Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|3381
Gene name
LocationContig_215:19395..21737
Strand-
Gene length (bp)2342
Transcript length (bp)2199
Coding sequence length (bp)2199
Protein length (aa) 733

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00582 Usp Universal stress protein family 1.2E-20 483 698

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|P87132|YFK5_SCHPO Uncharacterized protein C167.05 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC167.05 PE=1 SV=2 609 704 6.0E-27
sp|P87132|YFK5_SCHPO Uncharacterized protein C167.05 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC167.05 PE=1 SV=2 408 520 2.0E-12

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup1230
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|2145
Ophiocordyceps australis map64 (Brazil) OphauB2|3381 (this protein)
Ophiocordyceps camponoti-floridani Ophcf2|01215
Ophiocordyceps camponoti-rufipedis Ophun1|6644
Ophiocordyceps kimflemingae Ophio5|7229
Ophiocordyceps subramaniannii Hirsu2|10405

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|3381
MSGDSRPMSIDAMLDMERQEVLALLENNGQTGASADGLRSSSPFAAPRSPVRSLLDIEEEGPSNTRTAPVVQAPV
RSMLDIDGPVSATHPPVRSMLNLDSPPSPTPLSLHRTTSPVSPGFRPSDLYGSHNTRSMSDAGLKPIEFGPRAGS
RKDRTSEYQFSGILPHSSGVPKRAPPPSKILHSTASYSDELRSPGLTSLQLPGDRGRRAAPGGRLGAQSKSPHNR
WEARSRSPATLSPRLPPNKAMLGDGRILDINSAYRRLSDANLAFSSGSLAQLPMRKRSEENGQGRLFKDYLGPDG
EHLDSSEEEDQYTSDDEDRGRKMVPRNLDAHGQHKATKSRSRSRSGHEERQSLSLLAAAEQERHQVASQREPQAA
MQQPVYQYRSLIPDLEIKITNSSGDTVKPSKGAIHPNTSYDQSPSGAPSMVDSDDEADMDDIKRAQKLSFSMTNI
ISHPESHRSIRIIYRGEYNKIVQQAEEDHHRLRKYLVATDLSDESTHALEWAIGTLLRDGDTLIAIYCVDEETGI
AMGDSGGGAVPDDPKAMREQAAVINTMANSRSAPAPANAINALTEAKRASELKRPSALHLRSESGGTPGTSPAPH
NGRGDRAGRAEEERNRAIQSMTERILRLLRKTRLQVRVIAEVLQCKNPRHLITEVIDLVDPTLVVIGSRGRSALK
GVILGSFSNYLVTKSSVPVMVARKRLRKHTNFKRTPVPQVNNLNNPAARSLANAKVD*
Coding >OphauB2|3381
ATGTCGGGGGATTCTCGACCCATGAGCATCGATGCCATGCTTGACATGGAGCGCCAGGAGGTTTTGGCCTTGCTC
GAGAATAACGGTCAGACAGGCGCCTCGGCGGATGGCCTACGATCCTCATCGCCCTTTGCTGCTCCCCGCTCGCCC
GTGCGAAGCCTGCTTGACATCGAGGAAGAGGGCCCTAGCAACACGCGCACCGCCCCTGTGGTGCAGGCTCCCGTT
CGGAGCATGCTCGACATTGATGGTCCTGTTTCGGCCACGCACCCTCCGGTCCGCAGCATGCTCAATCTCGACTCA
CCACCATCCCCAACGCCCTTGTCTCTTCATCGAACCACCAGCCCCGTCTCGCCCGGATTCCGCCCTAGTGACCTC
TACGGCTCCCACAATACGCGAAGCATGTCTGACGCTGGTCTCAAGCCCATCGAGTTTGGACCTCGTGCTGGCAGC
CGCAAAGATCGTACTTCCGAGTATCAATTCTCTGGCATCTTGCCGCACAGCTCGGGTGTCCCCAAAAGGGCCCCG
CCTCCTTCCAAGATTCTTCATTCCACTGCCTCGTATAGTGACGAATTGAGAAGCCCTGGCTTGACAAGCCTACAG
CTTCCTGGTGATAGGGGCCGACGCGCTGCTCCTGGCGGACGCCTAGGTGCTCAATCCAAATCCCCTCATAATCGA
TGGGAAGCTCGCTCGCGTTCACCCGCCACTCTGTCGCCCCGCCTGCCGCCAAACAAGGCCATGCTTGGCGACGGC
CGCATACTCGACATCAACAGCGCCTACCGCCGCCTCTCGGATGCCAATCTTGCCTTTTCTAGTGGAAGTCTGGCC
CAGTTGCCTATGCGCAAGCGATCTGAAGAGAATGGCCAAGGAAGGCTATTCAAGGACTACCTCGGTCCCGACGGC
GAACATCTCGACTCTAGCGAAGAAGAAGATCAGTATACGTCGGACGACGAGGACCGTGGCCGTAAAATGGTCCCT
CGGAACCTGGATGCTCATGGTCAACACAAAGCCACCAAAAGCAGATCACGTTCCCGCTCGGGTCATGAAGAACGA
CAGAGCTTGAGCTTGCTGGCTGCAGCTGAGCAAGAACGTCACCAAGTGGCTTCTCAAAGAGAGCCACAAGCGGCG
ATGCAGCAGCCAGTCTACCAGTATAGATCCCTGATCCCCGACCTCGAAATCAAAATTACAAATTCATCGGGCGAT
ACCGTCAAGCCTTCCAAGGGGGCGATTCATCCCAATACAAGTTATGATCAAAGCCCCTCTGGAGCACCGTCAATG
GTTGACTCGGACGACGAGGCCGACATGGACGACATCAAGAGGGCGCAAAAGCTGTCATTCTCCATGACCAATATT
ATATCCCACCCAGAGTCTCATCGATCGATCCGCATTATTTACCGAGGCGAATACAATAAGATTGTACAGCAGGCA
GAAGAGGACCATCACAGGCTGCGCAAGTACCTGGTGGCTACTGACCTAAGTGATGAATCGACTCACGCTCTGGAG
TGGGCGATTGGAACGCTACTGCGAGACGGAGACACGTTAATTGCTATATACTGCGTGGATGAGGAGACTGGCATT
GCCATGGGCGACAGTGGGGGAGGAGCGGTGCCTGATGACCCCAAGGCGATGCGAGAGCAAGCAGCAGTTATTAAC
ACCATGGCCAACTCTCGGTCGGCACCGGCTCCAGCCAATGCCATTAACGCCTTGACAGAGGCGAAGCGTGCGTCG
GAGCTGAAGCGACCATCAGCGCTACATTTGCGCAGCGAGTCGGGCGGGACGCCGGGGACGTCGCCGGCACCACAC
AATGGCCGCGGAGATCGCGCGGGGCGTGCCGAAGAGGAGCGCAACCGGGCCATTCAGAGCATGACGGAGCGAATT
TTACGGCTACTGCGCAAGACGAGGTTGCAAGTGCGCGTGATTGCCGAAGTGCTGCAATGCAAGAACCCACGACAC
CTCATCACCGAAGTCATTGACCTTGTGGACCCTACCTTGGTGGTCATAGGAAGCCGCGGACGTAGTGCGCTCAAG
GGGGTCATTCTTGGTTCATTCTCCAACTACCTTGTTACCAAGAGCTCAGTTCCTGTTATGGTGGCCAGGAAGAGA
CTGCGCAAGCATACCAATTTCAAGCGGACGCCGGTACCACAAGTCAATAATCTCAACAATCCGGCTGCACGGAGT
TTGGCCAATGCCAAGGTGGATTGA
Transcript >OphauB2|3381
ATGTCGGGGGATTCTCGACCCATGAGCATCGATGCCATGCTTGACATGGAGCGCCAGGAGGTTTTGGCCTTGCTC
GAGAATAACGGTCAGACAGGCGCCTCGGCGGATGGCCTACGATCCTCATCGCCCTTTGCTGCTCCCCGCTCGCCC
GTGCGAAGCCTGCTTGACATCGAGGAAGAGGGCCCTAGCAACACGCGCACCGCCCCTGTGGTGCAGGCTCCCGTT
CGGAGCATGCTCGACATTGATGGTCCTGTTTCGGCCACGCACCCTCCGGTCCGCAGCATGCTCAATCTCGACTCA
CCACCATCCCCAACGCCCTTGTCTCTTCATCGAACCACCAGCCCCGTCTCGCCCGGATTCCGCCCTAGTGACCTC
TACGGCTCCCACAATACGCGAAGCATGTCTGACGCTGGTCTCAAGCCCATCGAGTTTGGACCTCGTGCTGGCAGC
CGCAAAGATCGTACTTCCGAGTATCAATTCTCTGGCATCTTGCCGCACAGCTCGGGTGTCCCCAAAAGGGCCCCG
CCTCCTTCCAAGATTCTTCATTCCACTGCCTCGTATAGTGACGAATTGAGAAGCCCTGGCTTGACAAGCCTACAG
CTTCCTGGTGATAGGGGCCGACGCGCTGCTCCTGGCGGACGCCTAGGTGCTCAATCCAAATCCCCTCATAATCGA
TGGGAAGCTCGCTCGCGTTCACCCGCCACTCTGTCGCCCCGCCTGCCGCCAAACAAGGCCATGCTTGGCGACGGC
CGCATACTCGACATCAACAGCGCCTACCGCCGCCTCTCGGATGCCAATCTTGCCTTTTCTAGTGGAAGTCTGGCC
CAGTTGCCTATGCGCAAGCGATCTGAAGAGAATGGCCAAGGAAGGCTATTCAAGGACTACCTCGGTCCCGACGGC
GAACATCTCGACTCTAGCGAAGAAGAAGATCAGTATACGTCGGACGACGAGGACCGTGGCCGTAAAATGGTCCCT
CGGAACCTGGATGCTCATGGTCAACACAAAGCCACCAAAAGCAGATCACGTTCCCGCTCGGGTCATGAAGAACGA
CAGAGCTTGAGCTTGCTGGCTGCAGCTGAGCAAGAACGTCACCAAGTGGCTTCTCAAAGAGAGCCACAAGCGGCG
ATGCAGCAGCCAGTCTACCAGTATAGATCCCTGATCCCCGACCTCGAAATCAAAATTACAAATTCATCGGGCGAT
ACCGTCAAGCCTTCCAAGGGGGCGATTCATCCCAATACAAGTTATGATCAAAGCCCCTCTGGAGCACCGTCAATG
GTTGACTCGGACGACGAGGCCGACATGGACGACATCAAGAGGGCGCAAAAGCTGTCATTCTCCATGACCAATATT
ATATCCCACCCAGAGTCTCATCGATCGATCCGCATTATTTACCGAGGCGAATACAATAAGATTGTACAGCAGGCA
GAAGAGGACCATCACAGGCTGCGCAAGTACCTGGTGGCTACTGACCTAAGTGATGAATCGACTCACGCTCTGGAG
TGGGCGATTGGAACGCTACTGCGAGACGGAGACACGTTAATTGCTATATACTGCGTGGATGAGGAGACTGGCATT
GCCATGGGCGACAGTGGGGGAGGAGCGGTGCCTGATGACCCCAAGGCGATGCGAGAGCAAGCAGCAGTTATTAAC
ACCATGGCCAACTCTCGGTCGGCACCGGCTCCAGCCAATGCCATTAACGCCTTGACAGAGGCGAAGCGTGCGTCG
GAGCTGAAGCGACCATCAGCGCTACATTTGCGCAGCGAGTCGGGCGGGACGCCGGGGACGTCGCCGGCACCACAC
AATGGCCGCGGAGATCGCGCGGGGCGTGCCGAAGAGGAGCGCAACCGGGCCATTCAGAGCATGACGGAGCGAATT
TTACGGCTACTGCGCAAGACGAGGTTGCAAGTGCGCGTGATTGCCGAAGTGCTGCAATGCAAGAACCCACGACAC
CTCATCACCGAAGTCATTGACCTTGTGGACCCTACCTTGGTGGTCATAGGAAGCCGCGGACGTAGTGCGCTCAAG
GGGGTCATTCTTGGTTCATTCTCCAACTACCTTGTTACCAAGAGCTCAGTTCCTGTTATGGTGGCCAGGAAGAGA
CTGCGCAAGCATACCAATTTCAAGCGGACGCCGGTACCACAAGTCAATAATCTCAACAATCCGGCTGCACGGAGT
TTGGCCAATGCCAAGGTGGATTGA
Gene >OphauB2|3381
ATGTCGGGGGATTCTCGACCCATGAGCATCGATGCCATGCTTGACATGGAGCGCCAGGAGGTTTTGGCCTTGCTC
GAGAATAACGGTCAGACAGGCGCCTCGGCGGATGGCCTACGATCCTCATCGCCCTTTGCTGCTCCCCGCTCGCCC
GTGCGAAGCCTGCTTGACATCGAGGAAGAGGGCCCTAGCAACACGCGCACCGCCCCTGTGGTGCAGGCTCCCGTT
CGGAGCATGCTCGACATTGATGGTCCTGTTTCGGCCACGCACCCTCCGGTCCGCAGCATGCTCAATCTCGACTCA
CCACCATCCCCAACGCCCTTGTCTCTTCATCGAACCACCAGCCCCGTCTCGCCCGGATTCCGCCCTAGTGACCTC
TACGGCTCCCACAATACGCGAAGCATGTCTGACGCTGGTCTCAAGCCCATCGAGTTTGGACCTCGTGCTGGCAGC
CGCAAAGATCGTACTTCCGAGTATCAATTCTCTGGCATCTTGCCGCACAGCTCGGGTGTCCCCAAAAGGGCCCCG
CCTCCTTCCAAGATTCTTCATTCCACTGCCTCGTATAGTGACGAATTGAGAAGCCCTGGCTTGACAAGCCTACAG
CTTCCTGGTGATAGGGGCCGACGCGCTGCTCCTGGCGGACGCCTAGGTGCTCAATCCAAATCCCCTCATAATCGA
TGGGAAGCTCGCTCGCGTTCACCCGCCACTCTGTCGCCCCGCCTGCCGCCAAACAAGGCCATGCTTGGCGACGGC
CGCATACTCGACATCAACAGCGCCTACCGCCGCCTCTCGGATGCCAATCTTGCCTTTTCTAGTGGAAGTCTGGCC
CAGTTGCCTATGCGCAAGCGATCTGAAGAGAATGGCCAAGGAAGGCTATTCAAGGACTACCTCGGTCCCGACGGC
GAACATCTCGACTCTAGCGAAGAAGAAGATCAGTATACGTCGGACGACGAGGACCGTGGCCGTAAAATGGTCCCT
CGGAACCTGGATGCTCATGGTCAACACAAAGCCACCAAAAGCAGATCACGTTCCCGCTCGGGTCATGAAGAACGA
CAGAGCTTGAGCTTGCTGGCTGCAGCTGAGCAAGAACGTATGTGAAATTTTCTCTTCTCAACCGACAAGAAATTG
CTAACCTCGCGATTTGAATGACAGGTCACCAAGTGGCTTCTCAAAGAGAGCCACAAGCGGCGATGCAGCAGCCAG
TCTACCAGTATAGATCCCTGATCCCCGACCTCGAAATCAAAATTACAAATTCATCGGGCGATACCGTCAAGCCTT
CCAAGGGGGCGATTCATCCCAATACAAGTTATGATCAAAGCCCCTCTGGAGCACCGTCAATGGTTGACTCGGACG
ACGAGGCCGACATGGACGACATCAAGAGGGCGCAAAAGCTGTCATTCTCCATGACCAATATTATATCCCACCCAG
AGTCTCATCGATCGATCCGCATTATTTACCGAGGCGAATACAATAAGATTGTACAGCAGGCAGAAGAGGACCATC
ACAGGCTGCGCAAGTACCTGGTGGCTACTGACCTAAGTGATGAATCGACTCACGCTCTGGAGTGGGCGATTGGAA
CGCTACTGCGAGACGGAGACACGTTAATTGCTATATACTGCGTGGATGAGGAGACTGGCATTGCCATGGGCGACA
GTGGGGGAGGAGCGGTGCCTGATGACCCCAAGGCGATGCGAGAGCAAGCAGCAGTTATTAACACCATGGCCAACT
CTCGGTCGGCACCGGCTCCAGCCAATGCCATTAACGCCTTGACAGAGGCGAAGCGTGCGTCGGAGCTGAAGCGAC
CATCAGCGCTACATTTGCGCAGCGAGTCGGGCGGGACGCCGGGGACGTCGCCGGCACCACACAATGGCCGCGGAG
ATCGCGCGGGGCGTGCCGAAGAGGAGCGCAACCGGGCCATTCAGAGCATGACGGAGCGAATTTTACGGCTACTGC
GCAAGACGAGGTTGCAAGTGCGCGTGATTGCCGAAGTGCTGCAATGCAAGAACCCACGACACCTCATCACCGAAG
TCATTGACCTTGTGGACCCTACCTTGGTGGTCATAGGAAGCCGCGGACGTAGTGCGCTCAAGGGGTGAGATATGT
CCCTTGATTCTCGCTTTTTTTTTTAAGTGAAAAACGTCGTTGGGCAAAGGACCATGCTAATAATTGGCAGGGTCA
TTCTTGGTTCATTCTCCAACTACCTTGTTACCAAGAGCTCAGTTCCTGTTATGGTGGCCAGGAAGAGACTGCGCA
AGCATACCAATTTCAAGCGGACGCCGGTACCACAAGTCAATAATCTCAACAATCCGGCTGCACGGAGTTTGGCCA
ATGCCAAGGTGGATTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail