Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|3361
Gene name
LocationContig_213:19622..20596
Strand-
Gene length (bp)974
Transcript length (bp)912
Coding sequence length (bp)912
Protein length (aa) 304

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01014 Uricase Uricase 5.4E-40 9 134
PF01014 Uricase Uricase 6.6E-34 151 297

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P33282|URIC_EMENI Uricase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=uaZ PE=3 SV=1 5 302 4.0E-135
sp|Q00511|URIC_ASPFL Uricase OS=Aspergillus flavus GN=uaZ PE=1 SV=3 5 303 5.0E-134
sp|P78609|URIC_CYBJA Uricase OS=Cyberlindnera jadinii PE=3 SV=1 1 302 2.0E-85
sp|O74409|URIC_SCHPO Uricase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC1223.09 PE=1 SV=1 10 302 2.0E-78
sp|P22673|URIC_DROPS Uricase OS=Drosophila pseudoobscura pseudoobscura GN=Uro PE=2 SV=2 3 302 1.0E-54
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P33282|URIC_EMENI Uricase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=uaZ PE=3 SV=1 5 302 4.0E-135
sp|Q00511|URIC_ASPFL Uricase OS=Aspergillus flavus GN=uaZ PE=1 SV=3 5 303 5.0E-134
sp|P78609|URIC_CYBJA Uricase OS=Cyberlindnera jadinii PE=3 SV=1 1 302 2.0E-85
sp|O74409|URIC_SCHPO Uricase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC1223.09 PE=1 SV=1 10 302 2.0E-78
sp|P22673|URIC_DROPS Uricase OS=Drosophila pseudoobscura pseudoobscura GN=Uro PE=2 SV=2 3 302 1.0E-54
sp|P16163|URIC_DROME Uricase OS=Drosophila melanogaster GN=Uro PE=1 SV=2 3 302 1.0E-53
sp|O44111|URIC_DROSU Uricase (Fragment) OS=Drosophila subobscura GN=Uro PE=2 SV=1 3 302 1.0E-52
sp|P23194|URIC_DROVI Uricase OS=Drosophila virilis GN=Uro PE=2 SV=1 3 302 5.0E-50
sp|D0VWQ1|URIC_ARTGO Uricase OS=Arthrobacter globiformis GN=uox PE=1 SV=1 5 303 8.0E-50
sp|P34798|URIC1_CANLI Uricase-2 isozyme 1 OS=Canavalia lineata PE=2 SV=1 9 302 1.0E-49
sp|P09118|URIC_RAT Uricase OS=Rattus norvegicus GN=Uox PE=1 SV=3 10 303 1.0E-48
sp|P25688|URIC_MOUSE Uricase OS=Mus musculus GN=Uox PE=1 SV=2 10 303 3.0E-48
sp|O04104|URIC2_SOYBN Uricase-2 isozyme 2 OS=Glycine max PE=1 SV=1 9 302 3.0E-48
sp|P04670|URIC1_SOYBN Uricase-2 isozyme 1 OS=Glycine max PE=1 SV=2 9 302 4.0E-48
sp|P11645|URIC_RABIT Uricase OS=Oryctolagus cuniculus GN=UOX PE=2 SV=1 10 303 2.0E-47
sp|Q5FZI9|URIC_CANLF Uricase OS=Canis lupus familiaris GN=UOX PE=1 SV=3 10 303 2.0E-47
sp|Q3MHG7|URIC_BOVIN Uricase OS=Bos taurus GN=UOX PE=2 SV=3 10 303 3.0E-47
sp|P25689|URIC_PAPHA Uricase OS=Papio hamadryas GN=UOX PE=2 SV=3 10 303 5.0E-47
sp|Q8MHW6|URIC_MACFA Uricase OS=Macaca fascicularis GN=UOX PE=3 SV=3 10 303 5.0E-47
sp|P16164|URIC_PIG Uricase OS=Sus scrofa GN=UOX PE=2 SV=3 10 303 6.0E-47
sp|P53763|URIC_PHAVU Uricase-2 OS=Phaseolus vulgaris GN=URIII PE=1 SV=2 9 302 7.0E-47
sp|Q8MKJ3|URIC_MACMU Uricase OS=Macaca mulatta GN=UOX PE=3 SV=3 10 303 4.0E-46
sp|Q8MKJ2|URIC_AOTTR Uricase OS=Aotus trivirgatus GN=UOX PE=3 SV=3 10 303 5.0E-46
sp|O04420|URIC_ARATH Uricase OS=Arabidopsis thaliana GN=At2g26230 PE=1 SV=2 9 302 7.0E-46
sp|P34799|URIC2_CANLI Uricase-2 isozyme 2 OS=Canavalia lineata PE=2 SV=1 9 302 2.0E-45
sp|Q54LT2|URIC_DICDI Uricase OS=Dictyostelium discoideum GN=uox PE=3 SV=1 9 303 7.0E-42
sp|D4GPU7|URIC_HALVD Uricase OS=Haloferax volcanii (strain ATCC 29605 / DSM 3757 / JCM 8879 / NBRC 14742 / NCIMB 2012 / VKM B-1768 / DS2) GN=HVO_B0300 PE=3 SV=1 10 302 1.0E-25
sp|D8JBB7|URIC_HALJB Uricase OS=Halalkalicoccus jeotgali (strain DSM 18796 / CECT 7217 / JCM 14584 / KCTC 4019 / B3) GN=HacjB3_16061 PE=3 SV=2 10 303 2.0E-24
sp|O32141|PUCL_BACSU Uric acid degradation bifunctional protein PucL OS=Bacillus subtilis (strain 168) GN=pucL PE=1 SV=1 10 303 3.0E-24
sp|Q45697|PUCL_BACSB Uric acid degradation bifunctional protein OS=Bacillus sp. (strain TB-90) GN=uao PE=1 SV=3 10 295 2.0E-20
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 47 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|3361
MPYRLSAARYGKDNVRVLKVARDSATGVQTVTEMTVCCLLEGDIDASYTHADNKVVVATDSIKNTIYILARQHAV
NPPELFAATVGSHFVDTYAHINAASVSVIVHRWLRMDIAGQSHPHSFIKDAGETRTAQVCVRRSQPGSSHGAIDL
SSSISGLSVLKTTGSAFHGFIRDEYTTLPETWDRILATDVDATWHWKPFANLNALQQAKHGFDDAWQAARDITLR
LFANDESPSVQNTMYKMCEQVLDAVPGIQDVAYSLPNKHNFELDLTWHKNLHNTGQHAEVYVPQSNPNGLIKCQV
SRS*
Coding >OphauB2|3361
ATGCCCTACCGCCTCTCGGCCGCCCGCTACGGCAAAGACAATGTCCGCGTCCTCAAGGTTGCGCGCGACTCGGCC
ACGGGCGTGCAGACGGTGACAGAAATGACTGTCTGCTGCCTACTCGAGGGCGACATTGACGCTTCCTACACGCAC
GCCGACAACAAGGTGGTGGTGGCGACGGATTCCATCAAAAACACAATCTACATTCTTGCTCGTCAACACGCTGTC
AATCCCCCCGAGCTCTTTGCCGCAACAGTAGGCTCGCATTTTGTTGACACTTATGCCCACATCAATGCCGCCTCG
GTTTCCGTCATTGTCCATCGCTGGCTGCGCATGGATATTGCTGGCCAATCACATCCTCATAGCTTCATCAAGGAC
GCTGGCGAGACTCGCACCGCCCAAGTTTGCGTCCGTCGGAGCCAGCCTGGCAGCAGCCACGGCGCCATTGACTTG
AGCAGCTCCATTTCAGGTCTTTCTGTGCTCAAAACCACGGGCTCGGCTTTCCACGGCTTCATCCGAGACGAGTAC
ACCACGCTTCCCGAGACGTGGGATCGCATTCTCGCCACCGATGTCGACGCCACCTGGCATTGGAAACCGTTTGCC
AACCTGAATGCTCTTCAACAAGCTAAACATGGCTTCGACGATGCCTGGCAGGCTGCTCGCGACATCACTCTGCGT
CTTTTTGCCAACGATGAGAGCCCCAGCGTGCAAAACACAATGTACAAAATGTGCGAGCAAGTTCTCGACGCTGTC
CCTGGAATTCAAGACGTGGCCTACTCGCTGCCTAATAAGCACAACTTTGAACTTGATTTGACCTGGCATAAAAAC
CTACACAATACCGGCCAGCATGCCGAGGTCTACGTGCCTCAGTCTAATCCGAATGGTCTCATCAAATGCCAAGTC
TCTCGCTCGTAG
Transcript >OphauB2|3361
ATGCCCTACCGCCTCTCGGCCGCCCGCTACGGCAAAGACAATGTCCGCGTCCTCAAGGTTGCGCGCGACTCGGCC
ACGGGCGTGCAGACGGTGACAGAAATGACTGTCTGCTGCCTACTCGAGGGCGACATTGACGCTTCCTACACGCAC
GCCGACAACAAGGTGGTGGTGGCGACGGATTCCATCAAAAACACAATCTACATTCTTGCTCGTCAACACGCTGTC
AATCCCCCCGAGCTCTTTGCCGCAACAGTAGGCTCGCATTTTGTTGACACTTATGCCCACATCAATGCCGCCTCG
GTTTCCGTCATTGTCCATCGCTGGCTGCGCATGGATATTGCTGGCCAATCACATCCTCATAGCTTCATCAAGGAC
GCTGGCGAGACTCGCACCGCCCAAGTTTGCGTCCGTCGGAGCCAGCCTGGCAGCAGCCACGGCGCCATTGACTTG
AGCAGCTCCATTTCAGGTCTTTCTGTGCTCAAAACCACGGGCTCGGCTTTCCACGGCTTCATCCGAGACGAGTAC
ACCACGCTTCCCGAGACGTGGGATCGCATTCTCGCCACCGATGTCGACGCCACCTGGCATTGGAAACCGTTTGCC
AACCTGAATGCTCTTCAACAAGCTAAACATGGCTTCGACGATGCCTGGCAGGCTGCTCGCGACATCACTCTGCGT
CTTTTTGCCAACGATGAGAGCCCCAGCGTGCAAAACACAATGTACAAAATGTGCGAGCAAGTTCTCGACGCTGTC
CCTGGAATTCAAGACGTGGCCTACTCGCTGCCTAATAAGCACAACTTTGAACTTGATTTGACCTGGCATAAAAAC
CTACACAATACCGGCCAGCATGCCGAGGTCTACGTGCCTCAGTCTAATCCGAATGGTCTCATCAAATGCCAAGTC
TCTCGCTCGTAG
Gene >OphauB2|3361
ATGCCCTACCGCCTCTCGGCCGCCCGCTACGGCAAAGACAATGTCCGCGTCCTCAAGGTTGCGCGCGACTCGGCC
ACGGGCGTGCAGACGGTGACAGAAATGACTGTCTGCTGCCTACTCGAGGGCGACATTGACGCTTCCTACACGCAC
GCCGACAACAAGGTGGTGGTGGCGACGGATTCCATCAAAAACACAATCTACATTCTTGCTCGTCAACACGCTGTC
AATCCCCCCGAGCTCTTTGCCGCAACAGTAGGCTCGCATTTTGTTGACACTTATGCCCACATCAATGCCGCCTCG
GTTTCCGTCATTGTCCATCGCTGGCTGCGCATGGATATTGCTGGCCAATCACATCCTCATAGCTTCATCAAGGAC
GCTGGCGAGACTCGCACCGCCCAAGTTTGCGTCCGTCGGAGCCAGCCTGGCAGCAGCCACGGCGCCATTGACTTG
AGCAGCTCCATTTCAGGTCTTTCTGTGCTCAAAACCACGGGCTCGGCTTTCCACGGCTTCATCCGAGACGAGTAC
ACCACGCTTCCCGAGACGTGGGATCGCATTCTCGCCACCGATGTCGACGCCACCTGGCATTGGAAACCGTTTGCC
AACCTGAATGCTCTTCAACAAGCTAAACATGGCTTCGACGATGCCTGGCAGGCTGCTCGCGACATCACTCTGCGT
CTTTTTGCCAACGATGAGAGCCCCAGCGTGCAAAACACAATGTACAAAATGTGCGAGCAAGTTCTCGACGCTGTC
CCTGGAATTCAAGACGTGGCCTACTCGCTGCCTAATAAGCACAACTTTGAACTTGGTTAGTCTCCAATGTCTTTC
CCACAGCCACCCACCCCTCTCACAAGCTTTGTCCTCGCACAGATTTGACCTGGCATAAAAACCTACACAATACCG
GCCAGCATGCCGAGGTCTACGTGCCTCAGTCTAATCCGAATGGTCTCATCAAATGCCAAGTCTCTCGCTCGTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail