACGGCCTTTGAGATTGGAACGGGTCTG
AGCAGAGGCTTCAAACAGTGGTTTCCTGTCAATGTCAGGGAGCTTGGTGGGGAAAAGACGCTGAGCTTGACTGAT
GGCCCCTTGGATATGATTTTTACAGCGACAGGACATGCTTTTGGATCCACCAATGACGCCTTTTTGGTCGAGAAC
CCTCTAGAGGTGCTTCTGCGCGGCCACTGCGTCGGCTCTGGCTACGGCGCCGAAGTGAAGCAATTCAACAACCTC
TTGGCGTGGTGGCAGCACGACAAGTCGTCCACCATTGCACAAAGGACCAAGCCGCAAAAGGTGGCGACGCTGAGG
GTCGACGCGTCGGACTGGGTGACGCGCCCGCCCTGCCACCTCATTGACGAGCTGCACGTGCACTTTTCCATGTCG
CAGCCGCACTACGCCGTCGAGTATGTCATGCCAGCGCTCACGTTTGGCGTGGGGCGGCGCATAGTGCTGGCCAAG
AATCAGCAGCACGGCCCAGCACTTACGCCGCGCATCGACTTGGGGCGGTCGTTTGGCGCGTCGGTTGTGAGCTTG
CGGGATCTTGACGTGGTGCAGGTGGTTGAAGAGGCCAAGAATGGCACATTGCATCAAAGCCACTGGAAGTTGGAG
AGCCTCTCCTTTTGGGGCAGATGCGCCGACTCGGGCAAAGTCGTACACATGGACAAGTGGAACGAGGTTAAAGAG
GCTCTTGGGCCTAGCGGCATGTGGTCTGGCCGCATCGACATCAATGACTGGCATGGCTAG
Transcript >OphauB2|3392
ATGTGCTTGACGTATACGAAAGCAGCTGCACTGCTCTGGCTCATGTGGCTACAGCTCAGCGGCACGAGCCTTGGA
TACCAAACCTCTAGACGGCCGGCTAAAATTGTTTACCGTGGCGATTACCGGCCCCCGCAAGATGTTAGAAACGCG
GGAGGCTTCTGGCCCTCGGGCAAGTATCAAGATGATGCGTTGGCATTCTCGATTCCTCGCCACATGGAGGGAGAT
GATGTCTCAATCGCGGCGCCCAATTCAACGGAAAATTGGACAACGGCCTTTGTATCCGTCTCGGACAATGTGACA
ACGGCAGCCAGACATGGGCATTGGATCTACACGATTCGTGCCACGCCAAACATGCTGGATCCCAACCCTGACAAT
GCCCCAGAGACTGAGATTTTTGCTCTGGGCGGCATTCAGTGGACTCAGGTGATTGGATATCAATTCTTGGACACT
GCTCGTCAAAAGCGCACAAAGTTTTTGCGCAGTCCCGACTATCGGCGAGACTCGTTTCAAGGCACTGCCGTCACG
CTGCTTGTGCCCTCGGGGTTTTACCGTGACGAGGGATTGCAGGCCGCTGTTGAACTCATGAATAGGTCTCAAGTC
GGAAGTTTGGTTGGATGGACGGGCAAATTCCCCCTCAGCTTTGAGCCCTTGGCGCCTAGAGACAAGGTTCCCTTT
TGGGGGTTTCCGCCAAAGTTTCACTGTCCCTTGCCTTTTCTAGAGCCGAGCCATGCGCTCAACGATGTTGATATG
CTAGCAGCTGCAGATTACTTGGTGCAGGAGCGTCCAGAGTGCAGTTCGGACCAACAGGATGTGAATGAACAGCAG
GCCTTGAGCAAGATGCACGACTTGTTGGAGGTGGCTGTCTGGGGCTTGCCCACTACTGGCTTTTTGCGGCAGATT
ATCGAGGCAGAAGAGCCCATTAAAAGGGTCTTTGAGACGATGGTGCAGGACGATGGCATTTGTGCACTAGTGGAA
GCTTGCGAATCCATATTCGACGGGAATATCGAAATGCGCCAATATCAGCGAGGCTTCCGCAAGTTTTGCCGCAAA
AGCAAGGATATTCGTGCCTGCGCTCACGTCAAGGATGTAGAGCTTGGCTTTGAGCTGTCGGATCGCTATTTTGCG
GGCACGTACGACCGCGTCGGCGTCACCATTAGCGGGCCCAAGGGCAAGACGGCCTTTGAGATTGGAACGGGTCTG
AGCAGAGGCTTCAAACAGTGGTTTCCTGTCAATGTCAGGGAGCTTGGTGGGGAAAAGACGCTGAGCTTGACTGAT
GGCCCCTTGGATATGATTTTTACAGCGACAGGACATGCTTTTGGATCCACCAATGACGCCTTTTTGGTCGAGAAC
CCTCTAGAGGTGCTTCTGCGCGGCCACTGCGTCGGCTCTGGCTACGGCGCCGAAGTGAAGCAATTCAACAACCTC
TTGGCGTGGTGGCAGCACGACAAGTCGTCCACCATTGCACAAAGGACCAAGCCGCAAAAGGTGGCGACGCTGAGG
GTCGACGCGTCGGACTGGGTGACGCGCCCGCCCTGCCACCTCATTGACGAGCTGCACGTGCACTTTTCCATGTCG
CAGCCGCACTACGCCGTCGAGTATGTCATGCCAGCGCTCACGTTTGGCGTGGGGCGGCGCATAGTGCTGGCCAAG
AATCAGCAGCACGGCCCAGCACTTACGCCGCGCATCGACTTGGGGCGGTCGTTTGGCGCGTCGGTTGTGAGCTTG
CGGGATCTTGACGTGGTGCAGGTGGTTGAAGAGGCCAAGAATGGCACATTGCATCAAAGCCACTGGAAGTTGGAG
AGCCTCTCCTTTTGGGGCAGATGCGCCGACTCGGGCAAAGTCGTACACATGGACAAGTGGAACGAGGTTAAAGAG
GCTCTTGGGCCTAGCGGCATGTGGTCTGGCCGCATCGACATCAATGACTGGCATGGCTAG
Gene >OphauB2|3392
ATGTGCTTGACGTATACGAAAGCAGCTGCACTGCTCTGGCTCATGTGGCTACAGCTCAGCGGCACGAGCCTTGGA
TACCAAACCTCTAGACGGCCGGCTAAAATTGTTTACCGTGGCGATTACCGGCCCCCGCAAGATGTTAGAAACGCG
GGAGGCTTCTGGCCCTCGGGCAAGTATCAAGATGATGCGTTGGCATTCTCGATTCCTCGCCACATGGAGGGAGAT
GATGTCTCAATCGCGGCGCCCAATTCAACGGAAAATTGGACAACGGCCTTTGTATCCGTCTCGGACAATGTGACA
ACGGCAGCCAGACATGGGCATTGGATCTACACGATTCGTGCCACGCCAAACATGCTGGATCCCAACCCTGACAAT
GCCCCAGAGACTGAGATTTTTGCTCTGGGCGGCATTCAGTGGACTCAGGTGATTGGATATCAATTCTTGGACACT
GCTCGTCAAAAGCGCACAAAGTTTTTGCGCAGTCCCGACTATCGGCGAGACTCGTTTCAAGGCACTGCCGTCACG
CTGCTTGTGCCCTCGGGGTTTTACCGTGACGAGGGATTGCAGGCCGCTGTTGAACTCATGAATAGGTCTCAAGTC
GGAAGTTTGGTTGGATGGACGGGCAAATTCCCCCTCAGCTTTGAGCCCTTGGCGCCTAGAGACAAGGTTCCCTTT
TGGGGGTTTCCGCCAAAGTTTCACTGTCCCTTGCCTTTTCTAGAGCCGAGCCATGCGCTCAACGATGTTGATATG
CTAGCAGCTGCAGATTACTTGGTGCAGGAGCGTCCAGAGTGCAGTTCGGACCAACAGGATGTGAATGAACAGCAG
GCCTTGAGCAAGATGCACGACTTGTTGGAGGTGGCTGTCTGGGGCTTGCCCACTACTGGCTTTTTGCGGCAGATT
ATCGAGGCAGAAGAGCCCATTAAAAGGGTCTTTGAGACGATGGTGCAGGACGATGGCATTTGTGCACTAGTGGAA
GCTTGCGAATCCATATTCGACGGGAATATCGAAATGCGTGCGTCTCCAAGACACGATTGCAAGCCAAGGTTTCCA
AGAGCTGATGCAGACTGGCAGGCCAATATCAGCGAGGCTTCCGCAAGTTTTGCCGCAAAAGCAAGGATATTCGTG
CCTGCGCTCACGTCAAGGATGTAGAGCTTGGCTTTGAGCTGTCGGATCGCTATTTTGCGGGCACGTACGACCGCG
TCGGCGTCACCATTAGCGGGCCCAAGGGCAAGACGGCCTTTGAGATTGGAACGGGTCTGAGCAGAGGCTTCAAAC
AGTGGTTTCCTGTCAATGTCAGGGAGCTTGGTGGGGAAAAGACGCTGAGCTTGACTGATGGCCCCTTGGATATGA
TTTTTACAGCGACAGGACATGCTTTTGGATCCACCAATGACGCCTTTTTGGTCGAGAGTGAGTCGCTTGTCCAGC
TTCCCTCTTCTTCCCCCTCTCCGCTTTCTCTTCTTCTTTTTCCTCTTGTCCTCCTCCTCCTTCCTCTCCTCCCTC
TTGGCTCGGGCAGGCTTTGCTAAGCACAAAGACCCTCTAGAGGTGCTTCTGCGCGGCCACTGCGTCGGCTCTGGC
TACGGCGCCGAAGTGAAGCAATTCAACAACCTCTTGGCGTGGTGGCAGCACGACAAGTCGTCCACCATTGCACAA
AGGACCAAGCCGCAAAAGGTGGCGACGCTGAGGGTCGACGCGTCGGACTGGGTGACGCGCCCGCCCTGCCACCTC
ATTGACGAGCTGCACGTGCACTTTTCCATGTCGCAGCCGCACTACGCCGTCGAGTATGTCATGCCAGCGCTCACG
TTTGGCGTGGGGCGGCGCATAGTGCTGGCCAAGAATCAGCAGCACGGCCCAGCACTTACGCCGCGCATCGACTTG
GGGCGGTCGTTTGGCGCGTCGGTTGTGAGCTTGCGGGATCTTGACGTGGTGCAGGTGGTTGAAGAGGCCAAGAAT
GGCACATTGCATCAAAGCCACTGGAAGTTGGAGAGTGAGTCTTTGTCTCTGTCTCGTCTTGGTCTTGGCCCTGCA
TCTTGCCGACTGACGTGTCCTAGGCCTCTCCTTTTGGGGCAGATGCGCCGACTCGGGCAAAGTCGTACACATGGA
CAAGTGGAACGAGGTTAAAGAGGCTCTTGGGCCTAGCGGCATGTGGTCTGGCCGCATCGACATCAATGACTGGCA
TGGCTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail