Ophiocordyceps australis map64 (Brazil)

General Properties

Protein ID	OphauB2\|3385
Gene name
Location	Contig_216:6345..7206
Strand	-
Gene length (bp)	861
Transcript length (bp)	861
Coding sequence length (bp)	861
Protein length (aa)	287

PFAM Domains

PFAM Domain ID	Short name	Long name	E-value	Start	End
PF00005	ABC_tran	ABC transporter	4.3E-15	26	161

Swissprot hits

[Show all]

Swissprot ID	Swissprot Description	Start	End	E-value
sp\|Q7Z991\|YE31_SCHPO	Uncharacterized ABC transporter ATP-binding protein C20G4.01 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC20G4.01 PE=3 SV=2	8	257	9.0E-87
sp\|P43569\|CAF16_YEAST	CCR4-associated factor 16 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CAF16 PE=1 SV=1	9	212	7.0E-67
sp\|Q9LZ98\|AB20I_ARATH	ABC transporter I family member 20 OS=Arabidopsis thaliana GN=ABCI20 PE=2 SV=1	9	213	6.0E-50
sp\|Q9XF19\|AB21I_ARATH	ABC transporter I family member 21 OS=Arabidopsis thaliana GN=ABCI21 PE=2 SV=1	9	213	6.0E-48
sp\|Q3EDJ0\|AB19I_ARATH	ABC transporter I family member 19 OS=Arabidopsis thaliana GN=ABCI19 PE=2 SV=1	9	212	2.0E-46

[Show all]

[Show less]

Swissprot ID	Swissprot Description	Start	End	E-value
sp\|Q7Z991\|YE31_SCHPO	Uncharacterized ABC transporter ATP-binding protein C20G4.01 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC20G4.01 PE=3 SV=2	8	257	9.0E-87
sp\|P43569\|CAF16_YEAST	CCR4-associated factor 16 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CAF16 PE=1 SV=1	9	212	7.0E-67
sp\|Q9LZ98\|AB20I_ARATH	ABC transporter I family member 20 OS=Arabidopsis thaliana GN=ABCI20 PE=2 SV=1	9	213	6.0E-50
sp\|Q9XF19\|AB21I_ARATH	ABC transporter I family member 21 OS=Arabidopsis thaliana GN=ABCI21 PE=2 SV=1	9	213	6.0E-48
sp\|Q3EDJ0\|AB19I_ARATH	ABC transporter I family member 19 OS=Arabidopsis thaliana GN=ABCI19 PE=2 SV=1	9	212	2.0E-46
sp\|Q8DIA0\|CYSA_THEEB	Sulfate/thiosulfate import ATP-binding protein CysA OS=Thermosynechococcus elongatus (strain BP-1) GN=cysA PE=3 SV=1	9	214	2.0E-16
sp\|P74548\|CYSA_SYNY3	Sulfate/thiosulfate import ATP-binding protein CysA OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=cysA PE=3 SV=1	8	221	3.0E-16
sp\|P46903\|NATA_BACSU	ABC transporter ATP-binding protein NatA OS=Bacillus subtilis (strain 168) GN=natA PE=1 SV=1	9	212	3.0E-15
sp\|Q97JB8\|Y1368_CLOAB	Putative ABC transporter ATP-binding protein CA_C1368 OS=Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / LMG 5710 / VKM B-1787) GN=CA_C1368 PE=3 SV=1	9	195	4.0E-15
sp\|Q01937\|LACK_RHIRD	Lactose transport ATP-binding protein LacK OS=Rhizobium radiobacter GN=lacK PE=3 SV=1	25	224	4.0E-15
sp\|Q3KCC5\|FBPC_PSEPF	Fe(3+) ions import ATP-binding protein FbpC OS=Pseudomonas fluorescens (strain Pf0-1) GN=fbpC PE=3 SV=1	11	192	7.0E-15
sp\|Q8Z0H0\|CYSA_NOSS1	Sulfate/thiosulfate import ATP-binding protein CysA OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=cysA PE=3 SV=1	9	214	1.0E-14
sp\|Q2YAD6\|POTA_NITMU	Spermidine/putrescine import ATP-binding protein PotA OS=Nitrosospira multiformis (strain ATCC 25196 / NCIMB 11849) GN=potA PE=3 SV=1	11	224	5.0E-14
sp\|Q6GEL3\|ECFA1_STAAR	Energy-coupling factor transporter ATP-binding protein EcfA1 OS=Staphylococcus aureus (strain MRSA252) GN=ecfA1 PE=3 SV=1	9	212	1.0E-13
sp\|Q7A470\|ECFA1_STAAN	Energy-coupling factor transporter ATP-binding protein EcfA1 OS=Staphylococcus aureus (strain N315) GN=ecfA1 PE=3 SV=1	9	212	1.0E-13
sp\|Q99S47\|ECFA1_STAAM	Energy-coupling factor transporter ATP-binding protein EcfA1 OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=ecfA1 PE=3 SV=1	9	212	1.0E-13
sp\|Q2YYM4\|ECFA1_STAAB	Energy-coupling factor transporter ATP-binding protein EcfA1 OS=Staphylococcus aureus (strain bovine RF122 / ET3-1) GN=ecfA1 PE=3 SV=2	9	212	1.0E-13
sp\|Q9HY19\|POTA2_PSEAE	Spermidine/putrescine import ATP-binding protein PotA 2 OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=potA2 PE=3 SV=1	5	223	1.0E-13
sp\|Q5HDY6\|ECFA1_STAAC	Energy-coupling factor transporter ATP-binding protein EcfA1 OS=Staphylococcus aureus (strain COL) GN=ecfA1 PE=3 SV=1	9	212	1.0E-13
sp\|Q2FW34\|ECFA1_STAA8	Energy-coupling factor transporter ATP-binding protein EcfA1 OS=Staphylococcus aureus (strain NCTC 8325) GN=ecfA1 PE=3 SV=1	9	212	1.0E-13
sp\|Q2FER7\|ECFA1_STAA3	Energy-coupling factor transporter ATP-binding protein EcfA1 OS=Staphylococcus aureus (strain USA300) GN=ecfA1 PE=3 SV=1	9	212	1.0E-13
sp\|Q02R79\|POTA_PSEAB	Spermidine/putrescine import ATP-binding protein PotA OS=Pseudomonas aeruginosa (strain UCBPP-PA14) GN=potA PE=3 SV=1	5	223	2.0E-13
sp\|Q8T674\|ABCGK_DICDI	ABC transporter G family member 20 OS=Dictyostelium discoideum GN=abcG20 PE=3 SV=1	25	199	2.0E-13
sp\|Q4KC87\|FBPC_PSEF5	Fe(3+) ions import ATP-binding protein FbpC OS=Pseudomonas fluorescens (strain Pf-5 / ATCC BAA-477) GN=fbpC PE=3 SV=1	25	251	6.0E-13
sp\|P14788\|CYSA_SYNE7	Sulfate/thiosulfate import ATP-binding protein CysA OS=Synechococcus elongatus (strain PCC 7942) GN=cysA PE=2 SV=1	9	214	7.0E-13
sp\|Q7NQN5\|POTA_CHRVO	Spermidine/putrescine import ATP-binding protein PotA OS=Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / NBRC 12614 / NCIMB 9131 / NCTC 9757) GN=potA PE=3 SV=1	11	223	7.0E-13
sp\|Q6HG98\|Y3105_BACHK	Putative ABC transporter ATP-binding protein BT9727_3105 OS=Bacillus thuringiensis subsp. konkukian (strain 97-27) GN=BT9727_3105 PE=3 SV=1	11	212	7.0E-13
sp\|Q7NIW1\|CYSA_GLOVI	Sulfate/thiosulfate import ATP-binding protein CysA OS=Gloeobacter violaceus (strain PCC 7421) GN=cysA PE=3 SV=1	8	214	8.0E-13
sp\|Q73KT5\|Y2132_TREDE	Putative ABC transporter ATP-binding protein TDE_2132 OS=Treponema denticola (strain ATCC 35405 / CIP 103919 / DSM 14222) GN=TDE_2132 PE=3 SV=1	9	210	9.0E-13
sp\|P56344\|CYSA_CHLVU	Probable sulfate/thiosulfate import ATP-binding protein CysA OS=Chlorella vulgaris GN=cysA PE=3 SV=1	8	221	1.0E-12
sp\|Q8NVB5\|ECFA1_STAAW	Energy-coupling factor transporter ATP-binding protein EcfA1 OS=Staphylococcus aureus (strain MW2) GN=ecfA1 PE=3 SV=1	9	212	1.0E-12
sp\|Q6G799\|ECFA1_STAAS	Energy-coupling factor transporter ATP-binding protein EcfA1 OS=Staphylococcus aureus (strain MSSA476) GN=ecfA1 PE=3 SV=1	9	212	1.0E-12
sp\|Q3KBH4\|POTA_PSEPF	Spermidine/putrescine import ATP-binding protein PotA OS=Pseudomonas fluorescens (strain Pf0-1) GN=potA PE=3 SV=1	5	192	3.0E-12
sp\|Q5XCA4\|POTA_STRP6	Spermidine/putrescine import ATP-binding protein PotA OS=Streptococcus pyogenes serotype M6 (strain ATCC BAA-946 / MGAS10394) GN=potA PE=3 SV=1	5	192	3.0E-12
sp\|Q99758\|ABCA3_HUMAN	ATP-binding cassette sub-family A member 3 OS=Homo sapiens GN=ABCA3 PE=1 SV=2	24	196	3.0E-12
sp\|P0CZ35\|POTA_STRPQ	Spermidine/putrescine import ATP-binding protein PotA OS=Streptococcus pyogenes serotype M3 (strain SSI-1) GN=potA PE=3 SV=1	5	192	3.0E-12
sp\|Q48TP4\|POTA_STRPM	Spermidine/putrescine import ATP-binding protein PotA OS=Streptococcus pyogenes serotype M28 (strain MGAS6180) GN=potA PE=3 SV=1	5	192	3.0E-12
sp\|P0CZ34\|POTA_STRP3	Spermidine/putrescine import ATP-binding protein PotA OS=Streptococcus pyogenes serotype M3 (strain ATCC BAA-595 / MGAS315) GN=potA PE=3 SV=1	5	192	3.0E-12
sp\|Q1J6Q6\|POTA_STRPF	Spermidine/putrescine import ATP-binding protein PotA OS=Streptococcus pyogenes serotype M4 (strain MGAS10750) GN=potA PE=3 SV=1	5	192	3.0E-12
sp\|Q1JGY7\|POTA_STRPD	Spermidine/putrescine import ATP-binding protein PotA OS=Streptococcus pyogenes serotype M2 (strain MGAS10270) GN=potA PE=3 SV=1	5	192	3.0E-12
sp\|Q1JLT7\|POTA_STRPC	Spermidine/putrescine import ATP-binding protein PotA OS=Streptococcus pyogenes serotype M12 (strain MGAS9429) GN=potA PE=3 SV=1	5	192	3.0E-12
sp\|Q1JBV6\|POTA_STRPB	Spermidine/putrescine import ATP-binding protein PotA OS=Streptococcus pyogenes serotype M12 (strain MGAS2096) GN=potA PE=3 SV=1	5	192	3.0E-12
sp\|Q7CN92\|POTA_STRP8	Spermidine/putrescine import ATP-binding protein PotA OS=Streptococcus pyogenes serotype M18 (strain MGAS8232) GN=potA PE=3 SV=1	5	192	4.0E-12
sp\|Q99ZS8\|POTA_STRP1	Spermidine/putrescine import ATP-binding protein PotA OS=Streptococcus pyogenes serotype M1 GN=potA PE=3 SV=1	5	192	4.0E-12
sp\|O28437\|Y1841_ARCFU	Putative ABC transporter ATP-binding protein AF_1841 OS=Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126) GN=AF_1841 PE=3 SV=1	9	209	4.0E-12
sp\|Q82HA2\|Y3608_STRAW	Putative ABC transporter ATP-binding protein SAV_3608 OS=Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680) GN=SAV_3608 PE=3 SV=1	1	194	4.0E-12
sp\|P45127\|ETTA_HAEIN	Energy-dependent translational throttle protein EttA OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=ettA PE=1 SV=1	9	166	5.0E-12
sp\|Q9I6L0\|CYSA_PSEAE	Sulfate/thiosulfate import ATP-binding protein CysA OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=cysA PE=3 SV=1	8	214	6.0E-12
sp\|Q9MUN1\|CYSA_MESVI	Sulfate/thiosulfate import ATP-binding protein CysA OS=Mesostigma viride GN=cysA PE=3 SV=1	9	192	6.0E-12
sp\|Q81N53\|Y3364_BACAN	Putative ABC transporter ATP-binding protein BA_3364/GBAA_3364/BAS3118 OS=Bacillus anthracis GN=BA_3364 PE=3 SV=1	11	212	7.0E-12
sp\|Q64SQ6\|POTA_BACFR	Spermidine/putrescine import ATP-binding protein PotA OS=Bacteroides fragilis (strain YCH46) GN=potA PE=3 SV=2	9	214	7.0E-12
sp\|Q13ER6\|UGPC_RHOPS	sn-glycerol-3-phosphate import ATP-binding protein UgpC OS=Rhodopseudomonas palustris (strain BisB5) GN=ugpC PE=3 SV=1	8	214	8.0E-12
sp\|Q5LBT4\|POTA_BACFN	Spermidine/putrescine import ATP-binding protein PotA OS=Bacteroides fragilis (strain ATCC 25285 / DSM 2151 / JCM 11019 / NCTC 9343) GN=potA PE=3 SV=1	9	214	8.0E-12
sp\|Q8RHL0\|ECFA1_FUSNN	Energy-coupling factor transporter ATP-binding protein EcfA1 OS=Fusobacterium nucleatum subsp. nucleatum (strain ATCC 25586 / CIP 101130 / JCM 8532 / LMG 13131) GN=ecfA1 PE=3 SV=1	9	192	8.0E-12
sp\|A1B9H9\|SSUB1_PARDP	Aliphatic sulfonates import ATP-binding protein SsuB 1 OS=Paracoccus denitrificans (strain Pd 1222) GN=ssuB1 PE=3 SV=1	7	214	8.0E-12
sp\|Q8A883\|POTA_BACTN	Spermidine/putrescine import ATP-binding protein PotA OS=Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / NCTC 10582 / E50 / VPI-5482) GN=potA PE=3 SV=1	9	214	9.0E-12
sp\|Q9K876\|CYSA_BACHD	Sulfate/thiosulfate import ATP-binding protein CysA OS=Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125) GN=cysA PE=3 SV=1	8	221	9.0E-12
sp\|Q21UI2\|MODC_RHOFT	Molybdenum import ATP-binding protein ModC OS=Rhodoferax ferrireducens (strain ATCC BAA-621 / DSM 15236 / T118) GN=modC PE=3 SV=1	27	235	1.0E-11
sp\|Q93DX8\|CYSA_BURCE	Sulfate/thiosulfate import ATP-binding protein CysA (Fragment) OS=Burkholderia cepacia GN=cysA PE=3 SV=1	9	214	1.0E-11
sp\|Q7NX01\|CYSA1_CHRVO	Sulfate/thiosulfate import ATP-binding protein CysA 1 OS=Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / NBRC 12614 / NCIMB 9131 / NCTC 9757) GN=cysA1 PE=3 SV=1	8	214	1.0E-11
sp\|Q8UA73\|CYSA2_AGRFC	Sulfate/thiosulfate import ATP-binding protein CysA 2 OS=Agrobacterium fabrum (strain C58 / ATCC 33970) GN=cysA2 PE=3 SV=1	8	212	1.0E-11
sp\|Q2J2E9\|UGPC_RHOP2	sn-glycerol-3-phosphate import ATP-binding protein UgpC OS=Rhodopseudomonas palustris (strain HaA2) GN=ugpC PE=3 SV=1	8	214	1.0E-11
sp\|Q2SJY7\|POTA_HAHCH	Spermidine/putrescine import ATP-binding protein PotA OS=Hahella chejuensis (strain KCTC 2396) GN=potA PE=3 SV=1	5	214	1.0E-11
sp\|Q6HI76\|Y2424_BACHK	Putative ABC transporter ATP-binding protein BT9727_2424 OS=Bacillus thuringiensis subsp. konkukian (strain 97-27) GN=BT9727_2424 PE=3 SV=1	11	212	1.0E-11
sp\|Q4K441\|SSUB2_PSEF5	Aliphatic sulfonates import ATP-binding protein SsuB 2 OS=Pseudomonas fluorescens (strain Pf-5 / ATCC BAA-477) GN=ssuB2 PE=3 SV=1	1	192	1.0E-11
sp\|P9WQI3\|SUGC_MYCTU	Trehalose import ATP-binding protein SugC OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=sugC PE=1 SV=1	8	192	1.0E-11
sp\|P9WQI2\|SUGC_MYCTO	Trehalose import ATP-binding protein SugC OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=sugC PE=3 SV=1	8	192	1.0E-11
sp\|A3CVD3\|ECFA_METMJ	Energy-coupling factor transporter ATP-binding protein EcfA OS=Methanoculleus marisnigri (strain ATCC 35101 / DSM 1498 / JR1) GN=ecfA PE=3 SV=1	13	212	1.0E-11
sp\|Q0I2Z4\|FBPC_HAES1	Fe(3+) ions import ATP-binding protein FbpC OS=Haemophilus somnus (strain 129Pt) GN=fbpC PE=3 SV=1	9	221	2.0E-11
sp\|Q5YZY9\|CYSA_NOCFA	Sulfate/thiosulfate import ATP-binding protein CysA OS=Nocardia farcinica (strain IFM 10152) GN=cysA PE=3 SV=1	9	214	2.0E-11
sp\|Q609Q1\|CYSA_METCA	Sulfate/thiosulfate import ATP-binding protein CysA OS=Methylococcus capsulatus (strain ATCC 33009 / NCIMB 11132 / Bath) GN=cysA PE=3 SV=1	8	243	2.0E-11
sp\|O07016\|YVFR_BACSU	Uncharacterized ABC transporter ATP-binding protein YvfR OS=Bacillus subtilis (strain 168) GN=yvfR PE=3 SV=1	9	194	3.0E-11
sp\|Q254K9\|METN_CHLFF	Methionine import ATP-binding protein MetN OS=Chlamydophila felis (strain Fe/C-56) GN=metN PE=3 SV=1	7	222	3.0E-11
sp\|Q5WJP0\|METN2_BACSK	Methionine import ATP-binding protein MetN 2 OS=Bacillus clausii (strain KSM-K16) GN=metN2 PE=3 SV=1	24	192	3.0E-11
sp\|A1SWH9\|UGPC_PSYIN	sn-glycerol-3-phosphate import ATP-binding protein UgpC OS=Psychromonas ingrahamii (strain 37) GN=ugpC PE=3 SV=1	9	214	3.0E-11
sp\|Q9TKX3\|CYSA_NEPOL	Sulfate/thiosulfate import ATP-binding protein CysA OS=Nephroselmis olivacea GN=cysA PE=3 SV=1	8	192	3.0E-11
sp\|Q8TIX0\|Y4020_METAC	Putative ABC transporter ATP-binding protein MA_4020 OS=Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A) GN=MA_4020 PE=3 SV=1	7	213	3.0E-11
sp\|Q38WL5\|METN_LACSS	Methionine import ATP-binding protein MetN OS=Lactobacillus sakei subsp. sakei (strain 23K) GN=metN PE=3 SV=1	23	214	3.0E-11
sp\|Q56953\|YFEB_YERPE	Chelated iron transport system membrane protein YfeB OS=Yersinia pestis GN=yfeB PE=3 SV=1	7	205	4.0E-11
sp\|Q4L885\|ECFA1_STAHJ	Energy-coupling factor transporter ATP-binding protein EcfA1 OS=Staphylococcus haemolyticus (strain JCSC1435) GN=ecfA1 PE=3 SV=1	20	212	4.0E-11
sp\|Q8RHK9\|ECFA2_FUSNN	Energy-coupling factor transporter ATP-binding protein EcfA2 OS=Fusobacterium nucleatum subsp. nucleatum (strain ATCC 25586 / CIP 101130 / JCM 8532 / LMG 13131) GN=ecfA2 PE=3 SV=1	9	212	4.0E-11
sp\|Q6KHL1\|ECFA1_MYCMO	Energy-coupling factor transporter ATP-binding protein EcfA1 OS=Mycoplasma mobile (strain ATCC 43663 / 163K / NCTC 11711) GN=ecfA1 PE=3 SV=1	7	195	4.0E-11
sp\|Q9X196\|POTA_THEMA	Spermidine/putrescine import ATP-binding protein PotA OS=Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099) GN=potA PE=3 SV=1	9	192	5.0E-11
sp\|P31134\|POTG_ECOLI	Putrescine transport ATP-binding protein PotG OS=Escherichia coli (strain K12) GN=potG PE=3 SV=2	7	248	5.0E-11
sp\|A0PY57\|POTA_CLONN	Spermidine/putrescine import ATP-binding protein PotA OS=Clostridium novyi (strain NT) GN=potA PE=3 SV=1	25	215	5.0E-11
sp\|Q9RKC6\|Y3161_STRCO	Putative ABC transporter ATP-binding protein SCO3161 OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=SCO3161 PE=3 SV=1	11	194	5.0E-11
sp\|Q9V2C0\|WTPC_PYRAB	Molybdate/tungstate import ATP-binding protein WtpC OS=Pyrococcus abyssi (strain GE5 / Orsay) GN=wtpC PE=3 SV=1	11	192	5.0E-11
sp\|Q55EH8\|ABCGN_DICDI	ABC transporter G family member 23 OS=Dictyostelium discoideum GN=abcG23 PE=3 SV=2	8	194	5.0E-11
sp\|Q8PY27\|Y1037_METMA	Putative ABC transporter ATP-binding protein MM_1037 OS=Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88) GN=MM_1037 PE=3 SV=1	9	197	6.0E-11
sp\|O31427\|SKFE_BACSU	SkfA peptide export ATP-binding protein SkfE OS=Bacillus subtilis (strain 168) GN=skfE PE=1 SV=1	11	195	7.0E-11
sp\|Q8XNY7\|Y195_CLOPE	Putative ABC transporter ATP-binding protein CPE0195 OS=Clostridium perfringens (strain 13 / Type A) GN=CPE0195 PE=3 SV=1	11	212	7.0E-11
sp\|Q839D4\|ECFA2_ENTFA	Energy-coupling factor transporter ATP-binding protein EcfA2 OS=Enterococcus faecalis (strain ATCC 700802 / V583) GN=ecfA2 PE=3 SV=2	8	212	7.0E-11
sp\|Q81PZ8\|Y2641_BACAN	Putative ABC transporter ATP-binding protein BA_2641/GBAA_2641/BAS2461 OS=Bacillus anthracis GN=BA_2641 PE=3 SV=1	11	212	8.0E-11
sp\|Q3K506\|SSUB_PSEPF	Aliphatic sulfonates import ATP-binding protein SsuB OS=Pseudomonas fluorescens (strain Pf0-1) GN=ssuB PE=3 SV=1	1	192	9.0E-11
sp\|Q3ABN1\|ECFA_CARHZ	Energy-coupling factor transporter ATP-binding protein EcfA OS=Carboxydothermus hydrogenoformans (strain ATCC BAA-161 / DSM 6008 / Z-2901) GN=ecfA PE=3 SV=1	9	212	9.0E-11
sp\|Q8TTN2\|Y394_METAC	Putative ABC transporter ATP-binding protein MA_0394 OS=Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A) GN=MA_0394 PE=3 SV=1	13	204	9.0E-11
sp\|Q81Y10\|PHNC_BACAN	Phosphonates import ATP-binding protein PhnC OS=Bacillus anthracis GN=phnC PE=3 SV=1	13	212	1.0E-10
sp\|Q4A5A5\|ECFA1_MYCS5	Energy-coupling factor transporter ATP-binding protein EcfA1 OS=Mycoplasma synoviae (strain 53) GN=ecfA1 PE=3 SV=1	9	205	1.0E-10
sp\|Q03Z27\|METN_LEUMM	Methionine import ATP-binding protein MetN OS=Leuconostoc mesenteroides subsp. mesenteroides (strain ATCC 8293 / NCDO 523) GN=metN PE=3 SV=1	5	214	1.0E-10
sp\|Q0SRL2\|POTA_CLOPS	Spermidine/putrescine import ATP-binding protein PotA OS=Clostridium perfringens (strain SM101 / Type A) GN=potA PE=3 SV=2	23	215	1.0E-10
sp\|Q737I0\|Y2668_BACC1	Putative ABC transporter ATP-binding protein BCE_2668 OS=Bacillus cereus (strain ATCC 10987 / NRS 248) GN=BCE_2668 PE=3 SV=1	11	198	1.0E-10
sp\|P45127\|ETTA_HAEIN	Energy-dependent translational throttle protein EttA OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=ettA PE=1 SV=1	25	286	2.0E-10
sp\|Q6D201\|CYSA_PECAS	Sulfate/thiosulfate import ATP-binding protein CysA OS=Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) GN=cysA PE=3 SV=1	8	214	2.0E-10
sp\|Q637E2\|PHNC_BACCZ	Phosphonates import ATP-binding protein PhnC OS=Bacillus cereus (strain ZK / E33L) GN=phnC PE=3 SV=1	13	212	2.0E-10
sp\|Q8CMU4\|PHNC_STAES	Phosphonates import ATP-binding protein PhnC OS=Staphylococcus epidermidis (strain ATCC 12228) GN=phnC PE=3 SV=1	8	212	2.0E-10
sp\|Q5HKQ8\|PHNC_STAEQ	Phosphonates import ATP-binding protein PhnC OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=phnC PE=3 SV=1	8	212	2.0E-10
sp\|Q734T1\|Y3323_BACC1	Putative ABC transporter ATP-binding protein BCE_3323 OS=Bacillus cereus (strain ATCC 10987 / NRS 248) GN=BCE_3323 PE=3 SV=1	11	212	2.0E-10
sp\|Q0SWH9\|ECFA2_CLOPS	Energy-coupling factor transporter ATP-binding protein EcfA2 OS=Clostridium perfringens (strain SM101 / Type A) GN=ecfA2 PE=3 SV=1	11	212	2.0E-10
sp\|Q88ZJ6\|POTA_LACPL	Spermidine/putrescine import ATP-binding protein PotA OS=Lactobacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1) GN=potA PE=3 SV=1	1	212	2.0E-10
sp\|Q8RGC8\|FBPC_FUSNN	Fe(3+) ions import ATP-binding protein FbpC OS=Fusobacterium nucleatum subsp. nucleatum (strain ATCC 25586 / CIP 101130 / JCM 8532 / LMG 13131) GN=fbpC PE=3 SV=1	8	192	2.0E-10
sp\|Q9I2N4\|MODC_PSEAE	Molybdenum import ATP-binding protein ModC OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=modC PE=3 SV=1	27	226	2.0E-10
sp\|Q7A1Z1\|PHNC_STAAW	Phosphonates import ATP-binding protein PhnC OS=Staphylococcus aureus (strain MW2) GN=phnC PE=3 SV=1	13	212	2.0E-10
sp\|Q6GCY2\|PHNC_STAAS	Phosphonates import ATP-binding protein PhnC OS=Staphylococcus aureus (strain MSSA476) GN=phnC PE=3 SV=1	13	212	2.0E-10
sp\|Q6GKG3\|PHNC_STAAR	Phosphonates import ATP-binding protein PhnC OS=Staphylococcus aureus (strain MRSA252) GN=phnC PE=3 SV=1	9	212	2.0E-10
sp\|Q7A848\|PHNC_STAAN	Phosphonates import ATP-binding protein PhnC OS=Staphylococcus aureus (strain N315) GN=phnC PE=3 SV=1	13	212	2.0E-10
sp\|Q99X73\|PHNC_STAAM	Phosphonates import ATP-binding protein PhnC OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=phnC PE=3 SV=1	13	212	2.0E-10
sp\|Q5HJM6\|PHNC_STAAC	Phosphonates import ATP-binding protein PhnC OS=Staphylococcus aureus (strain COL) GN=phnC PE=3 SV=1	13	212	2.0E-10
sp\|Q2G1L8\|PHNC_STAA8	Phosphonates import ATP-binding protein PhnC OS=Staphylococcus aureus (strain NCTC 8325) GN=phnC PE=3 SV=1	13	212	2.0E-10
sp\|Q2FKB7\|PHNC_STAA3	Phosphonates import ATP-binding protein PhnC OS=Staphylococcus aureus (strain USA300) GN=phnC PE=3 SV=1	13	212	2.0E-10
sp\|Q13LD8\|METN2_BURXL	Methionine import ATP-binding protein MetN 2 OS=Burkholderia xenovorans (strain LB400) GN=metN2 PE=3 SV=1	5	192	2.0E-10
sp\|Q8YCG3\|FBPC_BRUME	Fe(3+) ions import ATP-binding protein FbpC OS=Brucella melitensis biotype 1 (strain 16M / ATCC 23456 / NCTC 10094) GN=fbpC PE=3 SV=1	1	214	2.0E-10
sp\|Q8R420\|ABCA3_MOUSE	ATP-binding cassette sub-family A member 3 OS=Mus musculus GN=Abca3 PE=1 SV=3	24	195	2.0E-10
sp\|O68106\|CBIO_RHOCB	Cobalt import ATP-binding protein CbiO OS=Rhodobacter capsulatus (strain ATCC BAA-309 / NBRC 16581 / SB1003) GN=cbiO PE=1 SV=1	7	223	3.0E-10
sp\|Q8XIZ5\|POTA_CLOPE	Spermidine/putrescine import ATP-binding protein PotA OS=Clostridium perfringens (strain 13 / Type A) GN=potA PE=3 SV=1	23	215	3.0E-10
sp\|Q0TNZ3\|POTA_CLOP1	Spermidine/putrescine import ATP-binding protein PotA OS=Clostridium perfringens (strain ATCC 13124 / DSM 756 / JCM 1290 / NCIMB 6125 / NCTC 8237 / Type A) GN=potA PE=3 SV=1	23	215	3.0E-10
sp\|Q8EPK1\|METN1_OCEIH	Methionine import ATP-binding protein MetN 1 OS=Oceanobacillus iheyensis (strain DSM 14371 / JCM 11309 / KCTC 3954 / HTE831) GN=metN1 PE=3 SV=2	24	214	3.0E-10
sp\|Q0TUN8\|ECFA3_CLOP1	Energy-coupling factor transporter ATP-binding protein EcfA3 OS=Clostridium perfringens (strain ATCC 13124 / DSM 756 / JCM 1290 / NCIMB 6125 / NCTC 8237 / Type A) GN=ecfA3 PE=1 SV=1	11	212	3.0E-10
sp\|Q1AS06\|POTA_RUBXD	Spermidine/putrescine import ATP-binding protein PotA OS=Rubrobacter xylanophilus (strain DSM 9941 / NBRC 16129) GN=potA PE=3 SV=1	6	214	3.0E-10
sp\|Q7AH43\|FBPC_ECO57	Fe(3+) ions import ATP-binding protein FbpC OS=Escherichia coli O157:H7 GN=fbpC PE=3 SV=2	22	192	3.0E-10
sp\|Q3SGJ8\|PHNC_THIDA	Phosphonates import ATP-binding protein PhnC OS=Thiobacillus denitrificans (strain ATCC 25259) GN=phnC PE=3 SV=1	9	212	3.0E-10
sp\|Q8PUE7\|Y2387_METMA	Putative ABC transporter ATP-binding protein MM_2387 OS=Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88) GN=MM_2387 PE=3 SV=1	7	214	3.0E-10
sp\|Q31J97\|HMUV_THICR	Hemin import ATP-binding protein HmuV OS=Thiomicrospira crunogena (strain XCL-2) GN=hmuV PE=3 SV=1	25	222	3.0E-10
sp\|Q8YCB1\|UGPC_BRUME	sn-glycerol-3-phosphate import ATP-binding protein UgpC OS=Brucella melitensis biotype 1 (strain 16M / ATCC 23456 / NCTC 10094) GN=ugpC PE=3 SV=1	8	214	3.0E-10
sp\|Q7VI92\|METN_HELHP	Methionine import ATP-binding protein MetN OS=Helicobacter hepaticus (strain ATCC 51449 / 3B1) GN=metN PE=3 SV=1	9	248	3.0E-10
sp\|Q839D5\|ECFA1_ENTFA	Energy-coupling factor transporter ATP-binding protein EcfA1 OS=Enterococcus faecalis (strain ATCC 700802 / V583) GN=ecfA1 PE=3 SV=1	7	224	3.0E-10
sp\|P37009\|FBPC_ECOLI	Fe(3+) ions import ATP-binding protein FbpC OS=Escherichia coli (strain K12) GN=fbpC PE=3 SV=3	22	192	4.0E-10
sp\|Q48QM3\|ECFA2_STRPM	Energy-coupling factor transporter ATP-binding protein EcfA2 OS=Streptococcus pyogenes serotype M28 (strain MGAS6180) GN=ecfA2 PE=3 SV=1	8	200	4.0E-10
sp\|Q578K3\|FBPC_BRUAB	Fe(3+) ions import ATP-binding protein FbpC OS=Brucella abortus biovar 1 (strain 9-941) GN=fbpC PE=3 SV=1	1	214	4.0E-10
sp\|Q2YKX3\|FBPC_BRUA2	Fe(3+) ions import ATP-binding protein FbpC OS=Brucella abortus (strain 2308) GN=fbpC PE=3 SV=1	1	214	4.0E-10
sp\|A2RH10\|ECFA2_STRPG	Energy-coupling factor transporter ATP-binding protein EcfA2 OS=Streptococcus pyogenes serotype M5 (strain Manfredo) GN=ecfA2 PE=3 SV=1	8	200	4.0E-10
sp\|Q1J450\|ECFA2_STRPF	Energy-coupling factor transporter ATP-binding protein EcfA2 OS=Streptococcus pyogenes serotype M4 (strain MGAS10750) GN=ecfA2 PE=3 SV=1	8	200	4.0E-10
sp\|Q1JEC9\|ECFA2_STRPD	Energy-coupling factor transporter ATP-binding protein EcfA2 OS=Streptococcus pyogenes serotype M2 (strain MGAS10270) GN=ecfA2 PE=3 SV=1	8	200	4.0E-10
sp\|Q1JJD0\|ECFA2_STRPC	Energy-coupling factor transporter ATP-binding protein EcfA2 OS=Streptococcus pyogenes serotype M12 (strain MGAS9429) GN=ecfA2 PE=3 SV=1	8	200	4.0E-10
sp\|Q1J983\|ECFA2_STRPB	Energy-coupling factor transporter ATP-binding protein EcfA2 OS=Streptococcus pyogenes serotype M12 (strain MGAS2096) GN=ecfA2 PE=3 SV=1	8	200	4.0E-10
sp\|Q7CMM8\|ECFA2_STRP8	Energy-coupling factor transporter ATP-binding protein EcfA2 OS=Streptococcus pyogenes serotype M18 (strain MGAS8232) GN=ecfA2 PE=3 SV=1	8	200	4.0E-10
sp\|Q5X9B6\|ECFA2_STRP6	Energy-coupling factor transporter ATP-binding protein EcfA2 OS=Streptococcus pyogenes serotype M6 (strain ATCC BAA-946 / MGAS10394) GN=ecfA2 PE=3 SV=1	8	200	4.0E-10
sp\|Q99XI2\|ECFA2_STRP1	Energy-coupling factor transporter ATP-binding protein EcfA2 OS=Streptococcus pyogenes serotype M1 GN=ecfA2 PE=3 SV=1	8	200	4.0E-10
sp\|Q7N986\|MALK_PHOLL	Maltose/maltodextrin import ATP-binding protein MalK OS=Photorhabdus luminescens subsp. laumondii (strain TT01) GN=malK PE=3 SV=1	8	192	4.0E-10
sp\|Q2SRI1\|ECFA1_MYCCT	Energy-coupling factor transporter ATP-binding protein EcfA1 OS=Mycoplasma capricolum subsp. capricolum (strain California kid / ATCC 27343 / NCTC 10154) GN=ecfA1 PE=3 SV=1	9	208	4.0E-10
sp\|Q07UI9\|UGPC_RHOP5	sn-glycerol-3-phosphate import ATP-binding protein UgpC OS=Rhodopseudomonas palustris (strain BisA53) GN=ugpC PE=3 SV=1	8	214	4.0E-10
sp\|Q0AGF4\|POTA_NITEC	Spermidine/putrescine import ATP-binding protein PotA OS=Nitrosomonas eutropha (strain C91) GN=potA PE=3 SV=1	11	214	4.0E-10
sp\|Q2YKR8\|UGPC_BRUA2	sn-glycerol-3-phosphate import ATP-binding protein UgpC OS=Brucella abortus (strain 2308) GN=ugpC PE=3 SV=1	8	214	5.0E-10
sp\|Q8FW07\|UGPC_BRUSU	sn-glycerol-3-phosphate import ATP-binding protein UgpC OS=Brucella suis biovar 1 (strain 1330) GN=ugpC PE=3 SV=1	8	214	5.0E-10
sp\|Q578E9\|UGPC_BRUAB	sn-glycerol-3-phosphate import ATP-binding protein UgpC OS=Brucella abortus biovar 1 (strain 9-941) GN=ugpC PE=3 SV=1	8	214	5.0E-10
sp\|P0CZ27\|ECFA2_STRPQ	Energy-coupling factor transporter ATP-binding protein EcfA2 OS=Streptococcus pyogenes serotype M3 (strain SSI-1) GN=ecfA2 PE=3 SV=1	8	200	5.0E-10
sp\|P0CZ26\|ECFA2_STRP3	Energy-coupling factor transporter ATP-binding protein EcfA2 OS=Streptococcus pyogenes serotype M3 (strain ATCC BAA-595 / MGAS315) GN=ecfA2 PE=3 SV=1	8	200	5.0E-10
sp\|Q9KLQ5\|FBPC_VIBCH	Fe(3+) ions import ATP-binding protein FbpC OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=fbpC PE=3 SV=1	9	192	5.0E-10
sp\|Q8U6M1\|FBPC_AGRFC	Fe(3+) ions import ATP-binding protein FbpC OS=Agrobacterium fabrum (strain C58 / ATCC 33970) GN=fbpC PE=3 SV=1	1	256	6.0E-10
sp\|P9WQM1\|CYSA_MYCTU	Sulfate/thiosulfate import ATP-binding protein CysA OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=cysA PE=1 SV=2	9	214	6.0E-10
sp\|P9WQM0\|CYSA_MYCTO	Sulfate/thiosulfate import ATP-binding protein CysA OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=cysA PE=3 SV=2	9	214	6.0E-10
sp\|P0A4W3\|CYSA_MYCBO	Sulfate/thiosulfate import ATP-binding protein CysA OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=cysA PE=3 SV=2	9	214	6.0E-10
sp\|Q2FNX9\|ECFA1_METHJ	Energy-coupling factor transporter ATP-binding protein EcfA1 OS=Methanospirillum hungatei JF-1 (strain ATCC 27890 / DSM 864 / NBRC 100397 / JF-1) GN=ecfA1 PE=3 SV=1	12	226	6.0E-10
sp\|O54187\|Y5958_STRCO	Putative ABC transporter ATP-binding protein SCO5958 OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=SCO5958 PE=3 SV=1	4	200	7.0E-10
sp\|Q21CA3\|UGPC_RHOPB	sn-glycerol-3-phosphate import ATP-binding protein UgpC OS=Rhodopseudomonas palustris (strain BisB18) GN=ugpC PE=3 SV=1	8	214	7.0E-10
sp\|Q6HFB5\|PHNC_BACHK	Phosphonates import ATP-binding protein PhnC OS=Bacillus thuringiensis subsp. konkukian (strain 97-27) GN=phnC PE=3 SV=1	13	212	7.0E-10
sp\|Q7N2D9\|LSRA_PHOLL	Autoinducer 2 import ATP-binding protein LsrA OS=Photorhabdus luminescens subsp. laumondii (strain TT01) GN=lsrA PE=3 SV=1	6	192	7.0E-10
sp\|Q81CT8\|Y2655_BACCR	Putative ABC transporter ATP-binding protein BC_2655 OS=Bacillus cereus (strain ATCC 14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL B-3711) GN=BC_2655 PE=3 SV=2	11	212	7.0E-10
sp\|A3PRY1\|UGPC_RHOS1	sn-glycerol-3-phosphate import ATP-binding protein UgpC OS=Rhodobacter sphaeroides (strain ATCC 17029 / ATH 2.4.9) GN=ugpC PE=3 SV=1	25	214	7.0E-10
sp\|Q18AM3\|POTA_PEPD6	Spermidine/putrescine import ATP-binding protein PotA OS=Peptoclostridium difficile (strain 630) GN=potA PE=3 SV=1	23	215	8.0E-10
sp\|Q03JH1\|POTA_STRTD	Spermidine/putrescine import ATP-binding protein PotA OS=Streptococcus thermophilus (strain ATCC BAA-491 / LMD-9) GN=potA PE=3 SV=1	7	192	8.0E-10
sp\|Q7ME63\|MODC_VIBVY	Molybdenum import ATP-binding protein ModC OS=Vibrio vulnificus (strain YJ016) GN=modC PE=3 SV=2	25	212	8.0E-10
sp\|P04285\|OPPD_SALTY	Oligopeptide transport ATP-binding protein OppD OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=oppD PE=3 SV=1	3	218	9.0E-10
sp\|Q6NDQ0\|UGPC_RHOPA	sn-glycerol-3-phosphate import ATP-binding protein UgpC OS=Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009) GN=ugpC PE=3 SV=1	8	192	9.0E-10
sp\|Q5M397\|POTA_STRT2	Spermidine/putrescine import ATP-binding protein PotA OS=Streptococcus thermophilus (strain ATCC BAA-250 / LMG 18311) GN=potA PE=3 SV=1	7	192	9.0E-10
sp\|Q82CD3\|SSUB2_STRAW	Aliphatic sulfonates import ATP-binding protein SsuB 2 OS=Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680) GN=ssuB2 PE=3 SV=1	7	196	9.0E-10
sp\|Q5LYN4\|POTA_STRT1	Spermidine/putrescine import ATP-binding protein PotA OS=Streptococcus thermophilus (strain CNRZ 1066) GN=potA PE=3 SV=1	7	192	9.0E-10
sp\|Q733D6\|PHNC_BACC1	Phosphonates import ATP-binding protein PhnC OS=Bacillus cereus (strain ATCC 10987 / NRS 248) GN=phnC PE=3 SV=1	13	212	1.0E-09
sp\|Q6MSQ1\|ECFA1_MYCMS	Energy-coupling factor transporter ATP-binding protein EcfA1 OS=Mycoplasma mycoides subsp. mycoides SC (strain PG1) GN=ecfA1 PE=3 SV=1	9	208	1.0E-09
sp\|Q6F9P2\|METN2_ACIAD	Methionine import ATP-binding protein MetN 2 OS=Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1) GN=metN2 PE=3 SV=1	27	227	1.0E-09
sp\|Q47CB7\|MODC_DECAR	Molybdenum import ATP-binding protein ModC OS=Dechloromonas aromatica (strain RCB) GN=modC PE=3 SV=1	20	235	1.0E-09
sp\|Q5DZC6\|MALK_VIBF1	Maltose/maltodextrin import ATP-binding protein MalK OS=Vibrio fischeri (strain ATCC 700601 / ES114) GN=malK PE=3 SV=1	8	192	1.0E-09
sp\|Q8E8K8\|CYSA2_SHEON	Sulfate/thiosulfate import ATP-binding protein CysA 2 OS=Shewanella oneidensis (strain MR-1) GN=cysA2 PE=3 SV=1	11	214	1.0E-09
sp\|A1B9Q7\|UGPC_PARDP	sn-glycerol-3-phosphate import ATP-binding protein UgpC OS=Paracoccus denitrificans (strain Pd 1222) GN=ugpC PE=3 SV=1	25	192	1.0E-09
sp\|Q8DZJ0\|POTA_STRA5	Spermidine/putrescine import ATP-binding protein PotA OS=Streptococcus agalactiae serotype V (strain ATCC BAA-611 / 2603 V/R) GN=potA PE=3 SV=1	7	192	1.0E-09
sp\|Q8E554\|POTA_STRA3	Spermidine/putrescine import ATP-binding protein PotA OS=Streptococcus agalactiae serotype III (strain NEM316) GN=potA PE=3 SV=1	7	192	1.0E-09
sp\|Q3K0Y6\|POTA_STRA1	Spermidine/putrescine import ATP-binding protein PotA OS=Streptococcus agalactiae serotype Ia (strain ATCC 27591 / A909 / CDC SS700) GN=potA PE=3 SV=1	7	192	1.0E-09
sp\|P0A9U2\|YBHF_SHIFL	Uncharacterized ABC transporter ATP-binding protein YbhF OS=Shigella flexneri GN=ybhF PE=3 SV=1	9	196	1.0E-09
sp\|P0A9U1\|YBHF_ECOLI	Uncharacterized ABC transporter ATP-binding protein YbhF OS=Escherichia coli (strain K12) GN=ybhF PE=1 SV=1	9	196	1.0E-09
sp\|Q0T8D1\|THIQ_SHIF8	Thiamine import ATP-binding protein ThiQ OS=Shigella flexneri serotype 5b (strain 8401) GN=thiQ PE=3 SV=1	29	233	1.0E-09
sp\|Q5LX21\|UGPC_RUEPO	sn-glycerol-3-phosphate import ATP-binding protein UgpC OS=Ruegeria pomeroyi (strain ATCC 700808 / DSM 15171 / DSS-3) GN=ugpC PE=3 SV=1	8	192	1.0E-09
sp\|Q1IGL4\|SSUB_PSEE4	Aliphatic sulfonates import ATP-binding protein SsuB OS=Pseudomonas entomophila (strain L48) GN=ssuB PE=3 SV=1	9	212	1.0E-09
sp\|Q8FVV5\|FBPC_BRUSU	Fe(3+) ions import ATP-binding protein FbpC OS=Brucella suis biovar 1 (strain 1330) GN=fbpC PE=3 SV=1	1	214	1.0E-09
sp\|O32169\|METN_BACSU	Methionine import ATP-binding protein MetN OS=Bacillus subtilis (strain 168) GN=metN PE=1 SV=1	23	218	1.0E-09
sp\|Q326G9\|THIQ_SHIBS	Thiamine import ATP-binding protein ThiQ OS=Shigella boydii serotype 4 (strain Sb227) GN=thiQ PE=3 SV=1	29	233	2.0E-09
sp\|Q87UI3\|SSUB3_PSESM	Aliphatic sulfonates import ATP-binding protein SsuB 3 OS=Pseudomonas syringae pv. tomato (strain DC3000) GN=ssuB3 PE=3 SV=1	9	192	2.0E-09
sp\|Q83MG3\|THIQ_SHIFL	Thiamine import ATP-binding protein ThiQ OS=Shigella flexneri GN=thiQ PE=3 SV=4	29	230	2.0E-09
sp\|Q7MKU3\|POTA_VIBVY	Spermidine/putrescine import ATP-binding protein PotA OS=Vibrio vulnificus (strain YJ016) GN=potA PE=3 SV=2	7	214	2.0E-09
sp\|Q8D9J4\|POTA_VIBVU	Spermidine/putrescine import ATP-binding protein PotA OS=Vibrio vulnificus (strain CMCP6) GN=potA PE=3 SV=1	7	214	2.0E-09
sp\|P36879\|YADG_ECOLI	Uncharacterized ABC transporter ATP-binding protein YadG OS=Escherichia coli (strain K12) GN=yadG PE=3 SV=1	11	195	2.0E-09
sp\|Q5KVK2\|METN_GEOKA	Methionine import ATP-binding protein MetN OS=Geobacillus kaustophilus (strain HTA426) GN=metN PE=3 SV=1	23	217	2.0E-09
sp\|Q9CK97\|METN_PASMU	Methionine import ATP-binding protein MetN OS=Pasteurella multocida (strain Pm70) GN=metN PE=3 SV=1	23	223	2.0E-09
sp\|Q8PZN0\|Y462_METMA	Putative ABC transporter ATP-binding protein MM_0462 OS=Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88) GN=MM_0462 PE=3 SV=2	13	207	2.0E-09
sp\|Q8X6U5\|UGPC_ECO57	sn-glycerol-3-phosphate import ATP-binding protein UgpC OS=Escherichia coli O157:H7 GN=ugpC PE=3 SV=2	25	192	2.0E-09
sp\|Q6NDA6\|CCMA_RHOPA	Cytochrome c biogenesis ATP-binding export protein CcmA OS=Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009) GN=ccmA PE=3 SV=1	27	192	2.0E-09
sp\|O34756\|YJKB_BACSU	Putative ABC transporter ATP-binding protein YjkB OS=Bacillus subtilis (strain 168) GN=yjkB PE=3 SV=1	25	231	2.0E-09
sp\|Q28QL7\|UGPC_JANSC	sn-glycerol-3-phosphate import ATP-binding protein UgpC OS=Jannaschia sp. (strain CCS1) GN=ugpC PE=3 SV=1	8	192	2.0E-09
sp\|Q21Y06\|PHNC2_RHOFT	Phosphonates import ATP-binding protein PhnC 2 OS=Rhodoferax ferrireducens (strain ATCC BAA-621 / DSM 15236 / T118) GN=phnC2 PE=3 SV=1	8	201	2.0E-09
sp\|P54591\|YHCG_BACSU	Uncharacterized ABC transporter ATP-binding protein YhcG OS=Bacillus subtilis (strain 168) GN=yhcG PE=3 SV=1	23	197	2.0E-09
sp\|Q51719\|YCOBA_PROFR	Putative ABC transporter ATP-binding protein in cobA 5'region OS=Propionibacterium freudenreichii subsp. shermanii PE=3 SV=1	9	192	2.0E-09
sp\|Q8DUF7\|POTA_STRMU	Spermidine/putrescine import ATP-binding protein PotA OS=Streptococcus mutans serotype c (strain ATCC 700610 / UA159) GN=potA PE=3 SV=1	5	192	3.0E-09
sp\|Q8DPC2\|POTA_STRR6	Spermidine/putrescine import ATP-binding protein PotA OS=Streptococcus pneumoniae (strain ATCC BAA-255 / R6) GN=potA PE=3 SV=1	7	192	3.0E-09
sp\|Q97Q42\|POTA_STRPN	Spermidine/putrescine import ATP-binding protein PotA OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) GN=potA PE=3 SV=1	7	192	3.0E-09
sp\|Q04JW0\|POTA_STRP2	Spermidine/putrescine import ATP-binding protein PotA OS=Streptococcus pneumoniae serotype 2 (strain D39 / NCTC 7466) GN=potA PE=3 SV=1	7	192	3.0E-09
sp\|P48334\|YCXD_CYAPA	Probable ABC transporter ATP-binding protein in ycf23-apcF intergenic region OS=Cyanophora paradoxa PE=3 SV=1	6	188	3.0E-09
sp\|P17328\|PROV_SALTY	Glycine betaine/L-proline transport ATP-binding protein ProV OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=proV PE=3 SV=2	22	270	3.0E-09
sp\|Q3Z5U5\|THIQ_SHISS	Thiamine import ATP-binding protein ThiQ OS=Shigella sonnei (strain Ss046) GN=thiQ PE=3 SV=1	29	233	3.0E-09
sp\|Q89WG0\|UGPC_BRADU	sn-glycerol-3-phosphate import ATP-binding protein UgpC OS=Bradyrhizobium diazoefficiens (strain JCM 10833 / IAM 13628 / NBRC 14792 / USDA 110) GN=ugpC PE=3 SV=1	8	214	3.0E-09
sp\|Q14Q07\|POTA_SPICI	Spermidine/putrescine import ATP-binding protein PotA OS=Spiroplasma citri GN=potA PE=3 SV=1	13	214	3.0E-09
sp\|Q2PBM3\|LSRA_PHOTE	Autoinducer 2 import ATP-binding protein LsrA OS=Photorhabdus temperata GN=lsrA PE=3 SV=1	6	192	3.0E-09
sp\|O57896\|WTPC_PYRHO	Molybdate/tungstate import ATP-binding protein WtpC OS=Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3) GN=wtpC PE=3 SV=1	11	196	3.0E-09
sp\|Q9CM80\|FBPC_PASMU	Fe(3+) ions import ATP-binding protein FbpC OS=Pasteurella multocida (strain Pm70) GN=fbpC PE=3 SV=1	9	221	3.0E-09
sp\|Q8KZQ6\|SSUB_PSEPU	Aliphatic sulfonates import ATP-binding protein SsuB OS=Pseudomonas putida GN=ssuB PE=1 SV=1	12	192	3.0E-09
sp\|Q03ZL6\|ECFA1_LEUMM	Energy-coupling factor transporter ATP-binding protein EcfA1 OS=Leuconostoc mesenteroides subsp. mesenteroides (strain ATCC 8293 / NCDO 523) GN=ecfA1 PE=1 SV=1	9	195	4.0E-09
sp\|Q7N3S7\|HMUV_PHOLL	Hemin import ATP-binding protein HmuV OS=Photorhabdus luminescens subsp. laumondii (strain TT01) GN=hmuV PE=3 SV=1	8	228	4.0E-09
sp\|Q2K8C8\|FBPC_RHIEC	Fe(3+) ions import ATP-binding protein FbpC OS=Rhizobium etli (strain CFN 42 / ATCC 51251) GN=fbpC PE=3 SV=1	1	214	4.0E-09
sp\|Q8D740\|MODC_VIBVU	Molybdenum import ATP-binding protein ModC OS=Vibrio vulnificus (strain CMCP6) GN=modC PE=3 SV=1	25	212	4.0E-09
sp\|Q92WJ0\|FBPC1_RHIME	Fe(3+) ions import ATP-binding protein FbpC 1 OS=Rhizobium meliloti (strain 1021) GN=fbpC1 PE=3 SV=1	1	214	4.0E-09
sp\|Q2PBM0\|LSRA_PHOLU	Autoinducer 2 import ATP-binding protein LsrA OS=Photorhabdus luminescens GN=lsrA PE=3 SV=1	6	264	4.0E-09
sp\|Q87DT9\|CYSA_XYLFT	Sulfate/thiosulfate import ATP-binding protein CysA OS=Xylella fastidiosa (strain Temecula1 / ATCC 700964) GN=cysA PE=3 SV=1	9	221	4.0E-09
sp\|Q6A6X6\|METN_PROAC	Methionine import ATP-binding protein MetN OS=Propionibacterium acnes (strain KPA171202 / DSM 16379) GN=metN PE=3 SV=1	2	195	4.0E-09
sp\|A0RFA4\|SSUB_BACAH	Aliphatic sulfonates import ATP-binding protein SsuB OS=Bacillus thuringiensis (strain Al Hakam) GN=ssuB PE=3 SV=2	9	207	4.0E-09
sp\|Q0HYN8\|MODC_SHESR	Molybdenum import ATP-binding protein ModC OS=Shewanella sp. (strain MR-7) GN=modC PE=3 SV=1	27	212	4.0E-09
sp\|A1JIE0\|UGPC_YERE8	sn-glycerol-3-phosphate import ATP-binding protein UgpC OS=Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081) GN=ugpC PE=3 SV=1	25	192	4.0E-09
sp\|P0AAI0\|SAPF_SHIFL	Peptide transport system ATP-binding protein SapF OS=Shigella flexneri GN=sapF PE=3 SV=1	11	235	5.0E-09
sp\|P0AAH8\|SAPF_ECOLI	Peptide transport system ATP-binding protein SapF OS=Escherichia coli (strain K12) GN=sapF PE=1 SV=1	11	235	5.0E-09
sp\|P0AAH9\|SAPF_ECOL6	Peptide transport system ATP-binding protein SapF OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=sapF PE=3 SV=1	11	235	5.0E-09
sp\|A1TXH7\|POTA_MARHV	Spermidine/putrescine import ATP-binding protein PotA OS=Marinobacter hydrocarbonoclasticus (strain ATCC 700491 / DSM 11845 / VT8) GN=potA PE=3 SV=1	11	214	5.0E-09
sp\|A3CMQ7\|POTA_STRSV	Spermidine/putrescine import ATP-binding protein PotA OS=Streptococcus sanguinis (strain SK36) GN=potA PE=3 SV=1	7	192	5.0E-09
sp\|Q1QE80\|POTA_PSYCK	Spermidine/putrescine import ATP-binding protein PotA OS=Psychrobacter cryohalolentis (strain K5) GN=potA PE=3 SV=1	20	192	5.0E-09
sp\|Q5FKL2\|METN_LACAC	Methionine import ATP-binding protein MetN OS=Lactobacillus acidophilus (strain ATCC 700396 / NCK56 / N2 / NCFM) GN=metN PE=3 SV=1	9	214	5.0E-09
sp\|Q8G5P8\|METN_BIFLO	Methionine import ATP-binding protein MetN OS=Bifidobacterium longum (strain NCC 2705) GN=metN PE=3 SV=1	25	224	5.0E-09
sp\|Q65VG9\|METN_MANSM	Methionine import ATP-binding protein MetN OS=Mannheimia succiniciproducens (strain MBEL55E) GN=metN PE=3 SV=1	27	223	5.0E-09
sp\|Q1CJS9\|FBPC_YERPN	Fe(3+) ions import ATP-binding protein FbpC OS=Yersinia pestis bv. Antiqua (strain Nepal516) GN=fbpC PE=3 SV=1	28	170	5.0E-09
sp\|Q8ZCM2\|FBPC_YERPE	Fe(3+) ions import ATP-binding protein FbpC OS=Yersinia pestis GN=fbpC PE=3 SV=1	28	170	5.0E-09
sp\|Q1C607\|FBPC_YERPA	Fe(3+) ions import ATP-binding protein FbpC OS=Yersinia pestis bv. Antiqua (strain Antiqua) GN=fbpC PE=3 SV=1	28	170	5.0E-09
sp\|Q10418\|MESD_LEUME	Mesentericin-Y105 transport/processing ATP-binding protein MesD OS=Leuconostoc mesenteroides GN=mesD PE=3 SV=1	1	224	5.0E-09
sp\|Q668Q3\|FBPC_YERPS	Fe(3+) ions import ATP-binding protein FbpC OS=Yersinia pseudotuberculosis serotype I (strain IP32953) GN=fbpC PE=3 SV=1	28	170	5.0E-09
sp\|Q1CNC6\|UGPC_YERPN	sn-glycerol-3-phosphate import ATP-binding protein UgpC OS=Yersinia pestis bv. Antiqua (strain Nepal516) GN=ugpC PE=3 SV=1	25	192	5.0E-09
sp\|Q74R28\|UGPC_YERPE	sn-glycerol-3-phosphate import ATP-binding protein UgpC OS=Yersinia pestis GN=ugpC PE=3 SV=1	25	192	5.0E-09
sp\|Q1CBH2\|UGPC_YERPA	sn-glycerol-3-phosphate import ATP-binding protein UgpC OS=Yersinia pestis bv. Antiqua (strain Antiqua) GN=ugpC PE=3 SV=1	25	192	5.0E-09
sp\|Q1GIE5\|POTA_RUEST	Spermidine/putrescine import ATP-binding protein PotA OS=Ruegeria sp. (strain TM1040) GN=potA PE=3 SV=1	23	214	5.0E-09
sp\|Q32K28\|THIQ_SHIDS	Thiamine import ATP-binding protein ThiQ OS=Shigella dysenteriae serotype 1 (strain Sd197) GN=thiQ PE=3 SV=1	29	233	5.0E-09
sp\|Q3IX40\|UGPC_RHOS4	sn-glycerol-3-phosphate import ATP-binding protein UgpC OS=Rhodobacter sphaeroides (strain ATCC 17023 / 2.4.1 / NCIB 8253 / DSM 158) GN=ugpC PE=3 SV=1	25	214	6.0E-09
sp\|Q164Y5\|UGPC_ROSDO	sn-glycerol-3-phosphate import ATP-binding protein UgpC OS=Roseobacter denitrificans (strain ATCC 33942 / OCh 114) GN=ugpC PE=3 SV=1	8	192	6.0E-09
sp\|Q664X5\|MALK_YERPS	Maltose/maltodextrin import ATP-binding protein MalK OS=Yersinia pseudotuberculosis serotype I (strain IP32953) GN=malK PE=3 SV=1	26	192	6.0E-09
sp\|Q1CNR8\|MALK_YERPN	Maltose/maltodextrin import ATP-binding protein MalK OS=Yersinia pestis bv. Antiqua (strain Nepal516) GN=malK PE=3 SV=1	26	192	6.0E-09
sp\|Q8ZAS8\|MALK_YERPE	Maltose/maltodextrin import ATP-binding protein MalK OS=Yersinia pestis GN=malK PE=3 SV=1	26	192	6.0E-09
sp\|Q1CC21\|MALK_YERPA	Maltose/maltodextrin import ATP-binding protein MalK OS=Yersinia pestis bv. Antiqua (strain Antiqua) GN=malK PE=3 SV=1	26	192	6.0E-09
sp\|O27739\|ECFA_METTH	Energy-coupling factor transporter ATP-binding protein EcfA OS=Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H) GN=ecfA PE=3 SV=1	9	200	6.0E-09
sp\|P34358\|CED7_CAEEL	ABC transporter ced-7 OS=Caenorhabditis elegans GN=ced-7 PE=1 SV=6	8	211	6.0E-09
sp\|Q18KE1\|PHNC1_HALWD	Phosphonates import ATP-binding protein PhnC 1 OS=Haloquadratum walsbyi (strain DSM 16790 / HBSQ001) GN=phnC1 PE=3 SV=1	7	192	6.0E-09
sp\|Q0I5E9\|METN_HAES1	Methionine import ATP-binding protein MetN OS=Haemophilus somnus (strain 129Pt) GN=metN PE=3 SV=1	23	195	7.0E-09
sp\|Q60AI1\|POTA_METCA	Spermidine/putrescine import ATP-binding protein PotA OS=Methylococcus capsulatus (strain ATCC 33009 / NCIMB 11132 / Bath) GN=potA PE=3 SV=1	24	214	7.0E-09
sp\|Q66H39\|ABCF3_RAT	ATP-binding cassette sub-family F member 3 OS=Rattus norvegicus GN=Abcf3 PE=2 SV=1	8	208	7.0E-09
sp\|Q134N9\|METN_RHOPS	Methionine import ATP-binding protein MetN OS=Rhodopseudomonas palustris (strain BisB5) GN=metN PE=3 SV=2	1	192	7.0E-09
sp\|Q8KFD6\|Y391_CHLTE	Putative ABC transporter ATP-binding protein CT0391 OS=Chlorobium tepidum (strain ATCC 49652 / DSM 12025 / NBRC 103806 / TLS) GN=CT0391 PE=3 SV=1	4	212	7.0E-09
sp\|P31548\|THIQ_ECOLI	Thiamine import ATP-binding protein ThiQ OS=Escherichia coli (strain K12) GN=thiQ PE=1 SV=2	29	233	7.0E-09
sp\|Q88R93\|SSUB_PSEPK	Aliphatic sulfonates import ATP-binding protein SsuB OS=Pseudomonas putida (strain KT2440) GN=ssuB PE=3 SV=1	12	192	7.0E-09
sp\|P44531\|FBPC1_HAEIN	Fe(3+) ions import ATP-binding protein FbpC 1 OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=fbpC1 PE=3 SV=1	9	221	7.0E-09
sp\|Q035E0\|PHNC_LACC3	Phosphonates import ATP-binding protein PhnC OS=Lactobacillus casei (strain ATCC 334) GN=phnC PE=3 SV=1	1	236	7.0E-09
sp\|P37732\|MODC1_AZOVI	Molybdenum import ATP-binding protein ModC 1 OS=Azotobacter vinelandii GN=modC1 PE=3 SV=2	20	226	7.0E-09
sp\|Q6LPK6\|MSBA_PHOPR	Lipid A export ATP-binding/permease protein MsbA OS=Photobacterium profundum GN=msbA PE=3 SV=1	8	205	7.0E-09
sp\|Q7N8B9\|FBPC_PHOLL	Fe(3+) ions import ATP-binding protein FbpC OS=Photorhabdus luminescens subsp. laumondii (strain TT01) GN=fbpC PE=3 SV=1	9	192	7.0E-09
sp\|Q8PYH5\|Y887_METMA	Putative ABC transporter ATP-binding protein MM_0887 OS=Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88) GN=MM_0887 PE=3 SV=1	7	213	8.0E-09
sp\|Q03PY6\|ECFA2_LACBA	Energy-coupling factor transporter ATP-binding protein EcfA2 OS=Lactobacillus brevis (strain ATCC 367 / JCM 1170) GN=ecfA2 PE=1 SV=1	9	215	8.0E-09
sp\|Q21PQ7\|ZNUC_SACD2	Zinc import ATP-binding protein ZnuC OS=Saccharophagus degradans (strain 2-40 / ATCC 43961 / DSM 17024) GN=znuC PE=3 SV=1	1	192	8.0E-09
sp\|Q6LKD4\|FBPC_PHOPR	Fe(3+) ions import ATP-binding protein FbpC OS=Photobacterium profundum GN=fbpC PE=3 SV=2	9	192	8.0E-09
sp\|Q2J3F7\|CCMA_RHOP2	Cytochrome c biogenesis ATP-binding export protein CcmA OS=Rhodopseudomonas palustris (strain HaA2) GN=ccmA PE=3 SV=1	35	192	8.0E-09
sp\|Q831K6\|METN2_ENTFA	Methionine import ATP-binding protein MetN 2 OS=Enterococcus faecalis (strain ATCC 700802 / V583) GN=metN2 PE=1 SV=1	23	214	8.0E-09
sp\|Q2NRN5\|METN_SODGM	Methionine import ATP-binding protein MetN OS=Sodalis glossinidius (strain morsitans) GN=metN PE=3 SV=1	23	223	8.0E-09
sp\|Q6D645\|HMUV_PECAS	Hemin import ATP-binding protein HmuV OS=Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) GN=hmuV PE=3 SV=1	27	212	8.0E-09
sp\|Q71ED1\|NDVA_AGRVI	Beta-(1-->2)glucan export ATP-binding/permease protein NdvA OS=Agrobacterium vitis GN=ndvA PE=3 SV=1	8	188	8.0E-09
sp\|Q9FJH6\|AB1F_ARATH	ABC transporter F family member 1 OS=Arabidopsis thaliana GN=ABCF1 PE=1 SV=1	4	215	8.0E-09
sp\|Q7MFC4\|MALK_VIBVY	Maltose/maltodextrin import ATP-binding protein MalK OS=Vibrio vulnificus (strain YJ016) GN=malK PE=3 SV=1	8	192	8.0E-09
sp\|Q8D3V0\|MALK_VIBVU	Maltose/maltodextrin import ATP-binding protein MalK OS=Vibrio vulnificus (strain CMCP6) GN=malK PE=3 SV=1	8	192	8.0E-09
sp\|Q6FAN3\|METN1_ACIAD	Methionine import ATP-binding protein MetN 1 OS=Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1) GN=metN1 PE=3 SV=1	5	192	9.0E-09
sp\|P94360\|MSMX_BACSU	Maltodextrin import ATP-binding protein MsmX OS=Bacillus subtilis (strain 168) GN=msmX PE=3 SV=1	16	214	9.0E-09
sp\|Q6HHI7\|SSUB_BACHK	Aliphatic sulfonates import ATP-binding protein SsuB OS=Bacillus thuringiensis subsp. konkukian (strain 97-27) GN=ssuB PE=3 SV=1	9	207	9.0E-09
sp\|O06980\|YVCR_BACSU	Uncharacterized ABC transporter ATP-binding protein YvcR OS=Bacillus subtilis (strain 168) GN=yvcR PE=3 SV=1	30	192	9.0E-09
sp\|Q6MIP7\|PHNC_BDEBA	Phosphonates import ATP-binding protein PhnC OS=Bdellovibrio bacteriovorus (strain ATCC 15356 / DSM 50701 / NCIB 9529 / HD100) GN=phnC PE=3 SV=1	5	212	9.0E-09
sp\|Q92LX3\|METN_RHIME	Methionine import ATP-binding protein MetN OS=Rhizobium meliloti (strain 1021) GN=metN PE=3 SV=1	9	214	9.0E-09
sp\|Q48CA0\|SSUB3_PSE14	Aliphatic sulfonates import ATP-binding protein SsuB 3 OS=Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6) GN=ssuB3 PE=3 SV=1	9	192	9.0E-09
sp\|Q08381\|MODC_RHOCA	Molybdenum import ATP-binding protein ModC OS=Rhodobacter capsulatus GN=modC PE=3 SV=1	27	213	9.0E-09
sp\|Q58488\|ECFA_METJA	Energy-coupling factor transporter ATP-binding protein EcfA OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=ecfA PE=3 SV=1	9	237	1.0E-08
sp\|P78966\|MAM1_SCHPO	Mating factor M secretion protein mam1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mam1 PE=3 SV=1	12	227	1.0E-08
sp\|Q9KL04\|MALK_VIBCH	Maltose/maltodextrin import ATP-binding protein MalK OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=malK PE=3 SV=1	8	192	1.0E-08
sp\|Q63JZ3\|TAUB_BURPS	Taurine import ATP-binding protein TauB OS=Burkholderia pseudomallei (strain K96243) GN=tauB PE=3 SV=1	23	169	1.0E-08
sp\|Q8R9L8\|Y1589_CALS4	Putative ABC transporter ATP-binding protein TTE1589 OS=Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4) GN=TTE1589 PE=3 SV=1	9	215	1.0E-08
sp\|Q63A38\|SSUB_BACCZ	Aliphatic sulfonates import ATP-binding protein SsuB OS=Bacillus cereus (strain ZK / E33L) GN=ssuB PE=3 SV=1	9	207	1.0E-08
sp\|Q9C8T1\|AB1I_ARATH	ABC transporter I family member 1 OS=Arabidopsis thaliana GN=ABCI1 PE=2 SV=1	4	193	1.0E-08
sp\|Q65S66\|FBPC_MANSM	Fe(3+) ions import ATP-binding protein FbpC OS=Mannheimia succiniciproducens (strain MBEL55E) GN=fbpC PE=3 SV=2	9	221	1.0E-08
sp\|Q9NUQ8\|ABCF3_HUMAN	ATP-binding cassette sub-family F member 3 OS=Homo sapiens GN=ABCF3 PE=1 SV=2	8	208	1.0E-08
sp\|P52218\|CCMA_PARDP	Cytochrome c biogenesis ATP-binding export protein CcmA OS=Paracoccus denitrificans (strain Pd 1222) GN=ccmA PE=1 SV=2	25	193	1.0E-08
sp\|Q4FQD1\|PSTB_PSYA2	Phosphate import ATP-binding protein PstB OS=Psychrobacter arcticus (strain DSM 17307 / 273-4) GN=pstB PE=3 SV=2	6	223	1.0E-08
sp\|Q8NR42\|SSUB_CORGL	Aliphatic sulfonates import ATP-binding protein SsuB OS=Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / LMG 3730 / NCIMB 10025) GN=ssuB PE=1 SV=1	25	246	1.0E-08
sp\|Q81C68\|SSUB_BACCR	Aliphatic sulfonates import ATP-binding protein SsuB OS=Bacillus cereus (strain ATCC 14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL B-3711) GN=ssuB PE=3 SV=1	25	207	1.0E-08
sp\|O34641\|YTRB_BACSU	ABC transporter ATP-binding protein YtrB OS=Bacillus subtilis (strain 168) GN=ytrB PE=2 SV=1	25	197	1.0E-08
sp\|O83590\|LOLD_TREPA	Lipoprotein-releasing system ATP-binding protein LolD OS=Treponema pallidum (strain Nichols) GN=lolD PE=3 SV=1	7	192	1.0E-08
sp\|Q8UII7\|UGPC1_AGRFC	sn-glycerol-3-phosphate import ATP-binding protein UgpC 1 OS=Agrobacterium fabrum (strain C58 / ATCC 33970) GN=ugpC1 PE=3 SV=1	13	192	1.0E-08
sp\|Q92DL6\|POTA_LISIN	Spermidine/putrescine import ATP-binding protein PotA OS=Listeria innocua serovar 6a (strain CLIP 11262) GN=potA PE=3 SV=2	13	214	1.0E-08
sp\|Q1RGD0\|THIQ_ECOUT	Thiamine import ATP-binding protein ThiQ OS=Escherichia coli (strain UTI89 / UPEC) GN=thiQ PE=3 SV=2	29	233	1.0E-08
sp\|Q8FL82\|THIQ_ECOL6	Thiamine import ATP-binding protein ThiQ OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=thiQ PE=3 SV=2	29	233	1.0E-08
sp\|Q4UJW5\|ZNUC_RICFE	Zinc import ATP-binding protein ZnuC OS=Rickettsia felis (strain ATCC VR-1525 / URRWXCal2) GN=znuC PE=3 SV=1	25	192	1.0E-08
sp\|P10907\|UGPC_ECOLI	sn-glycerol-3-phosphate import ATP-binding protein UgpC OS=Escherichia coli (strain K12) GN=ugpC PE=1 SV=3	25	192	1.0E-08
sp\|Q722B1\|POTA_LISMF	Spermidine/putrescine import ATP-binding protein PotA OS=Listeria monocytogenes serotype 4b (strain F2365) GN=potA PE=3 SV=2	13	214	1.0E-08
sp\|Q87PH3\|POTA_VIBPA	Spermidine/putrescine import ATP-binding protein PotA OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) GN=potA PE=3 SV=1	7	214	1.0E-08
sp\|Q0TLS2\|THIQ_ECOL5	Thiamine import ATP-binding protein ThiQ OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=thiQ PE=3 SV=1	29	233	1.0E-08
sp\|Q87GB5\|MALK_VIBPA	Maltose/maltodextrin import ATP-binding protein MalK OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) GN=malK PE=3 SV=1	8	192	1.0E-08
sp\|Q31VH5\|UGPC_SHIBS	sn-glycerol-3-phosphate import ATP-binding protein UgpC OS=Shigella boydii serotype 4 (strain Sb227) GN=ugpC PE=3 SV=2	25	192	1.0E-08
sp\|P33916\|YEJF_ECOLI	Uncharacterized ABC transporter ATP-binding protein YejF OS=Escherichia coli (strain K12) GN=yejF PE=3 SV=1	4	223	1.0E-08
sp\|Q8NSN2\|METN_CORGL	Methionine import ATP-binding protein MetN OS=Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / LMG 3730 / NCIMB 10025) GN=metN PE=3 SV=1	22	223	1.0E-08
sp\|P96605\|YDBJ_BACSU	Uncharacterized ABC transporter ATP-binding protein YdbJ OS=Bacillus subtilis (strain 168) GN=ydbJ PE=3 SV=1	25	213	2.0E-08
sp\|Q1MCN6\|UGPC1_RHIL3	sn-glycerol-3-phosphate import ATP-binding protein UgpC 1 OS=Rhizobium leguminosarum bv. viciae (strain 3841) GN=ugpC1 PE=3 SV=1	25	214	2.0E-08
sp\|Q4PH16\|ATM1_USTMA	Iron-sulfur clusters transporter ATM1, mitochondrial OS=Ustilago maydis (strain 521 / FGSC 9021) GN=ATM1 PE=3 SV=1	25	224	2.0E-08
sp\|Q6CYU2\|SSUB_PECAS	Aliphatic sulfonates import ATP-binding protein SsuB OS=Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) GN=ssuB PE=3 SV=1	21	192	2.0E-08
sp\|Q9KS33\|POTA_VIBCH	Spermidine/putrescine import ATP-binding protein PotA OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=potA PE=3 SV=1	7	214	2.0E-08
sp\|A3CRB9\|ECFA1_STRSV	Energy-coupling factor transporter ATP-binding protein EcfA1 OS=Streptococcus sanguinis (strain SK36) GN=ecfA1 PE=3 SV=2	9	198	2.0E-08
sp\|P44871\|FTSE_HAEIN	Cell division ATP-binding protein FtsE OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=ftsE PE=3 SV=1	24	201	2.0E-08
sp\|Q9K789\|METN_BACHD	Methionine import ATP-binding protein MetN OS=Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125) GN=metN PE=3 SV=1	23	214	2.0E-08
sp\|O26236\|Y133_METTH	Putative ABC transporter ATP-binding protein MTH_133 OS=Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H) GN=MTH_133 PE=3 SV=1	13	195	2.0E-08
sp\|P14175\|PROV_ECOLI	Glycine betaine/L-proline transport ATP-binding protein ProV OS=Escherichia coli (strain K12) GN=proV PE=1 SV=1	22	270	2.0E-08
sp\|Q3YW77\|UGPC_SHISS	sn-glycerol-3-phosphate import ATP-binding protein UgpC OS=Shigella sonnei (strain Ss046) GN=ugpC PE=3 SV=2	25	192	2.0E-08
sp\|Q8TI16\|ECFA_METAC	Energy-coupling factor transporter ATP-binding protein EcfA OS=Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A) GN=ecfA PE=3 SV=1	9	197	2.0E-08
sp\|O32151\|YURJ_BACSU	Uncharacterized ABC transporter ATP-binding protein YurJ OS=Bacillus subtilis (strain 168) GN=yurJ PE=3 SV=1	25	214	2.0E-08
sp\|Q92WD6\|UGPC_RHIME	sn-glycerol-3-phosphate import ATP-binding protein UgpC OS=Rhizobium meliloti (strain 1021) GN=ugpC PE=3 SV=1	9	192	2.0E-08
sp\|Q5JEB0\|WTPC_THEKO	Molybdate/tungstate import ATP-binding protein WtpC OS=Thermococcus kodakarensis (strain ATCC BAA-918 / JCM 12380 / KOD1) GN=wtpC PE=3 SV=1	9	196	2.0E-08
sp\|Q65QT6\|MALK_MANSM	Maltose/maltodextrin import ATP-binding protein MalK OS=Mannheimia succiniciproducens (strain MBEL55E) GN=malK PE=3 SV=1	8	192	2.0E-08
sp\|Q66FU4\|UGPC_YERPS	sn-glycerol-3-phosphate import ATP-binding protein UgpC OS=Yersinia pseudotuberculosis serotype I (strain IP32953) GN=ugpC PE=3 SV=1	25	192	2.0E-08
sp\|Q1R5H8\|UGPC_ECOUT	sn-glycerol-3-phosphate import ATP-binding protein UgpC OS=Escherichia coli (strain UTI89 / UPEC) GN=ugpC PE=3 SV=2	25	192	2.0E-08
sp\|A1AGY1\|UGPC_ECOK1	sn-glycerol-3-phosphate import ATP-binding protein UgpC OS=Escherichia coli O1:K1 / APEC GN=ugpC PE=3 SV=1	25	192	2.0E-08
sp\|Q8Y651\|MNTB_LISMO	Manganese transport system ATP-binding protein MntB OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=mntB PE=3 SV=1	22	200	2.0E-08
sp\|Q8K268\|ABCF3_MOUSE	ATP-binding cassette sub-family F member 3 OS=Mus musculus GN=Abcf3 PE=1 SV=1	8	208	2.0E-08
sp\|Q2NSR0\|HMUV_SODGM	Hemin import ATP-binding protein HmuV OS=Sodalis glossinidius (strain morsitans) GN=hmuV PE=3 SV=1	23	237	2.0E-08
sp\|Q50801\|Y583_METTM	Putative ABC transporter ATP-binding protein MTBMA_c05830 OS=Methanothermobacter marburgensis (strain DSM 2133 / 14651 / NBRC 100331 / OCM 82 / Marburg) GN=MTBMA_c05830 PE=3 SV=2	13	195	2.0E-08
sp\|Q8FCQ2\|UGPC_ECOL6	sn-glycerol-3-phosphate import ATP-binding protein UgpC OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=ugpC PE=3 SV=2	25	192	2.0E-08
sp\|Q8UBB7\|UGPC2_AGRFC	sn-glycerol-3-phosphate import ATP-binding protein UgpC 2 OS=Agrobacterium fabrum (strain C58 / ATCC 33970) GN=ugpC2 PE=3 SV=2	25	214	2.0E-08
sp\|Q7MN25\|METN_VIBVY	Methionine import ATP-binding protein MetN OS=Vibrio vulnificus (strain YJ016) GN=metN PE=3 SV=1	11	195	2.0E-08
sp\|Q13TV1\|UGPC_BURXL	sn-glycerol-3-phosphate import ATP-binding protein UgpC OS=Burkholderia xenovorans (strain LB400) GN=ugpC PE=3 SV=1	9	192	2.0E-08
sp\|Q2K4V4\|UGPC2_RHIEC	sn-glycerol-3-phosphate import ATP-binding protein UgpC 2 OS=Rhizobium etli (strain CFN 42 / ATCC 51251) GN=ugpC2 PE=3 SV=1	25	214	2.0E-08
sp\|Q6G1D9\|Y270_BARQU	Putative ABC transporter ATP-binding protein BQ02700 OS=Bartonella quintana (strain Toulouse) GN=BQ02700 PE=3 SV=1	12	215	2.0E-08
sp\|Q6LR20\|POTA_PHOPR	Spermidine/putrescine import ATP-binding protein PotA OS=Photobacterium profundum GN=potA PE=3 SV=1	7	214	2.0E-08
sp\|Q8DFC3\|METN_VIBVU	Methionine import ATP-binding protein MetN OS=Vibrio vulnificus (strain CMCP6) GN=metN PE=3 SV=1	11	195	2.0E-08
sp\|Q2K6L3\|UGPC1_RHIEC	sn-glycerol-3-phosphate import ATP-binding protein UgpC 1 OS=Rhizobium etli (strain CFN 42 / ATCC 51251) GN=ugpC1 PE=3 SV=1	24	214	2.0E-08
sp\|Q0TC10\|UGPC_ECOL5	sn-glycerol-3-phosphate import ATP-binding protein UgpC OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=ugpC PE=3 SV=1	25	192	2.0E-08
sp\|Q1M8R6\|UGPC2_RHIL3	sn-glycerol-3-phosphate import ATP-binding protein UgpC 2 OS=Rhizobium leguminosarum bv. viciae (strain 3841) GN=ugpC2 PE=3 SV=1	23	214	3.0E-08
sp\|Q9KTJ5\|METN_VIBCH	Methionine import ATP-binding protein MetN OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=metN PE=3 SV=1	11	195	3.0E-08
sp\|Q1QTX6\|UGPC_CHRSD	sn-glycerol-3-phosphate import ATP-binding protein UgpC OS=Chromohalobacter salexigens (strain DSM 3043 / ATCC BAA-138 / NCIMB 13768) GN=ugpC PE=3 SV=1	11	215	3.0E-08
sp\|Q92G36\|ZNUC_RICCN	Zinc import ATP-binding protein ZnuC OS=Rickettsia conorii (strain ATCC VR-613 / Malish 7) GN=znuC PE=3 SV=1	25	192	3.0E-08
sp\|Q07LQ4\|SSUB_RHOP5	Aliphatic sulfonates import ATP-binding protein SsuB OS=Rhodopseudomonas palustris (strain BisA53) GN=ssuB PE=3 SV=1	9	192	3.0E-08
sp\|Q30V33\|POTA_DESAG	Spermidine/putrescine import ATP-binding protein PotA OS=Desulfovibrio alaskensis (strain G20) GN=potA PE=3 SV=1	20	214	3.0E-08
sp\|P54933\|SMOK_RHOSH	ATP-binding transport protein SmoK OS=Rhodobacter sphaeroides GN=smoK PE=3 SV=2	8	192	3.0E-08
sp\|Q736E0\|SSUB_BACC1	Aliphatic sulfonates import ATP-binding protein SsuB OS=Bacillus cereus (strain ATCC 10987 / NRS 248) GN=ssuB PE=3 SV=1	25	207	3.0E-08
sp\|Q9K8N1\|PHNC3_BACHD	Phosphonates import ATP-binding protein PhnC 3 OS=Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125) GN=phnC3 PE=3 SV=1	13	212	3.0E-08
sp\|P75355\|Y433_MYCPN	Putative ABC transporter ATP-binding protein MG304 homolog OS=Mycoplasma pneumoniae (strain ATCC 29342 / M129) GN=MPN_433 PE=3 SV=1	11	197	3.0E-08
sp\|Q73XU8\|CYSA_MYCPA	Sulfate/thiosulfate import ATP-binding protein CysA OS=Mycobacterium paratuberculosis (strain ATCC BAA-968 / K-10) GN=cysA PE=3 SV=1	9	192	3.0E-08
sp\|Q3JKX3\|TAUB_BURP1	Taurine import ATP-binding protein TauB OS=Burkholderia pseudomallei (strain 1710b) GN=tauB PE=3 SV=1	23	169	3.0E-08
sp\|Q62AW4\|TAUB_BURMA	Taurine import ATP-binding protein TauB OS=Burkholderia mallei (strain ATCC 23344) GN=tauB PE=3 SV=1	23	169	3.0E-08
sp\|P0A9S0\|FTSE_SHIFL	Cell division ATP-binding protein FtsE OS=Shigella flexneri GN=ftsE PE=3 SV=1	25	192	3.0E-08
sp\|P0A9R7\|FTSE_ECOLI	Cell division ATP-binding protein FtsE OS=Escherichia coli (strain K12) GN=ftsE PE=1 SV=1	25	192	3.0E-08
sp\|P0A9R8\|FTSE_ECOL6	Cell division ATP-binding protein FtsE OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=ftsE PE=3 SV=1	25	192	3.0E-08
sp\|P0A9R9\|FTSE_ECO57	Cell division ATP-binding protein FtsE OS=Escherichia coli O157:H7 GN=ftsE PE=3 SV=1	25	192	3.0E-08
sp\|Q6ME20\|METN_PARUW	Methionine import ATP-binding protein MetN OS=Protochlamydia amoebophila (strain UWE25) GN=metN PE=3 SV=1	12	197	3.0E-08
sp\|Q81P94\|SSUB_BACAN	Aliphatic sulfonates import ATP-binding protein SsuB OS=Bacillus anthracis GN=ssuB PE=3 SV=1	25	207	3.0E-08
sp\|Q92UV5\|FBPC2_RHIME	Fe(3+) ions import ATP-binding protein FbpC 2 OS=Rhizobium meliloti (strain 1021) GN=fbpC2 PE=3 SV=1	25	214	4.0E-08
sp\|P0A9W5\|ETTA_SHIFL	Energy-dependent translational throttle protein EttA OS=Shigella flexneri GN=ettA PE=3 SV=2	11	195	4.0E-08
sp\|P0A9W3\|ETTA_ECOLI	Energy-dependent translational throttle protein EttA OS=Escherichia coli (strain K12) GN=ettA PE=1 SV=2	11	195	4.0E-08
sp\|P0A9W4\|ETTA_ECO57	Energy-dependent translational throttle protein EttA OS=Escherichia coli O157:H7 GN=ettA PE=3 SV=2	11	195	4.0E-08
sp\|Q98HF7\|POTA_RHILO	Spermidine/putrescine import ATP-binding protein PotA OS=Rhizobium loti (strain MAFF303099) GN=potA PE=3 SV=1	27	220	4.0E-08
sp\|Q3JSQ0\|NODI_BURP1	Nod factor export ATP-binding protein I OS=Burkholderia pseudomallei (strain 1710b) GN=nodI PE=3 SV=2	25	196	4.0E-08
sp\|Q62K72\|NODI_BURMA	Nod factor export ATP-binding protein I OS=Burkholderia mallei (strain ATCC 23344) GN=nodI PE=3 SV=2	25	196	4.0E-08
sp\|Q8Y8T6\|POTA_LISMO	Spermidine/putrescine import ATP-binding protein PotA OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=potA PE=3 SV=2	13	214	4.0E-08
sp\|Q5E586\|POTA_VIBF1	Spermidine/putrescine import ATP-binding protein PotA OS=Vibrio fischeri (strain ATCC 700601 / ES114) GN=potA PE=3 SV=1	14	214	4.0E-08
sp\|Q13CI6\|MODC_RHOPS	Molybdenum import ATP-binding protein ModC OS=Rhodopseudomonas palustris (strain BisB5) GN=modC PE=3 SV=1	27	212	4.0E-08
sp\|Q58206\|Y796_METJA	Uncharacterized ABC transporter ATP-binding protein MJ0796 OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=MJ0796 PE=1 SV=1	24	217	4.0E-08
sp\|Q58762\|WTPC_METJA	Molybdate/tungstate import ATP-binding protein WtpC OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=wtpC PE=3 SV=1	11	192	4.0E-08
sp\|Q8U4K3\|WTPC_PYRFU	Molybdate/tungstate import ATP-binding protein WtpC OS=Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1) GN=wtpC PE=3 SV=1	11	192	4.0E-08
sp\|Q63TX3\|NODI_BURPS	Nod factor export ATP-binding protein I OS=Burkholderia pseudomallei (strain K96243) GN=nodI PE=3 SV=2	25	196	4.0E-08
sp\|Q92L31\|THIQ_RHIME	Thiamine import ATP-binding protein ThiQ OS=Rhizobium meliloti (strain 1021) GN=thiQ PE=3 SV=1	32	229	4.0E-08
sp\|Q92W56\|ARAG_RHIME	Arabinose import ATP-binding protein AraG OS=Rhizobium meliloti (strain 1021) GN=araG PE=3 SV=1	12	197	4.0E-08
sp\|P37624\|RBBA_ECOLI	Ribosome-associated ATPase OS=Escherichia coli (strain K12) GN=rbbA PE=1 SV=3	13	251	4.0E-08
sp\|O34392\|YTRE_BACSU	ABC transporter ATP-binding protein YtrE OS=Bacillus subtilis (strain 168) GN=ytrE PE=2 SV=1	25	213	4.0E-08
sp\|Q7VNG4\|POTA_HAEDU	Spermidine/putrescine import ATP-binding protein PotA OS=Haemophilus ducreyi (strain 35000HP / ATCC 700724) GN=potA PE=3 SV=1	9	214	4.0E-08
sp\|Q2KDV1\|PHNC_RHIEC	Phosphonates import ATP-binding protein PhnC OS=Rhizobium etli (strain CFN 42 / ATCC 51251) GN=phnC PE=3 SV=1	28	228	4.0E-08
sp\|P45321\|MODC_HAEIN	Molybdenum import ATP-binding protein ModC OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=modC PE=3 SV=1	29	221	5.0E-08
sp\|Q8T6J2\|ABCA5_DICDI	ABC transporter A family member 5 OS=Dictyostelium discoideum GN=abcA5 PE=3 SV=1	24	171	5.0E-08
sp\|Q39GT7\|NODI_BURL3	Nod factor export ATP-binding protein I OS=Burkholderia lata (strain ATCC 17760 / LMG 22485 / NCIMB 9086 / R18194 / 383) GN=nodI PE=3 SV=2	25	196	5.0E-08
sp\|Q6NJ07\|METN_CORDI	Methionine import ATP-binding protein MetN OS=Corynebacterium diphtheriae (strain ATCC 700971 / NCTC 13129 / Biotype gravis) GN=metN PE=3 SV=1	23	223	5.0E-08
sp\|Q4QMH4\|METN_HAEI8	Methionine import ATP-binding protein MetN OS=Haemophilus influenzae (strain 86-028NP) GN=metN PE=3 SV=1	9	192	5.0E-08
sp\|Q81GC1\|POTA_BACCR	Spermidine/putrescine import ATP-binding protein PotA OS=Bacillus cereus (strain ATCC 14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL B-3711) GN=potA PE=3 SV=1	28	214	5.0E-08
sp\|Q57293\|FBPC_ACTPL	Fe(3+) ions import ATP-binding protein FbpC OS=Actinobacillus pleuropneumoniae GN=fbpC PE=3 SV=1	9	214	5.0E-08
sp\|Q0VQQ0\|LOLD_ALCBS	Lipoprotein-releasing system ATP-binding protein LolD OS=Alcanivorax borkumensis (strain ATCC 700651 / DSM 11573 / NCIMB 13689 / SK2) GN=lolD PE=3 SV=2	25	203	5.0E-08
sp\|A0AGP9\|POTA_LISW6	Spermidine/putrescine import ATP-binding protein PotA OS=Listeria welshimeri serovar 6b (strain ATCC 35897 / DSM 20650 / SLCC5334) GN=potA PE=3 SV=1	13	214	5.0E-08
sp\|Q8YEM5\|CCMA_BRUME	Cytochrome c biogenesis ATP-binding export protein CcmA OS=Brucella melitensis biotype 1 (strain 16M / ATCC 23456 / NCTC 10094) GN=ccmA PE=3 SV=2	23	193	5.0E-08
sp\|Q8PP41\|SSUB1_XANAC	Aliphatic sulfonates import ATP-binding protein SsuB 1 OS=Xanthomonas axonopodis pv. citri (strain 306) GN=ssuB1 PE=3 SV=1	25	196	5.0E-08
sp\|Q6LX68\|ECFA_METMP	Energy-coupling factor transporter ATP-binding protein EcfA OS=Methanococcus maripaludis (strain S2 / LL) GN=ecfA PE=3 SV=1	13	237	5.0E-08
sp\|Q2YKZ7\|Y2993_BRUA2	Putative ATP-binding protein BAB2_0493 OS=Brucella abortus (strain 2308) GN=BAB2_0493 PE=3 SV=1	8	214	5.0E-08
sp\|Q578M5\|Y2787_BRUAB	Putative ATP-binding protein BruAb2_0487 OS=Brucella abortus biovar 1 (strain 9-941) GN=BruAb2_0487 PE=3 SV=1	8	214	5.0E-08
sp\|Q0B6I6\|METN2_BURCM	Methionine import ATP-binding protein MetN 2 OS=Burkholderia ambifaria (strain ATCC BAA-244 / AMMD) GN=metN2 PE=3 SV=1	11	195	5.0E-08
sp\|Q8UB29\|UGPC3_AGRFC	sn-glycerol-3-phosphate import ATP-binding protein UgpC 3 OS=Agrobacterium fabrum (strain C58 / ATCC 33970) GN=ugpC3 PE=3 SV=1	24	215	6.0E-08
sp\|Q8G358\|CCMA_BRUSU	Cytochrome c biogenesis ATP-binding export protein CcmA OS=Brucella suis biovar 1 (strain 1330) GN=ccmA PE=3 SV=1	23	193	6.0E-08
sp\|Q57FS7\|CCMA_BRUAB	Cytochrome c biogenesis ATP-binding export protein CcmA OS=Brucella abortus biovar 1 (strain 9-941) GN=ccmA PE=3 SV=1	23	193	6.0E-08
sp\|Q2YNU0\|CCMA_BRUA2	Cytochrome c biogenesis ATP-binding export protein CcmA OS=Brucella abortus (strain 2308) GN=ccmA PE=3 SV=1	23	193	6.0E-08
sp\|Q8FVT0\|Y3745_BRUSU	Putative ATP-binding protein BRA0745/BS1330_II0738 OS=Brucella suis biovar 1 (strain 1330) GN=BRA0745 PE=3 SV=1	8	214	6.0E-08
sp\|Q87RS1\|METN_VIBPA	Methionine import ATP-binding protein MetN OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) GN=metN PE=1 SV=1	11	192	6.0E-08
sp\|Q7ULB5\|MACB_RHOBA	Macrolide export ATP-binding/permease protein MacB OS=Rhodopirellula baltica (strain DSM 10527 / NCIMB 13988 / SH1) GN=macB PE=3 SV=1	20	236	6.0E-08
sp\|Q97KD5\|METN_CLOAB	Methionine import ATP-binding protein MetN OS=Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / LMG 5710 / VKM B-1787) GN=metN PE=3 SV=1	11	222	7.0E-08
sp\|Q8Z1U0\|MALK_SALTI	Maltose/maltodextrin import ATP-binding protein MalK OS=Salmonella typhi GN=malK PE=3 SV=1	26	192	7.0E-08
sp\|Q3A558\|LOLD_PELCD	Lipoprotein-releasing system ATP-binding protein LolD OS=Pelobacter carbinolicus (strain DSM 2380 / Gra Bd 1) GN=lolD PE=3 SV=1	9	212	7.0E-08
sp\|Q39CJ6\|TAUB_BURL3	Taurine import ATP-binding protein TauB OS=Burkholderia lata (strain ATCC 17760 / LMG 22485 / NCIMB 9086 / R18194 / 383) GN=tauB PE=3 SV=1	11	250	7.0E-08
sp\|Q4ZLS1\|SSUB3_PSEU2	Aliphatic sulfonates import ATP-binding protein SsuB 3 OS=Pseudomonas syringae pv. syringae (strain B728a) GN=ssuB3 PE=3 SV=1	25	192	7.0E-08
sp\|P19566\|MALK_SALTY	Maltose/maltodextrin import ATP-binding protein MalK OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=malK PE=1 SV=3	26	192	7.0E-08
sp\|Q57GZ7\|MALK_SALCH	Maltose/maltodextrin import ATP-binding protein MalK OS=Salmonella choleraesuis (strain SC-B67) GN=malK PE=3 SV=1	26	192	7.0E-08
sp\|P77481\|YCJV_ECOLI	Putative uncharacterized ABC transporter ATP-binding protein YcjV OS=Escherichia coli (strain K12) GN=ycjV PE=5 SV=2	25	214	7.0E-08
sp\|Q5LT05\|POTA_RUEPO	Spermidine/putrescine import ATP-binding protein PotA OS=Ruegeria pomeroyi (strain ATCC 700808 / DSM 15171 / DSS-3) GN=potA PE=3 SV=1	28	276	7.0E-08
sp\|Q8CF82\|ABCA5_RAT	ATP-binding cassette sub-family A member 5 OS=Rattus norvegicus GN=Abca5 PE=2 SV=1	24	195	8.0E-08
sp\|Q7VV72\|METN_BORPE	Methionine import ATP-binding protein MetN OS=Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251) GN=metN PE=3 SV=1	11	249	8.0E-08
sp\|Q7W4E1\|METN_BORPA	Methionine import ATP-binding protein MetN OS=Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253) GN=metN PE=3 SV=1	11	249	8.0E-08
sp\|Q7WFU9\|METN_BORBR	Methionine import ATP-binding protein MetN OS=Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50) GN=metN PE=3 SV=1	11	249	8.0E-08
sp\|Q03PF2\|POTA_LACBA	Spermidine/putrescine import ATP-binding protein PotA OS=Lactobacillus brevis (strain ATCC 367 / JCM 1170) GN=potA PE=3 SV=1	5	212	8.0E-08
sp\|P36638\|SAPF_SALTY	Peptide transport system ATP-binding protein SapF OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=sapF PE=3 SV=1	11	235	8.0E-08
sp\|Q1BWI2\|NODI_BURCA	Nod factor export ATP-binding protein I OS=Burkholderia cenocepacia (strain AU 1054) GN=nodI PE=3 SV=1	25	196	8.0E-08
sp\|Q8X8K4\|YCJV_ECO57	Uncharacterized ABC transporter ATP-binding protein YcjV OS=Escherichia coli O157:H7 GN=ycjV PE=3 SV=1	25	214	8.0E-08
sp\|Q32JQ8\|METN_SHIDS	Methionine import ATP-binding protein MetN OS=Shigella dysenteriae serotype 1 (strain Sd197) GN=metN PE=3 SV=1	9	223	9.0E-08
sp\|Q8TK65\|Y3551_METAC	Putative ABC transporter ATP-binding protein MA_3551 OS=Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A) GN=MA_3551 PE=3 SV=1	14	207	9.0E-08
sp\|Q5KYQ7\|RGMG_GEOKA	Putative ribose/galactose/methyl galactoside import ATP-binding protein OS=Geobacillus kaustophilus (strain HTA426) GN=GK1894 PE=3 SV=1	13	197	9.0E-08
sp\|Q8H1R4\|AB10I_ARATH	ABC transporter I family member 10, chloroplastic OS=Arabidopsis thaliana GN=ABCI10 PE=2 SV=1	25	212	9.0E-08
sp\|Q8TYV9\|Y182_METKA	Putative ABC transporter ATP-binding protein MK0182 OS=Methanopyrus kandleri (strain AV19 / DSM 6324 / JCM 9639 / NBRC 100938) GN=MK0182 PE=3 SV=1	14	226	9.0E-08
sp\|Q73P93\|Y906_TREDE	Putative ABC transporter ATP-binding protein TDE_0906 OS=Treponema denticola (strain ATCC 35405 / CIP 103919 / DSM 14222) GN=TDE_0906 PE=3 SV=1	9	236	9.0E-08
sp\|Q6XYZ4\|ECFA1_SPIKU	Energy-coupling factor transporter ATP-binding protein EcfA1 OS=Spiroplasma kunkelii GN=ecfA1 PE=3 SV=1	20	197	9.0E-08
sp\|Q8TQW9\|Y1418_METAC	Putative ABC transporter ATP-binding protein MA_1418 OS=Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A) GN=MA_1418 PE=3 SV=1	7	223	1.0E-07
sp\|Q88ZZ2\|Y149_LACPL	Putative ABC transporter ATP-binding protein lp_0149 OS=Lactobacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1) GN=lp_0149 PE=3 SV=1	7	192	1.0E-07
sp\|Q88ZZ2\|Y149_LACPL	Putative ABC transporter ATP-binding protein lp_0149 OS=Lactobacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1) GN=lp_0149 PE=3 SV=1	5	222	1.0E-07
sp\|Q08972\|NEW1_YEAST	[NU+] prion formation protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=NEW1 PE=1 SV=1	25	206	1.0E-07
sp\|Q160M2\|POTA_ROSDO	Spermidine/putrescine import ATP-binding protein PotA OS=Roseobacter denitrificans (strain ATCC 33942 / OCh 114) GN=potA PE=3 SV=1	7	218	1.0E-07
sp\|A1TAI4\|POTA_MYCVP	Spermidine/putrescine import ATP-binding protein PotA OS=Mycobacterium vanbaalenii (strain DSM 7251 / PYR-1) GN=potA PE=3 SV=1	9	214	1.0E-07
sp\|Q1MQ44\|POTA_LAWIP	Spermidine/putrescine import ATP-binding protein PotA OS=Lawsonia intracellularis (strain PHE/MN1-00) GN=potA PE=3 SV=1	9	214	1.0E-07
sp\|Q8FHR3\|YCJV_ECOL6	Uncharacterized ABC transporter ATP-binding protein YcjV OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=ycjV PE=3 SV=1	25	214	1.0E-07
sp\|Q65UE1\|POTA_MANSM	Spermidine/putrescine import ATP-binding protein PotA OS=Mannheimia succiniciproducens (strain MBEL55E) GN=potA PE=3 SV=1	5	214	1.0E-07
sp\|Q0SBZ1\|FBPC1_RHOJR	Fe(3+) ions import ATP-binding protein FbpC 1 OS=Rhodococcus jostii (strain RHA1) GN=fbpC1 PE=3 SV=1	22	192	1.0E-07
sp\|Q7N0N3\|Y3849_PHOLL	Putative ABC transporter ATP-binding protein plu3849 OS=Photorhabdus luminescens subsp. laumondii (strain TT01) GN=plu3849 PE=3 SV=1	11	206	1.0E-07
sp\|Q0TI47\|YCJV_ECOL5	Uncharacterized ABC transporter ATP-binding protein YcjV OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=ycjV PE=3 SV=2	25	214	1.0E-07
sp\|Q6MMY0\|LOLD_BDEBA	Lipoprotein-releasing system ATP-binding protein LolD OS=Bdellovibrio bacteriovorus (strain ATCC 15356 / DSM 50701 / NCIB 9529 / HD100) GN=lolD PE=3 SV=1	21	201	1.0E-07
sp\|Q24XJ2\|POTA_DESHY	Spermidine/putrescine import ATP-binding protein PotA OS=Desulfitobacterium hafniense (strain Y51) GN=potA PE=3 SV=2	27	214	1.0E-07
sp\|Q5R9Z5\|ABCF3_PONAB	ATP-binding cassette sub-family F member 3 OS=Pongo abelii GN=ABCF3 PE=2 SV=1	8	208	1.0E-07
sp\|Q1GID1\|UGPC_RUEST	sn-glycerol-3-phosphate import ATP-binding protein UgpC OS=Ruegeria sp. (strain TM1040) GN=ugpC PE=3 SV=1	8	192	1.0E-07
sp\|Q1B8V9\|POTA_MYCSS	Spermidine/putrescine import ATP-binding protein PotA OS=Mycobacterium sp. (strain MCS) GN=potA PE=3 SV=1	5	214	1.0E-07
sp\|A1UG51\|POTA_MYCSK	Spermidine/putrescine import ATP-binding protein PotA OS=Mycobacterium sp. (strain KMS) GN=potA PE=3 SV=1	5	214	1.0E-07
sp\|Q63E84\|POTA_BACCZ	Spermidine/putrescine import ATP-binding protein PotA OS=Bacillus cereus (strain ZK / E33L) GN=potA PE=3 SV=2	28	214	1.0E-07
sp\|Q73BM0\|POTA_BACC1	Spermidine/putrescine import ATP-binding protein PotA OS=Bacillus cereus (strain ATCC 10987 / NRS 248) GN=potA PE=3 SV=1	28	214	1.0E-07
sp\|A0RBB0\|POTA_BACAH	Spermidine/putrescine import ATP-binding protein PotA OS=Bacillus thuringiensis (strain Al Hakam) GN=potA PE=3 SV=1	28	214	1.0E-07
sp\|P16679\|PHNL_ECOLI	Alpha-D-ribose 1-methylphosphonate 5-triphosphate synthase subunit PhnL OS=Escherichia coli (strain K12) GN=phnL PE=1 SV=1	11	192	1.0E-07
sp\|Q8ELQ6\|METN3_OCEIH	Methionine import ATP-binding protein MetN 3 OS=Oceanobacillus iheyensis (strain DSM 14371 / JCM 11309 / KCTC 3954 / HTE831) GN=metN3 PE=3 SV=1	25	214	1.0E-07
sp\|Q1R0Z6\|PHNC_CHRSD	Phosphonates import ATP-binding protein PhnC OS=Chromohalobacter salexigens (strain DSM 3043 / ATCC BAA-138 / NCIMB 13768) GN=phnC PE=3 SV=1	11	212	1.0E-07
sp\|Q9CP06\|POTA_PASMU	Spermidine/putrescine import ATP-binding protein PotA OS=Pasteurella multocida (strain Pm70) GN=potA PE=3 SV=2	2	192	1.0E-07
sp\|Q9CGD4\|POTA_LACLA	Spermidine/putrescine import ATP-binding protein PotA OS=Lactococcus lactis subsp. lactis (strain IL1403) GN=potA PE=3 SV=1	9	192	1.0E-07
sp\|Q6D734\|FBPC1_PECAS	Fe(3+) ions import ATP-binding protein FbpC 1 OS=Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) GN=fbpC1 PE=3 SV=1	22	192	1.0E-07
sp\|Q24QI5\|METN_DESHY	Methionine import ATP-binding protein MetN OS=Desulfitobacterium hafniense (strain Y51) GN=metN PE=3 SV=1	11	230	1.0E-07
sp\|Q56927\|FBPC_YEREN	Fe(3+) ions import ATP-binding protein FbpC OS=Yersinia enterocolitica GN=fbpC PE=3 SV=1	25	170	1.0E-07
sp\|Q6HLQ9\|POTA_BACHK	Spermidine/putrescine import ATP-binding protein PotA OS=Bacillus thuringiensis subsp. konkukian (strain 97-27) GN=potA PE=3 SV=2	28	214	1.0E-07
sp\|P21410\|FBPC_SERMA	Fe(3+) ions import ATP-binding protein FbpC OS=Serratia marcescens GN=fbpC PE=3 SV=1	25	165	1.0E-07
sp\|Q1CDR0\|SSUB_YERPN	Aliphatic sulfonates import ATP-binding protein SsuB OS=Yersinia pestis bv. Antiqua (strain Nepal516) GN=ssuB PE=3 SV=1	23	192	1.0E-07
sp\|Q74PI5\|SSUB_YERPE	Aliphatic sulfonates import ATP-binding protein SsuB OS=Yersinia pestis GN=ssuB PE=3 SV=1	23	192	1.0E-07
sp\|Q1C1S0\|SSUB_YERPA	Aliphatic sulfonates import ATP-binding protein SsuB OS=Yersinia pestis bv. Antiqua (strain Antiqua) GN=ssuB PE=3 SV=1	23	192	1.0E-07
sp\|Q2S3A3\|LOLD_SALRD	Lipoprotein-releasing system ATP-binding protein LolD OS=Salinibacter ruber (strain DSM 13855 / M31) GN=lolD PE=3 SV=1	23	217	1.0E-07
sp\|Q1LJ08\|PHNC2_CUPMC	Phosphonates import ATP-binding protein PhnC 2 OS=Cupriavidus metallidurans (strain ATCC 43123 / DSM 2839 / NBRC 102507 / CH34) GN=phnC2 PE=3 SV=1	11	221	1.0E-07
sp\|Q98G42\|UGPC_RHILO	sn-glycerol-3-phosphate import ATP-binding protein UgpC OS=Rhizobium loti (strain MAFF303099) GN=ugpC PE=3 SV=1	25	214	1.0E-07
sp\|Q02Z10\|POTA_LACLS	Spermidine/putrescine import ATP-binding protein PotA OS=Lactococcus lactis subsp. cremoris (strain SK11) GN=potA PE=3 SV=1	9	192	1.0E-07
sp\|Q2T751\|TAUB_BURTA	Taurine import ATP-binding protein TauB OS=Burkholderia thailandensis (strain E264 / ATCC 700388 / DSM 13276 / CIP 106301) GN=tauB PE=3 SV=1	23	247	1.0E-07
sp\|P47288\|POTA_MYCGE	Spermidine/putrescine import ATP-binding protein PotA OS=Mycoplasma genitalium (strain ATCC 33530 / G-37 / NCTC 10195) GN=potA PE=3 SV=2	9	72	1.0E-07
sp\|Q6D664\|LOLD_PECAS	Lipoprotein-releasing system ATP-binding protein LolD OS=Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) GN=lolD PE=3 SV=1	11	214	1.0E-07
sp\|Q5L3Q9\|ECFA2_GEOKA	Energy-coupling factor transporter ATP-binding protein EcfA2 OS=Geobacillus kaustophilus (strain HTA426) GN=ecfA2 PE=3 SV=1	8	230	1.0E-07
sp\|Q13VD7\|METN1_BURXL	Methionine import ATP-binding protein MetN 1 OS=Burkholderia xenovorans (strain LB400) GN=metN1 PE=3 SV=1	9	195	1.0E-07
sp\|Q9KN37\|RBSA_VIBCH	Ribose import ATP-binding protein RbsA OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=rbsA PE=3 SV=1	23	232	1.0E-07
sp\|P77795\|YDCT_ECOLI	Uncharacterized ABC transporter ATP-binding protein YdcT OS=Escherichia coli (strain K12) GN=ydcT PE=3 SV=1	9	192	1.0E-07
sp\|Q6G4Q8\|Y276_BARHE	Putative ABC transporter ATP-binding protein BH02760 OS=Bartonella henselae (strain ATCC 49882 / DSM 28221 / Houston 1) GN=BH02760 PE=3 SV=1	25	215	1.0E-07
sp\|Q74LQ3\|PHNC_LACJO	Phosphonates import ATP-binding protein PhnC OS=Lactobacillus johnsonii (strain CNCM I-12250 / La1 / NCC 533) GN=phnC PE=3 SV=2	9	239	1.0E-07
sp\|P40790\|POTA_SALTY	Spermidine/putrescine import ATP-binding protein PotA OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=potA PE=3 SV=2	7	214	1.0E-07
sp\|Q57QC8\|POTA_SALCH	Spermidine/putrescine import ATP-binding protein PotA OS=Salmonella choleraesuis (strain SC-B67) GN=potA PE=3 SV=1	7	214	1.0E-07
sp\|P18767\|NDVA_RHIME	Beta-(1-->2)glucan export ATP-binding/permease protein NdvA OS=Rhizobium meliloti (strain 1021) GN=ndvA PE=1 SV=2	8	171	1.0E-07
sp\|Q5PMK1\|POTA_SALPA	Spermidine/putrescine import ATP-binding protein PotA OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=potA PE=3 SV=1	7	214	1.0E-07
sp\|Q2K3Y7\|ARAG_RHIEC	Arabinose import ATP-binding protein AraG OS=Rhizobium etli (strain CFN 42 / ATCC 51251) GN=araG PE=3 SV=1	12	197	1.0E-07
sp\|Q6D2F6\|FBPC2_PECAS	Fe(3+) ions import ATP-binding protein FbpC 2 OS=Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) GN=fbpC2 PE=3 SV=1	23	165	2.0E-07
sp\|P45052\|OPPD_HAEIN	Oligopeptide transport ATP-binding protein OppD OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=oppD PE=3 SV=1	7	227	2.0E-07
sp\|Q02ME3\|METN1_PSEAB	Methionine import ATP-binding protein MetN 1 OS=Pseudomonas aeruginosa (strain UCBPP-PA14) GN=metN1 PE=3 SV=1	5	232	2.0E-07
sp\|Q9HT70\|METN2_PSEAE	Methionine import ATP-binding protein MetN 2 OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=metN2 PE=3 SV=1	30	222	2.0E-07
sp\|Q02DK6\|METN2_PSEAB	Methionine import ATP-binding protein MetN 2 OS=Pseudomonas aeruginosa (strain UCBPP-PA14) GN=metN2 PE=3 SV=1	30	222	2.0E-07
sp\|Q8FB37\|MALK_ECOL6	Maltose/maltodextrin import ATP-binding protein MalK OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=malK PE=3 SV=2	26	192	2.0E-07
sp\|Q3YUV0\|MALK_SHISS	Maltose/maltodextrin import ATP-binding protein MalK OS=Shigella sonnei (strain Ss046) GN=malK PE=3 SV=1	26	192	2.0E-07
sp\|Q1R3Q1\|MALK_ECOUT	Maltose/maltodextrin import ATP-binding protein MalK OS=Escherichia coli (strain UTI89 / UPEC) GN=malK PE=1 SV=2	26	192	2.0E-07
sp\|P68187\|MALK_ECOLI	Maltose/maltodextrin import ATP-binding protein MalK OS=Escherichia coli (strain K12) GN=malK PE=1 SV=1	26	192	2.0E-07
sp\|P68188\|MALK_ECO57	Maltose/maltodextrin import ATP-binding protein MalK OS=Escherichia coli O157:H7 GN=malK PE=3 SV=1	26	192	2.0E-07
sp\|Q6N9W0\|METN1_RHOPA	Methionine import ATP-binding protein MetN 1 OS=Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009) GN=metN1 PE=3 SV=1	27	192	2.0E-07
sp\|Q9KN37\|RBSA_VIBCH	Ribose import ATP-binding protein RbsA OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=rbsA PE=3 SV=1	9	197	9.0E-07
sp\|P34358\|CED7_CAEEL	ABC transporter ced-7 OS=Caenorhabditis elegans GN=ced-7 PE=1 SV=6	9	212	5.0E-06
sp\|P33916\|YEJF_ECOLI	Uncharacterized ABC transporter ATP-binding protein YejF OS=Escherichia coli (strain K12) GN=yejF PE=3 SV=1	9	227	9.0E-06

[Show less]

GO

GO Term	Description	Terminal node
GO:0005524	ATP binding	Yes
GO:0017076	purine nucleotide binding	No
GO:0035639	purine ribonucleoside triphosphate binding	No
GO:0000166	nucleotide binding	No
GO:0043167	ion binding	No
GO:0097159	organic cyclic compound binding	No
GO:1901265	nucleoside phosphate binding	No
GO:0030554	adenyl nucleotide binding	No
GO:0032555	purine ribonucleotide binding	No
GO:1901363	heterocyclic compound binding	No
GO:0032553	ribonucleotide binding	No
GO:0043168	anion binding	No
GO:0036094	small molecule binding	No
GO:0032559	adenyl ribonucleotide binding	No
GO:0005488	binding	No
GO:0003674	molecular_function	No
GO:0097367	carbohydrate derivative binding	No

SignalP

[Help with interpreting these statistics]

SignalP signal predicted	Location (based on Ymax)	D score (significance: > 0.45)
No	1 - 25	0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequence	Sequence
Locus	Download genbank file of locus The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein	>OphauB2\|3385 MAAPSPPNVVVNNLSYTFPDYSTGIRNVSLNLPSGSRTLLIGANGAGKTTLLRLLAGKRLAPRGSLSVCGVDPFT HALEGVTYLGLEWVLNPVVRTDMAVHVLLASVGGDAYPARRDELVAMLDVDTRWRMHAVSDGERRRVQLAMGLVR PWTVLLLDEVTVDLDVLSRSRFLAWLKRETETRQCTIVYATHILDNLAGWPTHLVHMHLGAVKEWDEADKMLSAV DHSAAHSGNSRLGELVLSWLEQDLAQRGPRSQTNLGSEGKTYGFGSTNVGGYGDESKQHEV*
Coding	>OphauB2\|3385 ATGGCTGCGCCCAGCCCTCCCAACGTGGTGGTCAATAATCTCTCCTACACCTTCCCCGACTACTCAACAGGCATC CGCAACGTCTCGCTCAATCTGCCTTCAGGCTCGCGCACTCTGCTCATTGGCGCCAACGGAGCCGGCAAGACGACG CTGCTGCGCCTCCTCGCTGGCAAACGACTGGCTCCGCGCGGCTCGCTCTCAGTCTGCGGCGTCGACCCCTTTACC CATGCGCTCGAGGGAGTCACCTATCTGGGCCTTGAATGGGTCCTCAACCCCGTCGTCCGTACCGACATGGCGGTC CATGTCTTGCTTGCCTCGGTTGGCGGCGATGCATATCCCGCTCGCCGTGACGAGCTCGTGGCAATGCTCGACGTC GACACTCGATGGCGCATGCACGCCGTCTCTGATGGCGAACGCCGTCGCGTCCAGCTGGCAATGGGTCTTGTTCGT CCCTGGACTGTTTTGCTGCTCGATGAGGTGACGGTCGACCTTGATGTTCTCAGTCGCTCCCGCTTCCTTGCCTGG CTCAAACGCGAGACAGAGACGCGCCAATGCACCATTGTCTATGCCACTCACATTCTTGACAACCTTGCTGGCTGG CCCACACACCTGGTCCACATGCATCTCGGCGCTGTCAAGGAATGGGACGAGGCAGACAAGATGCTTAGTGCCGTC GACCACTCGGCCGCTCATTCGGGAAACAGCCGCCTTGGAGAACTCGTCCTCAGCTGGCTGGAGCAGGACCTTGCT CAGAGAGGGCCGCGAAGCCAGACGAACCTTGGCTCAGAAGGCAAGACATATGGCTTTGGAAGTACCAATGTAGGT GGTTATGGCGACGAGTCGAAGCAACATGAGGTGTAA
Transcript	>OphauB2\|3385 ATGGCTGCGCCCAGCCCTCCCAACGTGGTGGTCAATAATCTCTCCTACACCTTCCCCGACTACTCAACAGGCATC CGCAACGTCTCGCTCAATCTGCCTTCAGGCTCGCGCACTCTGCTCATTGGCGCCAACGGAGCCGGCAAGACGACG CTGCTGCGCCTCCTCGCTGGCAAACGACTGGCTCCGCGCGGCTCGCTCTCAGTCTGCGGCGTCGACCCCTTTACC CATGCGCTCGAGGGAGTCACCTATCTGGGCCTTGAATGGGTCCTCAACCCCGTCGTCCGTACCGACATGGCGGTC CATGTCTTGCTTGCCTCGGTTGGCGGCGATGCATATCCCGCTCGCCGTGACGAGCTCGTGGCAATGCTCGACGTC GACACTCGATGGCGCATGCACGCCGTCTCTGATGGCGAACGCCGTCGCGTCCAGCTGGCAATGGGTCTTGTTCGT CCCTGGACTGTTTTGCTGCTCGATGAGGTGACGGTCGACCTTGATGTTCTCAGTCGCTCCCGCTTCCTTGCCTGG CTCAAACGCGAGACAGAGACGCGCCAATGCACCATTGTCTATGCCACTCACATTCTTGACAACCTTGCTGGCTGG CCCACACACCTGGTCCACATGCATCTCGGCGCTGTCAAGGAATGGGACGAGGCAGACAAGATGCTTAGTGCCGTC GACCACTCGGCCGCTCATTCGGGAAACAGCCGCCTTGGAGAACTCGTCCTCAGCTGGCTGGAGCAGGACCTTGCT CAGAGAGGGCCGCGAAGCCAGACGAACCTTGGCTCAGAAGGCAAGACATATGGCTTTGGAAGTACCAATGTAGGT GGTTATGGCGACGAGTCGAAGCAACATGAGGTGTAA
Gene	>OphauB2\|3385 ATGGCTGCGCCCAGCCCTCCCAACGTGGTGGTCAATAATCTCTCCTACACCTTCCCCGACTACTCAACAGGCATC CGCAACGTCTCGCTCAATCTGCCTTCAGGCTCGCGCACTCTGCTCATTGGCGCCAACGGAGCCGGCAAGACGACG CTGCTGCGCCTCCTCGCTGGCAAACGACTGGCTCCGCGCGGCTCGCTCTCAGTCTGCGGCGTCGACCCCTTTACC CATGCGCTCGAGGGAGTCACCTATCTGGGCCTTGAATGGGTCCTCAACCCCGTCGTCCGTACCGACATGGCGGTC CATGTCTTGCTTGCCTCGGTTGGCGGCGATGCATATCCCGCTCGCCGTGACGAGCTCGTGGCAATGCTCGACGTC GACACTCGATGGCGCATGCACGCCGTCTCTGATGGCGAACGCCGTCGCGTCCAGCTGGCAATGGGTCTTGTTCGT CCCTGGACTGTTTTGCTGCTCGATGAGGTGACGGTCGACCTTGATGTTCTCAGTCGCTCCCGCTTCCTTGCCTGG CTCAAACGCGAGACAGAGACGCGCCAATGCACCATTGTCTATGCCACTCACATTCTTGACAACCTTGCTGGCTGG CCCACACACCTGGTCCACATGCATCTCGGCGCTGTCAAGGAATGGGACGAGGCAGACAAGATGCTTAGTGCCGTC GACCACTCGGCCGCTCATTCGGGAAACAGCCGCCTTGGAGAACTCGTCCTCAGCTGGCTGGAGCAGGACCTTGCT CAGAGAGGGCCGCGAAGCCAGACGAACCTTGGCTCAGAAGGCAAGACATATGGCTTTGGAAGTACCAATGTAGGT GGTTATGGCGACGAGTCGAAGCAACATGAGGTGTAA

Fungal Genomics

General Properties

PFAM Domains

Swissprot hits

GO

SignalP

Transmembrane Domains

Transcription Factor Class

Expression data

Sequences