Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|3386
Gene name
LocationContig_216:7692..9426
Strand+
Gene length (bp)1734
Transcript length (bp)1545
Coding sequence length (bp)1545
Protein length (aa) 515

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF04042 DNA_pol_E_B DNA polymerase alpha/epsilon subunit B 2.2E-47 230 461
PF18018 DNA_pol_D_N DNA polymerase delta subunit OB-fold domain 2.9E-37 47 184

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P46957|DPOD2_YEAST DNA polymerase delta small subunit OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=POL31 PE=1 SV=1 40 504 2.0E-80
sp|Q9LRE5|DPOD2_ORYSJ DNA polymerase delta small subunit OS=Oryza sativa subsp. japonica GN=POLD2 PE=2 SV=1 40 502 8.0E-75
sp|P87324|DPOD2_SCHPO DNA polymerase subunit delta-2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cdc1 PE=1 SV=1 44 497 3.0E-73
sp|O48520|DPOD2_ARATH DNA polymerase delta small subunit OS=Arabidopsis thaliana GN=POLD2 PE=2 SV=2 25 506 2.0E-72
sp|O35654|DPOD2_MOUSE DNA polymerase delta subunit 2 OS=Mus musculus GN=Pold2 PE=1 SV=2 42 495 1.0E-64
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P46957|DPOD2_YEAST DNA polymerase delta small subunit OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=POL31 PE=1 SV=1 40 504 2.0E-80
sp|Q9LRE5|DPOD2_ORYSJ DNA polymerase delta small subunit OS=Oryza sativa subsp. japonica GN=POLD2 PE=2 SV=1 40 502 8.0E-75
sp|P87324|DPOD2_SCHPO DNA polymerase subunit delta-2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cdc1 PE=1 SV=1 44 497 3.0E-73
sp|O48520|DPOD2_ARATH DNA polymerase delta small subunit OS=Arabidopsis thaliana GN=POLD2 PE=2 SV=2 25 506 2.0E-72
sp|O35654|DPOD2_MOUSE DNA polymerase delta subunit 2 OS=Mus musculus GN=Pold2 PE=1 SV=2 42 495 1.0E-64
sp|P49005|DPOD2_HUMAN DNA polymerase delta subunit 2 OS=Homo sapiens GN=POLD2 PE=1 SV=1 42 495 3.0E-64
sp|P49004|DPOD2_BOVIN DNA polymerase delta subunit 2 OS=Bos taurus GN=POLD2 PE=1 SV=2 42 495 2.0E-63
sp|Q6AXY4|DPOD2_RAT DNA polymerase delta subunit 2 OS=Rattus norvegicus GN=Pold2 PE=1 SV=1 42 495 3.0E-63
sp|Q9W088|DPOD2_DROME DNA polymerase delta small subunit OS=Drosophila melanogaster GN=CG12018 PE=2 SV=1 25 505 4.0E-60
sp|O93610|DPOD2_XENLA DNA polymerase delta subunit 2 OS=Xenopus laevis GN=pold2 PE=2 SV=1 256 497 1.0E-46
sp|Q19366|DPOD2_CAEEL Probable DNA polymerase delta small subunit OS=Caenorhabditis elegans GN=F12F6.7 PE=3 SV=1 39 495 2.0E-28
sp|O93610|DPOD2_XENLA DNA polymerase delta subunit 2 OS=Xenopus laevis GN=pold2 PE=2 SV=1 42 193 6.0E-14
[Show less]

GO

GO Term Description Terminal node
GO:0006260 DNA replication Yes
GO:0003677 DNA binding Yes
GO:1901363 heterocyclic compound binding No
GO:0043170 macromolecule metabolic process No
GO:0006725 cellular aromatic compound metabolic process No
GO:0008150 biological_process No
GO:0005488 binding No
GO:0003674 molecular_function No
GO:0034641 cellular nitrogen compound metabolic process No
GO:0006807 nitrogen compound metabolic process No
GO:1901360 organic cyclic compound metabolic process No
GO:0090304 nucleic acid metabolic process No
GO:0097159 organic cyclic compound binding No
GO:0006139 nucleobase-containing compound metabolic process No
GO:0044260 cellular macromolecule metabolic process No
GO:0071704 organic substance metabolic process No
GO:0006259 DNA metabolic process No
GO:0044237 cellular metabolic process No
GO:0008152 metabolic process No
GO:0009987 cellular process No
GO:0044238 primary metabolic process No
GO:0003676 nucleic acid binding No
GO:0046483 heterocycle metabolic process No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup3413
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|3270
Ophiocordyceps australis map64 (Brazil) OphauB2|3386 (this protein)
Ophiocordyceps camponoti-floridani Ophcf2|04895
Ophiocordyceps camponoti-rufipedis Ophun1|5208
Ophiocordyceps kimflemingae Ophio5|2528
Ophiocordyceps subramaniannii Hirsu2|6411

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|3386
MAQLRELAQSLLEDSGGPPKQPLCRESSCYKPLHTFDLDQGRPYQQQYGDMYFLRLVKLKSVVDEVAAAAWEGTI
IGDEEAKKVDRVLNVRQGDLCWVVGTVYMEMALKPNVLEDVINDRWVTAPLTTQRYYNDDELDQIMLEDDSGRLR
LVGQMLSMVPMVTGCIVAVLGTENSAGEFEVLDLKLPEMAPQPGRWALTNPSLADAKGKAKAEDEDEEMTDASQK
PGNKIAIVSGLNFVANDASHALELNLLLEFLVGEALESPMQDEVAHISRLIIAGNSISTVTDQKPEKRAPEKKIH
KKYGYDSSTFNPLPSKLFDEFITELLPSMPITLLPGSQDPANAIYPQQPIHMAMFYDARQYGADEAKSPSLPGWF
DTVTNPFEAEIDGWRILGTGGQNIDDVFKYIDSDDRLGMMDAMCRWRCCAPTAPDTLWSYPFQEDEPFVMQACPH
VYFVGCQPEFSTRRIYGSQGQTVRLITVPSFSETKEIVLLDTETLEATRLKIGVDVPRPEEAEM*
Coding >OphauB2|3386
ATGGCTCAGCTTCGCGAATTGGCCCAAAGCCTCTTAGAAGACTCAGGTGGTCCTCCGAAGCAGCCTCTTTGTCGA
GAATCGTCATGCTACAAGCCTCTACATACTTTTGACCTCGACCAGGGGCGTCCCTACCAGCAGCAGTATGGCGAC
ATGTACTTTCTGCGTCTTGTCAAACTAAAATCTGTTGTCGATGAGGTAGCCGCTGCAGCCTGGGAGGGAACCATT
ATCGGTGACGAAGAGGCCAAAAAGGTCGATCGGGTCCTCAATGTGCGCCAGGGCGACTTGTGCTGGGTTGTAGGA
ACAGTATACATGGAGATGGCCCTCAAGCCCAATGTCCTCGAAGACGTGATCAACGACCGCTGGGTAACGGCTCCC
TTGACTACTCAACGATACTACAACGACGACGAGCTGGACCAAATCATGCTTGAAGACGACTCGGGCCGGCTTCGC
TTGGTTGGCCAGATGCTCAGCATGGTTCCCATGGTGACGGGCTGCATCGTTGCCGTCTTGGGCACGGAGAATAGC
GCTGGCGAGTTTGAGGTGCTCGATCTCAAGCTCCCCGAGATGGCCCCCCAGCCTGGACGCTGGGCTCTCACCAAT
CCCAGCCTGGCTGATGCCAAGGGAAAGGCTAAGGCTGAAGACGAAGACGAGGAGATGACTGACGCTTCGCAAAAG
CCAGGCAACAAGATTGCCATTGTTTCCGGTCTCAATTTTGTCGCCAACGATGCCTCCCATGCGCTGGAGCTGAAT
TTATTGCTCGAGTTCTTAGTGGGAGAAGCGCTTGAGTCGCCGATGCAGGACGAGGTGGCACACATCAGCCGCCTC
ATCATAGCCGGCAACTCGATTTCGACCGTTACTGATCAGAAGCCGGAAAAGCGCGCGCCAGAAAAAAAGATACAT
AAAAAGTACGGATATGACTCGAGCACGTTTAATCCTCTGCCGTCAAAGCTGTTTGATGAATTCATCACCGAGCTG
CTGCCCTCGATGCCCATTACCCTGCTGCCCGGCTCGCAGGACCCTGCCAATGCAATCTATCCGCAACAGCCCATC
CACATGGCCATGTTTTATGATGCAAGGCAATATGGCGCAGATGAAGCCAAGTCGCCGTCGCTGCCTGGCTGGTTT
GATACGGTGACGAATCCCTTTGAGGCAGAAATCGATGGCTGGAGAATACTAGGCACAGGGGGGCAGAATATAGAC
GATGTCTTCAAGTACATTGACAGCGACGACCGGCTGGGCATGATGGATGCCATGTGCCGATGGAGATGCTGTGCT
CCCACGGCGCCGGATACGCTATGGAGCTACCCTTTTCAGGAGGATGAGCCTTTTGTCATGCAGGCTTGTCCGCAT
GTCTACTTTGTCGGATGCCAGCCCGAGTTTTCCACGAGAAGAATCTACGGGTCTCAAGGGCAAACGGTGCGCCTC
ATTACCGTGCCGTCCTTTTCAGAGACCAAGGAGATTGTGCTCTTGGACACGGAGACGCTCGAGGCTACCAGGCTC
AAGATTGGGGTCGACGTGCCCAGACCCGAGGAAGCTGAGATGTAG
Transcript >OphauB2|3386
ATGGCTCAGCTTCGCGAATTGGCCCAAAGCCTCTTAGAAGACTCAGGTGGTCCTCCGAAGCAGCCTCTTTGTCGA
GAATCGTCATGCTACAAGCCTCTACATACTTTTGACCTCGACCAGGGGCGTCCCTACCAGCAGCAGTATGGCGAC
ATGTACTTTCTGCGTCTTGTCAAACTAAAATCTGTTGTCGATGAGGTAGCCGCTGCAGCCTGGGAGGGAACCATT
ATCGGTGACGAAGAGGCCAAAAAGGTCGATCGGGTCCTCAATGTGCGCCAGGGCGACTTGTGCTGGGTTGTAGGA
ACAGTATACATGGAGATGGCCCTCAAGCCCAATGTCCTCGAAGACGTGATCAACGACCGCTGGGTAACGGCTCCC
TTGACTACTCAACGATACTACAACGACGACGAGCTGGACCAAATCATGCTTGAAGACGACTCGGGCCGGCTTCGC
TTGGTTGGCCAGATGCTCAGCATGGTTCCCATGGTGACGGGCTGCATCGTTGCCGTCTTGGGCACGGAGAATAGC
GCTGGCGAGTTTGAGGTGCTCGATCTCAAGCTCCCCGAGATGGCCCCCCAGCCTGGACGCTGGGCTCTCACCAAT
CCCAGCCTGGCTGATGCCAAGGGAAAGGCTAAGGCTGAAGACGAAGACGAGGAGATGACTGACGCTTCGCAAAAG
CCAGGCAACAAGATTGCCATTGTTTCCGGTCTCAATTTTGTCGCCAACGATGCCTCCCATGCGCTGGAGCTGAAT
TTATTGCTCGAGTTCTTAGTGGGAGAAGCGCTTGAGTCGCCGATGCAGGACGAGGTGGCACACATCAGCCGCCTC
ATCATAGCCGGCAACTCGATTTCGACCGTTACTGATCAGAAGCCGGAAAAGCGCGCGCCAGAAAAAAAGATACAT
AAAAAGTACGGATATGACTCGAGCACGTTTAATCCTCTGCCGTCAAAGCTGTTTGATGAATTCATCACCGAGCTG
CTGCCCTCGATGCCCATTACCCTGCTGCCCGGCTCGCAGGACCCTGCCAATGCAATCTATCCGCAACAGCCCATC
CACATGGCCATGTTTTATGATGCAAGGCAATATGGCGCAGATGAAGCCAAGTCGCCGTCGCTGCCTGGCTGGTTT
GATACGGTGACGAATCCCTTTGAGGCAGAAATCGATGGCTGGAGAATACTAGGCACAGGGGGGCAGAATATAGAC
GATGTCTTCAAGTACATTGACAGCGACGACCGGCTGGGCATGATGGATGCCATGTGCCGATGGAGATGCTGTGCT
CCCACGGCGCCGGATACGCTATGGAGCTACCCTTTTCAGGAGGATGAGCCTTTTGTCATGCAGGCTTGTCCGCAT
GTCTACTTTGTCGGATGCCAGCCCGAGTTTTCCACGAGAAGAATCTACGGGTCTCAAGGGCAAACGGTGCGCCTC
ATTACCGTGCCGTCCTTTTCAGAGACCAAGGAGATTGTGCTCTTGGACACGGAGACGCTCGAGGCTACCAGGCTC
AAGATTGGGGTCGACGTGCCCAGACCCGAGGAAGCTGAGATGTAG
Gene >OphauB2|3386
ATGGCTCAGCTTCGCGAATTGGCCCAAAGCCTCTTAGAAGACTCAGGGTAAGTACCGCGTCTTGACTTCAATCTT
GCTTGGTCCTTGGCCCCCATCGCTAATTGCAGCCAGCAGTGGTCCTCCGAAGCAGCCTCTTTGTCGAGAATCGTC
ATGCTACAAGCCTCTACATACTTTTGACCTCGACCAGGGGCGTCCCTACCAGCAGCAGTATGGCGACATGTACTT
TCTGCGTCTTGTCAAACTAAAATCTGTTGTCGATGAGGTAGCCGCTGCAGCCTGGGAGGGAACCATTATCGGTGA
CGAAGAGGCCAAAAAGGTCGATCGGGTCCTCAATGTGCGCCAGGGCGACTTGTGCTGGGTTGTAGGAACAGTATA
CATGGAGATGGCCCTCAAGCCCAATGTCCTCGAAGACGTGATCAACGACGTGAGATGGTCTATTCTCCAGCCATC
CTTGCTGGACACGCTTGAGGACCTGCTGACATGGCGACTAGCGCTGGGTAACGGCTCCCTTGACTACTCAACGAT
ACTACAACGACGACGAGCTGGACCAAATCATGCTTGAAGACGACTCGGGCCGGCTTCGCTTGGTTGGCCAGATGC
TCAGCATGGTTCCCATGGTGACGGGCTGCATCGTTGCCGTCTTGGGCACGGAGAATAGCGCTGGCGAGTTTGAGG
TGCTCGATCTCAAGCTCCCCGAGATGGCCCCCCAGCCTGGACGCTGGGCTCTCACCAATCCCAGCCTGGCTGATG
CCAAGGGAAAGGCTAAGGCTGAAGACGAAGACGAGGAGATGACTGACGCTTCGCAAAAGCCAGGCAACAAGATTG
CCATTGTTTCCGGTCTCAATTTTGTCGCCAACGATGCCTCCCATGCGCTGGAGCTGAATTTATTGCTCGAGTTCT
TAGTGGGAGAAGCGCTTGAGTCGCCGATGCAGGACGAGGTGGCACACATCAGCCGCCTCATCATAGCCGGCAACT
CGATTTCGACCGTTACTGATCAGAAGCCGGAAAAGCGCGCGCCAGAAAAAAAGATACATAAAAAGTACGGATATG
ACTCGAGCACGTTTAATCCTCTGCCGTCAAAGCTGTTTGATGAATTCATCACCGAGCTGCTGCCCTCGATGCCCA
TTACCCTGCTGCCCGGCTCGCAGGACCCTGCCAATGCAATCTATCCGCAACAGCCCATCCACATGGCCATGTTTT
ATGATGCAAGGCAATATGGCGCAGATGAAGCCAAGTCGCCGTCGCTGCCTGGCTGGTTTGATACGGTGACGAATC
CCTTTGAGGCAGAAATCGATGGCTGGAGAATACTAGGCACAGGGGGGCAGAATATAGACGATGTCTTCAAGTACA
TTGACAGCGACGACCGGCTGGGCATGATGGATGCCATGTGCCGATGGAGATGCTGTGCTCCCACGGCGCCGGATA
CGCTATGTAAGCTGCTTTCACATGCTAGATCAAGGTCCTCGGTGCTGATGCCTCTTGTCAGGGAGCTACCCTTTT
CAGGAGGATGAGCCTTTTGTCATGCAGGCTTGTCCGCATGTCTACTTTGTCGGATGCCAGCCCGAGTTTTCCACG
AGAAGAATCTACGGGTCTCAAGGGCAAACGGTGCGCCTCATTACCGTGCCGTCCTTTTCAGAGACCAAGGAGATT
GTGCTCTTGGACACGGAGACGCTCGAGGCTACCAGGCTCAAGATTGGGGTCGACGTGCCCAGACCCGAGGAAGCT
GAGATGTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail