Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|3354
Gene name
LocationContig_213:3496..5451
Strand+
Gene length (bp)1955
Transcript length (bp)1338
Coding sequence length (bp)1338
Protein length (aa) 446

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF20463 PDH_C Prephenate dehydrogenase, dimerization domain 8.5E-07 160 259

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|O60078|TYR1_SCHPO Probable prephenate dehydrogenase [NADP(+)] OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=tyr1 PE=2 SV=1 2 443 2.0E-168
sp|P20049|TYR1_YEAST Prephenate dehydrogenase [NADP(+)] OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TYR1 PE=1 SV=2 5 444 5.0E-163
sp|Q58029|Y612_METJA Probable arogenate/prephenate dehydrogenase OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=MJ0612 PE=3 SV=1 3 257 6.0E-16

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup4766
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|4512
Ophiocordyceps australis map64 (Brazil) OphauB2|3354 (this protein)
Ophiocordyceps camponoti-floridani Ophcf2|01759
Ophiocordyceps camponoti-rufipedis Ophun1|997
Ophiocordyceps kimflemingae Ophio5|4960
Ophiocordyceps subramaniannii Hirsu2|1006

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|3354
MQDFTVGLIGMGDMGKMYAERLSAAGWREDRYDSLKEKYAGTVNLEICRNGHLVSRASDFILYSVEAAVIGGVIA
QYGPSTKMGAIVGGQTSCKSPEIEAFEAHLPADVSIVSCHSLHGPSVDPRNQPLVLIQHRAPDEALQKVEAVLAC
LGSKYVYLTAQEHDRITADTQAVTHAAFLSMGKAWHANRQFPWELSRYVGGIENVKINTMLRIYSQKWHVYAGVA
ILNPEARKQIAQYAESVTQLYKLMLEGDMKGLRERVYLAREMVFGHATSSLLPSATGEITATSDNQSLAWKSRPL
IEADVLSSFSLGIPTNDCVSRPNNHLSLLAMVDCWAALGIVPYEHMLCSTPLFRLRLGVTEHLFRDSRLLDEALH
TAVHDKTYRSDDLEFTFAARGWAECVSLGHFETWKKRFISTQQFFEPRFAEAKTVGDQMMKKLLQSTQNT*
Coding >OphauB2|3354
ATGCAAGACTTCACCGTTGGCTTGATTGGCATGGGAGACATGGGCAAGATGTATGCCGAGCGGCTTTCTGCTGCT
GGCTGGAGAGAAGATAGATACGATAGCCTCAAAGAGAAATATGCTGGCACAGTTAACTTGGAAATCTGTCGCAAC
GGCCACCTTGTATCCCGGGCTAGCGACTTCATCCTGTACAGCGTCGAGGCTGCCGTAATAGGTGGTGTTATTGCC
CAATATGGACCTTCTACTAAGATGGGCGCCATTGTCGGCGGTCAGACTTCGTGCAAGTCTCCCGAGATTGAAGCC
TTCGAGGCACACCTTCCCGCCGACGTATCCATTGTCTCATGCCACTCACTGCATGGACCTAGCGTCGACCCGCGC
AACCAGCCGCTCGTGCTCATCCAGCACCGAGCTCCAGACGAGGCGTTGCAAAAGGTGGAGGCGGTACTGGCTTGC
TTGGGCTCCAAATATGTTTACCTGACGGCCCAGGAGCACGATCGCATCACAGCCGATACGCAGGCCGTCACCCAT
GCTGCCTTTCTTTCAATGGGAAAGGCCTGGCACGCCAACCGCCAGTTTCCCTGGGAACTAAGTCGCTACGTTGGC
GGTATCGAAAATGTCAAAATCAACACCATGCTACGCATATATAGCCAGAAGTGGCATGTTTATGCCGGTGTCGCA
ATTTTAAACCCAGAGGCAAGGAAGCAGATCGCCCAGTATGCCGAGAGCGTCACTCAGCTCTACAAGCTCATGCTC
GAGGGAGACATGAAGGGCCTTCGCGAGCGAGTCTACCTGGCCCGTGAAATGGTCTTTGGTCATGCTACGTCGTCT
TTATTGCCTTCTGCCACTGGAGAGATTACTGCTACTAGCGACAATCAATCTTTGGCCTGGAAATCGCGACCTCTA
ATTGAAGCCGATGTCTTGTCCTCCTTCTCCCTCGGCATTCCCACCAACGACTGTGTCTCGCGCCCCAATAATCAC
CTGTCTCTTCTTGCCATGGTTGATTGCTGGGCCGCGCTCGGCATTGTACCCTATGAACACATGCTTTGTAGCACG
CCTCTTTTTCGCCTCCGCCTTGGCGTCACCGAGCACCTTTTTCGAGACTCTCGCCTCCTCGATGAAGCTCTACAT
ACCGCCGTACACGACAAGACATACCGCAGCGACGATCTTGAGTTTACCTTTGCCGCCCGTGGCTGGGCAGAATGC
GTCTCACTCGGCCACTTTGAAACCTGGAAGAAGCGCTTTATCAGTACCCAACAATTCTTTGAGCCTCGGTTCGCA
GAGGCCAAAACTGTTGGTGATCAGATGATGAAGAAATTACTACAAAGCACACAAAACACTTGA
Transcript >OphauB2|3354
ATGCAAGACTTCACCGTTGGCTTGATTGGCATGGGAGACATGGGCAAGATGTATGCCGAGCGGCTTTCTGCTGCT
GGCTGGAGAGAAGATAGATACGATAGCCTCAAAGAGAAATATGCTGGCACAGTTAACTTGGAAATCTGTCGCAAC
GGCCACCTTGTATCCCGGGCTAGCGACTTCATCCTGTACAGCGTCGAGGCTGCCGTAATAGGTGGTGTTATTGCC
CAATATGGACCTTCTACTAAGATGGGCGCCATTGTCGGCGGTCAGACTTCGTGCAAGTCTCCCGAGATTGAAGCC
TTCGAGGCACACCTTCCCGCCGACGTATCCATTGTCTCATGCCACTCACTGCATGGACCTAGCGTCGACCCGCGC
AACCAGCCGCTCGTGCTCATCCAGCACCGAGCTCCAGACGAGGCGTTGCAAAAGGTGGAGGCGGTACTGGCTTGC
TTGGGCTCCAAATATGTTTACCTGACGGCCCAGGAGCACGATCGCATCACAGCCGATACGCAGGCCGTCACCCAT
GCTGCCTTTCTTTCAATGGGAAAGGCCTGGCACGCCAACCGCCAGTTTCCCTGGGAACTAAGTCGCTACGTTGGC
GGTATCGAAAATGTCAAAATCAACACCATGCTACGCATATATAGCCAGAAGTGGCATGTTTATGCCGGTGTCGCA
ATTTTAAACCCAGAGGCAAGGAAGCAGATCGCCCAGTATGCCGAGAGCGTCACTCAGCTCTACAAGCTCATGCTC
GAGGGAGACATGAAGGGCCTTCGCGAGCGAGTCTACCTGGCCCGTGAAATGGTCTTTGGTCATGCTACGTCGTCT
TTATTGCCTTCTGCCACTGGAGAGATTACTGCTACTAGCGACAATCAATCTTTGGCCTGGAAATCGCGACCTCTA
ATTGAAGCCGATGTCTTGTCCTCCTTCTCCCTCGGCATTCCCACCAACGACTGTGTCTCGCGCCCCAATAATCAC
CTGTCTCTTCTTGCCATGGTTGATTGCTGGGCCGCGCTCGGCATTGTACCCTATGAACACATGCTTTGTAGCACG
CCTCTTTTTCGCCTCCGCCTTGGCGTCACCGAGCACCTTTTTCGAGACTCTCGCCTCCTCGATGAAGCTCTACAT
ACCGCCGTACACGACAAGACATACCGCAGCGACGATCTTGAGTTTACCTTTGCCGCCCGTGGCTGGGCAGAATGC
GTCTCACTCGGCCACTTTGAAACCTGGAAGAAGCGCTTTATCAGTACCCAACAATTCTTTGAGCCTCGGTTCGCA
GAGGCCAAAACTGTTGGTGATCAGATGATGAAGAAATTACTACAAAGCACACAAAACACTTGA
Gene >OphauB2|3354
ATGCAAGACTTCACCGTTGGCTTGATTGGCATGGGAGACATGGGCAAGATGTATGCCGAGCGGCTTTCTGCTGCT
GGCTGGAGGTGAGTTGCTACCACTAGCGACGGTCTTTTGGTGCCCTGGTAAGTCTCGTTGGTGACTCCTCCTTTT
CCTTCTTTTTTCCTTTATAATGATGACTAGAGCGCATTTGGCTCGAGTATTGTCCAGGGGCTGCTTGGGCTCCGT
TCCGGCTCTCAGGCTTTACCCCTGGCTTTCGTTGATGAAAATGCTAGCTACCTTTTCATACTATTTGTCTGATTG
AACATCTTTTTTTAAATATTCATGATTTCTACGCTCGCATGCCATCCACGCTTATTCTGTATGCTGACGGTAGTC
TTTTTAGAACCCGTGAAAAACGAATGAATAAAAAAAATGACGACAGATTCGTGCACAAAACAGGCTTCTAGCCTG
CGATAGAGAAGATAGATACGATAGCCTCAAAGAGAAATATGCTGGCACAGTACGACTGCCCCCCGTCTTCATTTT
TTTTTGCCGGCTCCTCGACTCTCTGCCTTAATATGCTTCTCTAGTCTTTCTGCTTCATGGGCCAGGGTTGAACCA
CATCTAGCAACGTTTACTAAATGGTGCTCTTGTCAGGTTAACTTGGAAATCTGTCGCAACGGCCACCTTGTATCC
CGGGCTAGCGACTTCATCCTGTACAGCGTCGAGGCTGCCGTAATAGGTGGTGTTATTGCCCAATATGGACCTTGT
ATGATGAGCCAGTCTTGCCTTGCATCTCGTTGTGTCCATCGCCTTTGATGCGGCCTCCTCCCCTCCTAGTCATCA
ATGGATTCTTATCAAGAACTGTGCACACAGCTACTAAGATGGGCGCCATTGTCGGCGGTCAGACTTCGTGCAAGT
CTCCCGAGATTGAAGCCTTCGAGGCACACCTTCCCGCCGACGTATCCATTGTCTCATGCCACTCACTGCATGGAC
CTAGCGTCGACCCGCGCAACCAGCCGCTCGTGCTCATCCAGCACCGAGCTCCAGACGAGGCGTTGCAAAAGGTGG
AGGCGGTACTGGCTTGCTTGGGCTCCAAATATGTTTACCTGACGGCCCAGGAGCACGATCGCATCACAGCCGATA
CGCAGGCCGTCACCCATGCTGCCTTTCTTTCAATGGGAAAGGCCTGGCACGCCAACCGCCAGTTTCCCTGGGAAC
TAAGTCGCTACGTTGGCGGTATCGAAAATGTCAAAATCAACACCATGCTACGCATATATAGCCAGAAGTGGCATG
TTTATGCCGGTGTCGCAATTTTAAACCCAGAGGCAAGGAAGCAGATCGCCCAGTATGCCGAGAGCGTCACTCAGC
TCTACAAGCTCATGCTCGAGGGAGACATGAAGGGCCTTCGCGAGCGAGTCTACCTGGCCCGTGAAATGGTCTTTG
GTCATGCTACGTCGTCTTTATTGCCTTCTGCCACTGGAGAGATTACTGCTACTAGCGACAATCAATCTTTGGCCT
GGAAATCGCGACCTCTAATTGAAGCCGATGTCTTGTCCTCCTTCTCCCTCGGCATTCCCACCAACGACTGTGTCT
CGCGCCCCAATAATCACCTGTCTCTTCTTGCCATGGTTGATTGCTGGGCCGCGCTCGGCATTGTACCCTATGAAC
ACATGCTTTGTAGCACGCCTCTTTTTCGCCTCCGCCTTGGCGTCACCGAGCACCTTTTTCGAGACTCTCGCCTCC
TCGATGAAGCTCTACATACCGCCGTACACGACAAGACATACCGCAGCGACGATCTTGAGTTTACCTTTGCCGCCC
GTGGCTGGGCAGAATGCGTCTCACTCGGCCACTTTGAAACCTGGAAGAAGCGCTTTATCAGTACCCAACAATTCT
TTGAGCCTCGGTTCGCAGAGGCCAAAACTGTTGGTGATCAGATGATGAAGAAATTACTACAAAGCACACAAAACA
CTTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail