Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|3380
Gene name
LocationContig_215:14695..16820
Strand-
Gene length (bp)2125
Transcript length (bp)1917
Coding sequence length (bp)1917
Protein length (aa) 639

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

(None)

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

Domain # Start End Length
1 13 35 22

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup1229
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|2144
Ophiocordyceps australis map64 (Brazil) OphauB2|3380 (this protein)
Ophiocordyceps camponoti-floridani Ophcf2|01214
Ophiocordyceps camponoti-rufipedis Ophun1|5124
Ophiocordyceps kimflemingae Ophio5|707
Ophiocordyceps subramaniannii Hirsu2|10404

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|3380
MPSLLTVNNHISLISVSVAPSTYLASVVILLIFVGLYLPRLSVRLPRLLFATANLPFTALTEFGRLLPTKASVPD
FPPSPLSLRHSEPPTPEETMSDHMHARLLLDDDDDESETASVGGFSPPAWRNLGNGDRSRGFWKSAHQVVQSPHR
RSYRSPRLYFHDSDEGSDDEETLPSEHDMILEQAIRTRLPQGSLSPDKGTSPSPEVIAHGKLQRQVNGKSPSHCP
GAVDGAGVARRDNFIRLALRADIQQTTQPIDSAIVFVQKQYRSLTSTWLTLITTLIVAVLSISTAKMLVKPAAPR
PVGDLVKVAGLARSFEPLIYFSEPAVAHVRELQSTSIAIWDLGESVRISGMADADTIVQSLDTISETMKKLVLDL
TRFHTHVDGDVDAILNVMDWAKLHLNRLNTRPPPSHLSHAYDNLHNLLTDAHVLEDASGEPTRLGRLTTAVLGMS
NPQREQRMIQKLFDAFISTIEEAITDELEHSVGLFALFDDIDDHFLRLARHVAHESSTQDEFHAELLSGLWARML
GTRAAELRKFERNRAILHDVRRKTVRNKGALVGHHGKLLTLKASLESLRGRLASHLVRGLNSSALNLEDQIRGIA
GVRDYLADIRRQQKTKVMETLYSRKLPLPEIDAAPDHS*
Coding >OphauB2|3380
ATGCCTTCGCTCTTGACCGTCAACAACCACATATCTCTCATCAGTGTCAGCGTTGCGCCCAGCACCTATCTTGCG
TCGGTGGTGATTCTGCTCATCTTTGTCGGCCTCTATCTGCCTCGGCTCTCTGTGCGCCTTCCGCGCCTGCTCTTT
GCGACAGCAAATCTGCCCTTTACTGCCTTGACCGAGTTTGGGCGCCTGTTGCCCACAAAGGCCAGCGTCCCAGAT
TTTCCTCCCAGCCCCTTGAGTCTGCGACACTCGGAGCCGCCGACGCCCGAGGAGACCATGTCGGACCACATGCAC
GCTCGCCTTCTCCTCGACGACGACGACGACGAATCGGAGACGGCTTCCGTCGGTGGCTTCTCGCCCCCAGCATGG
CGCAACCTCGGCAACGGCGATCGAAGCCGCGGCTTTTGGAAGTCGGCCCACCAGGTGGTTCAGTCGCCTCACCGA
CGTTCCTATAGGAGTCCCAGGCTCTATTTCCACGACTCGGATGAGGGCTCTGATGATGAGGAAACACTGCCGAGC
GAGCATGACATGATTCTCGAGCAGGCCATTCGGACTCGTTTGCCCCAGGGGAGCTTGAGTCCCGACAAGGGCACC
AGCCCCAGCCCTGAAGTGATTGCCCATGGCAAACTACAGCGTCAGGTCAATGGCAAGAGCCCAAGTCATTGCCCC
GGAGCTGTTGACGGGGCCGGTGTGGCTAGGAGGGATAACTTTATTCGCCTCGCTCTTCGGGCTGACATTCAGCAG
ACGACACAGCCCATAGATAGCGCCATTGTCTTTGTGCAGAAGCAGTATCGCTCGCTGACGTCGACATGGTTGACG
CTCATCACGACGCTAATTGTAGCCGTTCTCTCCATCTCCACGGCCAAGATGCTGGTCAAGCCGGCGGCGCCGCGG
CCCGTGGGCGACCTGGTCAAGGTGGCTGGGCTCGCACGCTCCTTTGAACCGCTCATTTACTTTTCGGAGCCGGCA
GTGGCGCATGTGCGCGAGCTGCAGTCGACGAGCATTGCCATCTGGGACCTGGGCGAGTCGGTGCGCATCAGCGGC
ATGGCGGATGCCGACACCATTGTGCAGAGTCTTGACACGATTAGCGAGACGATGAAGAAGCTCGTCTTGGACCTG
ACGCGCTTCCACACGCACGTTGACGGCGACGTTGATGCCATCCTCAATGTCATGGACTGGGCCAAGCTGCACCTG
AACCGGCTCAACACGCGGCCGCCGCCGTCACACCTGTCGCACGCCTACGACAACCTGCACAACCTCTTGACAGAC
GCCCACGTGCTTGAAGATGCGTCGGGAGAGCCAACCAGGCTGGGCCGGCTGACAACGGCTGTGCTGGGCATGTCG
AATCCGCAGCGCGAGCAGCGCATGATTCAAAAGCTCTTTGACGCCTTCATCTCGACTATTGAAGAGGCCATTACC
GACGAGCTGGAGCACTCGGTCGGCCTGTTTGCCCTCTTTGACGACATTGACGACCACTTCTTGCGCCTGGCACGC
CACGTTGCCCACGAGTCGTCGACGCAGGACGAGTTCCACGCCGAGCTGCTGTCTGGCCTGTGGGCGCGCATGCTG
GGCACCCGCGCTGCCGAGCTGCGCAAGTTTGAGCGCAACCGCGCCATTTTGCACGACGTGCGCCGCAAGACGGTG
CGCAACAAGGGCGCCCTCGTCGGCCACCACGGCAAGCTGCTGACGCTCAAGGCGTCGCTCGAGTCGCTGCGCGGC
CGCCTCGCCTCGCACCTGGTTCGCGGGCTCAACTCGAGCGCCCTCAACCTCGAGGACCAGATTCGCGGCATTGCC
GGCGTGCGCGACTACCTGGCTGACATTCGCCGCCAGCAAAAGACAAAGGTCATGGAGACTCTCTACTCGCGCAAG
CTGCCTCTGCCCGAGATTGATGCCGCCCCCGACCACTCGTGA
Transcript >OphauB2|3380
ATGCCTTCGCTCTTGACCGTCAACAACCACATATCTCTCATCAGTGTCAGCGTTGCGCCCAGCACCTATCTTGCG
TCGGTGGTGATTCTGCTCATCTTTGTCGGCCTCTATCTGCCTCGGCTCTCTGTGCGCCTTCCGCGCCTGCTCTTT
GCGACAGCAAATCTGCCCTTTACTGCCTTGACCGAGTTTGGGCGCCTGTTGCCCACAAAGGCCAGCGTCCCAGAT
TTTCCTCCCAGCCCCTTGAGTCTGCGACACTCGGAGCCGCCGACGCCCGAGGAGACCATGTCGGACCACATGCAC
GCTCGCCTTCTCCTCGACGACGACGACGACGAATCGGAGACGGCTTCCGTCGGTGGCTTCTCGCCCCCAGCATGG
CGCAACCTCGGCAACGGCGATCGAAGCCGCGGCTTTTGGAAGTCGGCCCACCAGGTGGTTCAGTCGCCTCACCGA
CGTTCCTATAGGAGTCCCAGGCTCTATTTCCACGACTCGGATGAGGGCTCTGATGATGAGGAAACACTGCCGAGC
GAGCATGACATGATTCTCGAGCAGGCCATTCGGACTCGTTTGCCCCAGGGGAGCTTGAGTCCCGACAAGGGCACC
AGCCCCAGCCCTGAAGTGATTGCCCATGGCAAACTACAGCGTCAGGTCAATGGCAAGAGCCCAAGTCATTGCCCC
GGAGCTGTTGACGGGGCCGGTGTGGCTAGGAGGGATAACTTTATTCGCCTCGCTCTTCGGGCTGACATTCAGCAG
ACGACACAGCCCATAGATAGCGCCATTGTCTTTGTGCAGAAGCAGTATCGCTCGCTGACGTCGACATGGTTGACG
CTCATCACGACGCTAATTGTAGCCGTTCTCTCCATCTCCACGGCCAAGATGCTGGTCAAGCCGGCGGCGCCGCGG
CCCGTGGGCGACCTGGTCAAGGTGGCTGGGCTCGCACGCTCCTTTGAACCGCTCATTTACTTTTCGGAGCCGGCA
GTGGCGCATGTGCGCGAGCTGCAGTCGACGAGCATTGCCATCTGGGACCTGGGCGAGTCGGTGCGCATCAGCGGC
ATGGCGGATGCCGACACCATTGTGCAGAGTCTTGACACGATTAGCGAGACGATGAAGAAGCTCGTCTTGGACCTG
ACGCGCTTCCACACGCACGTTGACGGCGACGTTGATGCCATCCTCAATGTCATGGACTGGGCCAAGCTGCACCTG
AACCGGCTCAACACGCGGCCGCCGCCGTCACACCTGTCGCACGCCTACGACAACCTGCACAACCTCTTGACAGAC
GCCCACGTGCTTGAAGATGCGTCGGGAGAGCCAACCAGGCTGGGCCGGCTGACAACGGCTGTGCTGGGCATGTCG
AATCCGCAGCGCGAGCAGCGCATGATTCAAAAGCTCTTTGACGCCTTCATCTCGACTATTGAAGAGGCCATTACC
GACGAGCTGGAGCACTCGGTCGGCCTGTTTGCCCTCTTTGACGACATTGACGACCACTTCTTGCGCCTGGCACGC
CACGTTGCCCACGAGTCGTCGACGCAGGACGAGTTCCACGCCGAGCTGCTGTCTGGCCTGTGGGCGCGCATGCTG
GGCACCCGCGCTGCCGAGCTGCGCAAGTTTGAGCGCAACCGCGCCATTTTGCACGACGTGCGCCGCAAGACGGTG
CGCAACAAGGGCGCCCTCGTCGGCCACCACGGCAAGCTGCTGACGCTCAAGGCGTCGCTCGAGTCGCTGCGCGGC
CGCCTCGCCTCGCACCTGGTTCGCGGGCTCAACTCGAGCGCCCTCAACCTCGAGGACCAGATTCGCGGCATTGCC
GGCGTGCGCGACTACCTGGCTGACATTCGCCGCCAGCAAAAGACAAAGGTCATGGAGACTCTCTACTCGCGCAAG
CTGCCTCTGCCCGAGATTGATGCCGCCCCCGACCACTCGTGA
Gene >OphauB2|3380
ATGCCTTCGCTCTTGACCGTCAACAACCACATATCTCTCATCAGTGTCAGCGTTGCGCCCAGCACCTATCTTGCG
TCGGTGGTGATTCTGCTCATCTTTGTCGGCCTCTATCTGCCTCGGCTCTCTGTGCGCCTTCCGCGCCTGCTCTTT
GCGACAGCAAATCTGCCCTTTACTGCCTTGACCGAGTTTGGGCGCCTGTTGCCCACAAAGGCCAGCGTCCCAGTC
GTTGACCATCAAAAACCGCTTCCAGCCCTGCCACCATTGACAAGCAAGCGCAATGTCGCATCCCTTGGACGCTCT
CGAAGACTCGTTGCAGGATTTTCCTCCCAGCCCCTTGAGTCTGCGACACTCGGAGCCGCCGACGCCCGAGGAGAC
CATGTCGGACCACATGCACGCTCGCCTTCTCCTCGACGACGACGACGACGAATCGGAGACGGCTTCCGTCGGTGG
CTTCTCGCCCCCAGCATGGCGCAACCTCGGCAACGGCGATCGAAGCCGCGGCTTTTGGAAGTCGGCCCACCAGGT
GGTTCAGTCGCCTCACCGACGTTCCTATAGGAGTCCCAGGCTCTATTTCCACGACTCGGATGAGGGCTCTGATGA
TGAGGAAACACTGCCGAGCGAGCATGACATGATTCTCGAGCAGGCCATTCGGACTCGTTTGCCCCAGGGGAGCTT
GAGTCCCGACAAGGGCACCAGCCCCAGCCCTGAAGTGATTGCCCATGGCAAACTACAGCGTCAGGTCAATGGCAA
GAGCCCAAGTCATTGCCCCGGAGCTGTTGACGGGGCCGGTGTGGCTAGGAGGGATAACTGTTTGTCTCTTGTCTT
GGCTGGCCTTGGGCGTTGGGCGCTGCTGATGAGGAAACGTCTAGTTATTCGCCTCGCTCTTCGGGCTGACATTCA
GCAGACGACACAGCCCATAGATAGCGCCATTGTCTTTGTGCAGAAGCAGTATCGCTCGCTGACGTCGACATGGTT
GACGCTCATCACGACGCTAATTGTAGCCGTTCTCTCCATCTCCACGGCCAAGATGCTGGTCAAGCCGGCGGCGCC
GCGGCCCGTGGGCGACCTGGTCAAGGTGGCTGGGCTCGCACGCTCCTTTGAACCGCTCATTTACTTTTCGGAGCC
GGCAGTGGCGCATGTGCGCGAGCTGCAGTCGACGAGCATTGCCATCTGGGACCTGGGCGAGTCGGTGCGCATCAG
CGGCATGGCGGATGCCGACACCATTGTGCAGAGTCTTGACACGATTAGCGAGACGATGAAGAAGCTCGTCTTGGA
CCTGACGCGCTTCCACACGCACGTTGACGGCGACGTTGATGCGTACGTCTTGGTCTCCCCGCCCAAAGCGGGTGT
CGCGTGGCTAACCTTGTCTAGCATCCTCAATGTCATGGACTGGGCCAAGCTGCACCTGAACCGGCTCAACACGCG
GCCGCCGCCGTCACACCTGTCGCACGCCTACGACAACCTGCACAACCTCTTGACAGACGCCCACGTGCTTGAAGA
TGCGTCGGGAGAGCCAACCAGGCTGGGCCGGCTGACAACGGCTGTGCTGGGCATGTCGAATCCGCAGCGCGAGCA
GCGCATGATTCAAAAGCTCTTTGACGCCTTCATCTCGACTATTGAAGAGGCCATTACCGACGAGCTGGAGCACTC
GGTCGGCCTGTTTGCCCTCTTTGACGACATTGACGACCACTTCTTGCGCCTGGCACGCCACGTTGCCCACGAGTC
GTCGACGCAGGACGAGTTCCACGCCGAGCTGCTGTCTGGCCTGTGGGCGCGCATGCTGGGCACCCGCGCTGCCGA
GCTGCGCAAGTTTGAGCGCAACCGCGCCATTTTGCACGACGTGCGCCGCAAGACGGTGCGCAACAAGGGCGCCCT
CGTCGGCCACCACGGCAAGCTGCTGACGCTCAAGGCGTCGCTCGAGTCGCTGCGCGGCCGCCTCGCCTCGCACCT
GGTTCGCGGGCTCAACTCGAGCGCCCTCAACCTCGAGGACCAGATTCGCGGCATTGCCGGCGTGCGCGACTACCT
GGCTGACATTCGCCGCCAGCAAAAGACAAAGGTCATGGAGACTCTCTACTCGCGCAAGCTGCCTCTGCCCGAGAT
TGATGCCGCCCCCGACCACTCGTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail