Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|3372
Gene name
LocationContig_214:23348..24643
Strand-
Gene length (bp)1295
Transcript length (bp)1158
Coding sequence length (bp)1158
Protein length (aa) 386

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF03839 Sec62 Translocation protein Sec62 4.6E-63 125 311

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q99161|SEC62_YARLI Translocation protein SEC62 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=SEC62 PE=3 SV=2 97 315 8.0E-61
sp|O13787|SEC62_SCHPO Translocation protein sec62 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sec62 PE=3 SV=1 100 383 4.0E-53
sp|Q5AI21|SEC62_CANAL Translocation protein SEC62 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=SEC62 PE=3 SV=1 86 358 6.0E-34
sp|Q6CLZ9|SEC62_KLULA Translocation protein SEC62 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=SEC62 PE=3 SV=1 96 331 1.0E-31
sp|P21825|SEC62_YEAST Translocation protein SEC62 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SEC62 PE=1 SV=2 100 312 5.0E-27
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q99161|SEC62_YARLI Translocation protein SEC62 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=SEC62 PE=3 SV=2 97 315 8.0E-61
sp|O13787|SEC62_SCHPO Translocation protein sec62 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sec62 PE=3 SV=1 100 383 4.0E-53
sp|Q5AI21|SEC62_CANAL Translocation protein SEC62 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=SEC62 PE=3 SV=1 86 358 6.0E-34
sp|Q6CLZ9|SEC62_KLULA Translocation protein SEC62 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=SEC62 PE=3 SV=1 96 331 1.0E-31
sp|P21825|SEC62_YEAST Translocation protein SEC62 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SEC62 PE=1 SV=2 100 312 5.0E-27
sp|Q6FRU9|SEC62_CANGA Translocation protein SEC62 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=SEC62 PE=3 SV=1 100 312 1.0E-25
sp|Q6BI99|SEC62_DEBHA Translocation protein SEC62 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=SEC62 PE=3 SV=1 100 312 3.0E-22
sp|Q8BU14|SEC62_MOUSE Translocation protein SEC62 OS=Mus musculus GN=Sec62 PE=1 SV=1 213 326 2.0E-18
sp|Q5R4Q3|SEC62_PONAB Translocation protein SEC62 OS=Pongo abelii GN=SEC62 PE=2 SV=1 213 326 4.0E-18
sp|Q99442|SEC62_HUMAN Translocation protein SEC62 OS=Homo sapiens GN=SEC62 PE=1 SV=1 213 326 5.0E-18
sp|Q75D26|SEC62_ASHGO Translocation protein SEC62 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=SEC62 PE=3 SV=2 103 313 9.0E-17
sp|Q5F3A1|SEC62_CHICK Translocation protein SEC62 OS=Gallus gallus GN=SEC62 PE=2 SV=1 213 312 2.0E-16
[Show less]

GO

GO Term Description Terminal node
GO:0030176 integral component of endoplasmic reticulum membrane Yes
GO:0015031 protein transport Yes
GO:0031224 intrinsic component of membrane No
GO:0031300 intrinsic component of organelle membrane No
GO:0051641 cellular localization No
GO:0070727 cellular macromolecule localization No
GO:0005575 cellular_component No
GO:0045184 establishment of protein localization No
GO:0031301 integral component of organelle membrane No
GO:0008150 biological_process No
GO:0071702 organic substance transport No
GO:0033036 macromolecule localization No
GO:0008104 protein localization No
GO:0051179 localization No
GO:0110165 cellular anatomical entity No
GO:0006810 transport No
GO:0071705 nitrogen compound transport No
GO:0009987 cellular process No
GO:0016021 integral component of membrane No
GO:0051234 establishment of localization No
GO:0031227 intrinsic component of endoplasmic reticulum membrane No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 12 0.45

Transmembrane Domains

Domain # Start End Length
1 226 248 22
2 255 277 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|3372
MSGQPPPGGMQRPSPEQIAEIQRRVAEDAQRAGMTVPEFIEHIKKQAAEQQRMRMMQQQQQQQQHGHDHDHSHDH
DHDHGHQHPQAQQQPITPGPPNPKAIAVAQFLKNQDLKPRTCILNGERKDMFKVKRALRALQSPAYQKARKRNPL
LPEITDRASIENTFKLLPLSMLALRVSKVEPQMGTNGKKPKRVKGQWTVRIEQQQEAQDDMYYAWLWEGSQVKRQ
LYAALALVVIFAIVLYPLWPLKLRQGVYYLSWGLLCLLGLFFLMAIFRVILFCFTYFAVPPGLWLYPNLWEDVSF
MDSFRPVWAWHESAEEKKAKKKAKKKARATATSSGNVRNPVLAAATGQMAPTTATTTGTDTQIQTGDLHQRSYMA
PKVEELADDE*
Coding >OphauB2|3372
ATGTCAGGCCAACCACCGCCAGGAGGCATGCAGCGCCCCTCGCCCGAGCAGATTGCCGAAATCCAGCGCAGAGTG
GCCGAAGATGCGCAAAGGGCTGGGATGACGGTGCCAGAGTTCATTGAGCATATCAAGAAGCAGGCAGCCGAGCAG
CAGCGGATGCGCATGATGCAGCAGCAGCAGCAGCAGCAGCAACATGGCCATGATCACGATCACAGCCACGACCAC
GATCATGACCACGGCCATCAACATCCGCAAGCCCAGCAGCAGCCCATTACACCTGGGCCGCCGAACCCAAAAGCC
ATTGCAGTCGCCCAGTTTCTCAAAAACCAAGACCTTAAGCCGCGGACCTGTATCCTCAACGGCGAGCGCAAAGAC
ATGTTTAAAGTCAAGAGAGCCTTGCGAGCCTTGCAATCCCCCGCTTACCAAAAAGCTCGCAAGAGGAATCCGCTG
CTGCCTGAAATCACGGATCGAGCCTCCATTGAAAACACGTTTAAACTGCTTCCACTCAGTATGCTCGCCCTACGT
GTGTCCAAAGTCGAGCCCCAGATGGGTACGAATGGCAAGAAGCCCAAGCGCGTCAAGGGACAGTGGACTGTCCGC
ATAGAGCAGCAACAAGAAGCTCAGGACGACATGTACTATGCCTGGCTATGGGAGGGCAGCCAGGTTAAACGCCAG
CTCTACGCAGCACTTGCCCTCGTCGTCATCTTTGCCATTGTGCTCTATCCGCTGTGGCCGCTCAAGCTTCGTCAA
GGAGTATACTATCTCAGCTGGGGCCTGCTCTGTCTCTTGGGTCTTTTCTTTCTTATGGCCATCTTTCGCGTCATT
CTCTTTTGCTTCACCTACTTCGCAGTTCCACCTGGTCTGTGGCTCTACCCTAATTTGTGGGAGGACGTATCCTTC
ATGGACAGCTTCAGGCCTGTATGGGCCTGGCACGAATCGGCCGAGGAAAAGAAGGCCAAGAAGAAGGCCAAGAAG
AAGGCTAGAGCAACGGCTACATCCTCGGGTAACGTGAGAAATCCTGTCTTGGCCGCTGCCACGGGCCAAATGGCG
CCGACCACTGCGACGACGACGGGTACCGACACTCAAATCCAGACGGGCGATTTGCACCAACGAAGCTATATGGCA
CCAAAGGTGGAGGAGTTGGCTGATGACGAATAA
Transcript >OphauB2|3372
ATGTCAGGCCAACCACCGCCAGGAGGCATGCAGCGCCCCTCGCCCGAGCAGATTGCCGAAATCCAGCGCAGAGTG
GCCGAAGATGCGCAAAGGGCTGGGATGACGGTGCCAGAGTTCATTGAGCATATCAAGAAGCAGGCAGCCGAGCAG
CAGCGGATGCGCATGATGCAGCAGCAGCAGCAGCAGCAGCAACATGGCCATGATCACGATCACAGCCACGACCAC
GATCATGACCACGGCCATCAACATCCGCAAGCCCAGCAGCAGCCCATTACACCTGGGCCGCCGAACCCAAAAGCC
ATTGCAGTCGCCCAGTTTCTCAAAAACCAAGACCTTAAGCCGCGGACCTGTATCCTCAACGGCGAGCGCAAAGAC
ATGTTTAAAGTCAAGAGAGCCTTGCGAGCCTTGCAATCCCCCGCTTACCAAAAAGCTCGCAAGAGGAATCCGCTG
CTGCCTGAAATCACGGATCGAGCCTCCATTGAAAACACGTTTAAACTGCTTCCACTCAGTATGCTCGCCCTACGT
GTGTCCAAAGTCGAGCCCCAGATGGGTACGAATGGCAAGAAGCCCAAGCGCGTCAAGGGACAGTGGACTGTCCGC
ATAGAGCAGCAACAAGAAGCTCAGGACGACATGTACTATGCCTGGCTATGGGAGGGCAGCCAGGTTAAACGCCAG
CTCTACGCAGCACTTGCCCTCGTCGTCATCTTTGCCATTGTGCTCTATCCGCTGTGGCCGCTCAAGCTTCGTCAA
GGAGTATACTATCTCAGCTGGGGCCTGCTCTGTCTCTTGGGTCTTTTCTTTCTTATGGCCATCTTTCGCGTCATT
CTCTTTTGCTTCACCTACTTCGCAGTTCCACCTGGTCTGTGGCTCTACCCTAATTTGTGGGAGGACGTATCCTTC
ATGGACAGCTTCAGGCCTGTATGGGCCTGGCACGAATCGGCCGAGGAAAAGAAGGCCAAGAAGAAGGCCAAGAAG
AAGGCTAGAGCAACGGCTACATCCTCGGGTAACGTGAGAAATCCTGTCTTGGCCGCTGCCACGGGCCAAATGGCG
CCGACCACTGCGACGACGACGGGTACCGACACTCAAATCCAGACGGGCGATTTGCACCAACGAAGCTATATGGCA
CCAAAGGTGGAGGAGTTGGCTGATGACGAATAA
Gene >OphauB2|3372
ATGTCAGGCCAACCACCGCCAGGAGGCATGCAGCGCCCCTCGCCCGAGCAGATTGCCGAAATCCAGCGCAGAGTG
GCCGAAGATGCGCAAAGGGCTGGGATGACGGTGCCAGAGTTCATTGAGCATATCAAGAAGCAGGCAGCCGAGCAG
CAGCGGATGCGCATGATGCAGCAGCAGCAGCAGCAGCAGCAACATGGCCATGATCACGATCACAGCCACGACCAC
GATCATGACCACGGCCATCAACATCCGCAAGCCCAGCAGCAGCCCATTACACCTGGGCCGCCGAACCCAAAAGCC
ATTGCAGTCGCCCAGTTTCTCAAAAACCAAGACCTTAAGCCGCGGACCTGTATCCTCAACGGCGAGCGCAAAGAC
ATGTTTAAAGGCAAGTCGCCCAGGCCGCTGTCGCCTGGCATATCAATCGACTAATCTGGTGCCTGGCGTCTTGCA
GTCAAGAGAGCCTTGCGAGCCTTGCAATCCCCCGCTTACCAAAAAGCTCGCAAGAGGAATCCGCTGCTGCCTGAA
ATCACGGATCGAGCCTCCATTGAAAACACGTTTAAACTGCTTCCACTCAGTATGCTCGCCCTACGTGTGTCCAAA
GTCGAGCCCCAGATGGGTACGAATGGCAAGAAGCCCAAGCGCGTCAAGGGACAGTGGACTGTCCGCATAGAGCAG
CAACAAGAAGCTCAGGACGACATGTACTATGCCTGGCTATGGGAGGGCAGCCAGGTTAAACGCCAGCTCTACGCA
GCACTTGCCCTCGTCGTCATCTTTGCCATTGTGCTCTATCCGCTGTGGCCGCTCAAGCTTCGTCAAGGAGTATAC
TATCTCAGCTGGGGCCTGCTCTGTCTCTTGGGTCTTTTCTTTCTTATGGCCATCTTTCGCGTCATTCTCTTTTGC
TTCACCTACTTCGCAGTTCCACCTGGTCTGTGGCTCTACCCTAATTTGTGGGAGGACGTATCCTTCATGGACAGC
TTCAGGCCTGTATGGGCCTGGCACGAAGTGAGTGGCCTTGTTATTGTTTCCAAATTTGCCTATGGGGGATAATGG
CTGATTATATCTTGTCTTGTCAGTCGGCCGAGGAAAAGAAGGCCAAGAAGAAGGCCAAGAAGAAGGCTAGAGCAA
CGGCTACATCCTCGGGTAACGTGAGAAATCCTGTCTTGGCCGCTGCCACGGGCCAAATGGCGCCGACCACTGCGA
CGACGACGGGTACCGACACTCAAATCCAGACGGGCGATTTGCACCAACGAAGCTATATGGCACCAAAGGTGGAGG
AGTTGGCTGATGACGAATAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail