Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|335
Gene name
LocationContig_102:41858..42732
Strand+
Gene length (bp)874
Transcript length (bp)648
Coding sequence length (bp)648
Protein length (aa) 216

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00810 ER_lumen_recept ER lumen protein retaining receptor 3.6E-54 30 170

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O76767|ERD2_DROME ER lumen protein-retaining receptor OS=Drosophila melanogaster GN=KdelR PE=2 SV=1 3 214 4.0E-81
sp|O94270|ERD2_SCHPO ER lumen protein-retaining receptor OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=erd2 PE=3 SV=1 3 214 9.0E-80
sp|Q5XHA2|ERD21_XENTR ER lumen protein-retaining receptor 1 OS=Xenopus tropicalis GN=kdelr1 PE=2 SV=1 3 214 2.0E-76
sp|P18414|ERD2_YEAST ER lumen protein-retaining receptor OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ERD2 PE=3 SV=1 3 214 4.0E-76
sp|Q6PEH1|ERD22_DANRE ER lumen protein-retaining receptor 2 OS=Danio rerio GN=kdelr2 PE=2 SV=1 3 214 1.0E-75
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O76767|ERD2_DROME ER lumen protein-retaining receptor OS=Drosophila melanogaster GN=KdelR PE=2 SV=1 3 214 4.0E-81
sp|O94270|ERD2_SCHPO ER lumen protein-retaining receptor OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=erd2 PE=3 SV=1 3 214 9.0E-80
sp|Q5XHA2|ERD21_XENTR ER lumen protein-retaining receptor 1 OS=Xenopus tropicalis GN=kdelr1 PE=2 SV=1 3 214 2.0E-76
sp|P18414|ERD2_YEAST ER lumen protein-retaining receptor OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ERD2 PE=3 SV=1 3 214 4.0E-76
sp|Q6PEH1|ERD22_DANRE ER lumen protein-retaining receptor 2 OS=Danio rerio GN=kdelr2 PE=2 SV=1 3 214 1.0E-75
sp|Q5ZKX9|ERD22_CHICK ER lumen protein-retaining receptor 2 OS=Gallus gallus GN=KDELR2 PE=2 SV=1 3 214 4.0E-75
sp|Q6P257|ERD22_XENTR ER lumen protein-retaining receptor 2 OS=Xenopus tropicalis GN=kdelr2 PE=2 SV=1 3 214 8.0E-75
sp|Q68ES4|ER21B_XENLA ER lumen protein-retaining receptor 1-B OS=Xenopus laevis GN=kdelr1-b PE=2 SV=1 3 214 9.0E-75
sp|Q5U305|ERD22_RAT ER lumen protein-retaining receptor 2 OS=Rattus norvegicus GN=Kdelr2 PE=2 SV=1 3 214 3.0E-74
sp|Q9CQM2|ERD22_MOUSE ER lumen protein-retaining receptor 2 OS=Mus musculus GN=Kdelr2 PE=1 SV=1 3 214 3.0E-74
sp|Q2KJ37|ERD22_BOVIN ER lumen protein-retaining receptor 2 OS=Bos taurus GN=KDELR2 PE=2 SV=1 3 214 3.0E-74
sp|Q7ZXS5|ERD22_XENLA ER lumen protein-retaining receptor 2 OS=Xenopus laevis GN=kdelr2 PE=2 SV=1 3 214 8.0E-74
sp|P33947|ERD22_HUMAN ER lumen protein-retaining receptor 2 OS=Homo sapiens GN=KDELR2 PE=1 SV=1 3 214 9.0E-74
sp|Q6PAB8|ER21A_XENLA ER lumen protein-retaining receptor 1-A OS=Xenopus laevis GN=kdelr1-a PE=2 SV=1 3 214 1.0E-73
sp|P18413|ERD2_KLULA ER lumen protein-retaining receptor OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=ERD2 PE=3 SV=1 3 214 4.0E-72
sp|Q611C8|ERD2_CAEBR ER lumen protein-retaining receptor OS=Caenorhabditis briggsae GN=erd-2 PE=3 SV=1 3 210 3.0E-71
sp|O43731|ERD23_HUMAN ER lumen protein-retaining receptor 3 OS=Homo sapiens GN=KDELR3 PE=2 SV=1 3 215 1.0E-70
sp|Q8R1L4|ERD23_MOUSE ER lumen protein-retaining receptor 3 OS=Mus musculus GN=Kdelr3 PE=1 SV=1 3 215 4.0E-70
sp|P48583|ERD2_CAEEL ER lumen protein-retaining receptor OS=Caenorhabditis elegans GN=erd-2 PE=3 SV=2 3 210 2.0E-69
sp|Q569A6|ERD21_RAT ER lumen protein-retaining receptor 1 OS=Rattus norvegicus GN=Kdelr1 PE=2 SV=1 3 214 5.0E-69
sp|P24390|ERD21_HUMAN ER lumen protein-retaining receptor 1 OS=Homo sapiens GN=KDELR1 PE=1 SV=1 3 214 6.0E-69
sp|Q99JH8|ERD21_MOUSE ER lumen protein-retaining receptor 1 OS=Mus musculus GN=Kdelr1 PE=1 SV=1 3 214 8.0E-69
sp|P33946|ERD21_BOVIN ER lumen protein-retaining receptor 1 OS=Bos taurus GN=KDELR1 PE=2 SV=2 3 214 1.0E-68
sp|Q66JF2|ERD23_XENTR ER lumen protein-retaining receptor 3 OS=Xenopus tropicalis GN=kdelr3 PE=2 SV=1 3 215 2.0E-67
sp|O42580|ERD23_XENLA ER lumen protein-retaining receptor 3 OS=Xenopus laevis GN=kdelr3 PE=2 SV=1 3 215 8.0E-67
sp|P35402|ERD2A_ARATH ER lumen protein-retaining receptor A OS=Arabidopsis thaliana GN=ERD2A PE=2 SV=1 3 214 8.0E-67
sp|Q09473|ERD22_CAEEL Putative ER lumen protein-retaining receptor C28H8.4 OS=Caenorhabditis elegans GN=C28H8.4 PE=3 SV=1 3 215 1.0E-65
sp|Q8VWI1|ERD2B_ARATH ER lumen protein-retaining receptor B OS=Arabidopsis thaliana GN=ERD2B PE=1 SV=1 3 214 1.0E-64
sp|Q6PFS5|ERD23_DANRE ER lumen protein-retaining receptor 3 OS=Danio rerio GN=kdelr3 PE=2 SV=1 3 215 1.0E-63
sp|Q9ZTN2|ERD2_PETHY ER lumen protein-retaining receptor OS=Petunia hybrida GN=ERD2 PE=2 SV=1 3 214 4.0E-63
sp|O44017|ERD2_ENTHI ER lumen protein-retaining receptor OS=Entamoeba histolytica GN=ERD2 PE=3 SV=1 1 214 5.0E-62
sp|Q86JE5|ERD2_DICDI ER lumen protein-retaining receptor OS=Dictyostelium discoideum GN=kdelr PE=3 SV=1 3 214 2.0E-56
sp|P33948|ERD2_PLAFA ER lumen protein-retaining receptor OS=Plasmodium falciparum GN=ERD2 PE=2 SV=1 3 214 4.0E-52
sp|Q76NM1|ERD2_PLAF7 ER lumen protein-retaining receptor OS=Plasmodium falciparum (isolate 3D7) GN=ERD2 PE=3 SV=1 3 214 4.0E-52
[Show less]

GO

GO Term Description Terminal node
GO:0016021 integral component of membrane Yes
GO:0046923 ER retention sequence binding Yes
GO:0006621 protein retention in ER lumen Yes
GO:0042277 peptide binding No
GO:0045185 maintenance of protein location No
GO:0005575 cellular_component No
GO:0008150 biological_process No
GO:0005488 binding No
GO:0035437 maintenance of protein localization in endoplasmic reticulum No
GO:0003674 molecular_function No
GO:0051235 maintenance of location No
GO:0033218 amide binding No
GO:0051651 maintenance of location in cell No
GO:0009987 cellular process No
GO:0031224 intrinsic component of membrane No
GO:0072595 maintenance of protein localization in organelle No
GO:0051179 localization No
GO:0032507 maintenance of protein location in cell No
GO:0005048 signal sequence binding No
GO:0110165 cellular anatomical entity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 34 0.5

Transmembrane Domains

Domain # Start End Length
1 58 80 22
2 95 112 17
3 119 137 18
4 147 169 22
5 181 203 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|335
MTLNLFRVAGDFSHLASILILLHKMVQLNSCSGISFKSQALYFIVYVTRYLDLFSTESLYNLCFKILFIGSQGYI
LYLMTNAYKPTNDPNVDTFRVQYLLAGAAVLAILFPYKYTFSEILWAFSIWLEAVAILPQLFMLQRTGEAETITT
HYLFALGLYRALYIPNWVYRYFSEPTHKPDWIAIVAGLIQTVLYSDFFYVYYTKVLKGKKFKLPV*
Coding >OphauB2|335
ATGACGCTCAATCTTTTCCGGGTTGCCGGTGACTTCTCGCATCTGGCGAGCATTCTCATTCTATTGCACAAGATG
GTGCAGCTCAATAGCTGCTCGGGGATCTCGTTTAAATCACAAGCTCTTTACTTCATTGTCTACGTCACAAGATAT
CTAGACCTCTTTTCGACCGAGAGCCTCTACAACCTTTGCTTCAAAATCCTCTTCATCGGATCGCAAGGCTATATC
CTTTACCTCATGACAAATGCATACAAGCCAACAAACGATCCCAATGTCGACACCTTTCGCGTTCAGTACCTTCTC
GCTGGTGCCGCCGTCCTGGCAATCTTGTTCCCCTACAAATACACATTTTCCGAGATACTCTGGGCCTTTTCGATT
TGGCTAGAGGCCGTGGCCATTCTGCCGCAGCTCTTCATGCTACAACGCACAGGCGAGGCCGAAACTATCACGACG
CACTATCTCTTTGCCCTGGGCCTCTATCGTGCCCTCTACATACCCAATTGGGTCTACCGCTACTTTTCCGAGCCT
ACGCACAAGCCCGATTGGATTGCCATTGTTGCTGGTCTCATCCAAACCGTCCTCTACAGCGACTTCTTTTACGTC
TACTACACCAAAGTGCTCAAAGGCAAAAAGTTCAAGCTGCCAGTATAA
Transcript >OphauB2|335
ATGACGCTCAATCTTTTCCGGGTTGCCGGTGACTTCTCGCATCTGGCGAGCATTCTCATTCTATTGCACAAGATG
GTGCAGCTCAATAGCTGCTCGGGGATCTCGTTTAAATCACAAGCTCTTTACTTCATTGTCTACGTCACAAGATAT
CTAGACCTCTTTTCGACCGAGAGCCTCTACAACCTTTGCTTCAAAATCCTCTTCATCGGATCGCAAGGCTATATC
CTTTACCTCATGACAAATGCATACAAGCCAACAAACGATCCCAATGTCGACACCTTTCGCGTTCAGTACCTTCTC
GCTGGTGCCGCCGTCCTGGCAATCTTGTTCCCCTACAAATACACATTTTCCGAGATACTCTGGGCCTTTTCGATT
TGGCTAGAGGCCGTGGCCATTCTGCCGCAGCTCTTCATGCTACAACGCACAGGCGAGGCCGAAACTATCACGACG
CACTATCTCTTTGCCCTGGGCCTCTATCGTGCCCTCTACATACCCAATTGGGTCTACCGCTACTTTTCCGAGCCT
ACGCACAAGCCCGATTGGATTGCCATTGTTGCTGGTCTCATCCAAACCGTCCTCTACAGCGACTTCTTTTACGTC
TACTACACCAAAGTGCTCAAAGGCAAAAAGTTCAAGCTGCCAGTATAA
Gene >OphauB2|335
ATGACGCTCAATCTTTTCCGGGTTGCCGGTGCGTCCGGCCACATCTCCCAAAAGACCTTTGATGGCCCGTGTGCG
CTGACCAAAATGTCCTGAATAGGTGACTTCTCGCATCTGGCGAGCATTCTCATTCTATTGCACAAGATGGTGCAG
CTCAATGTAGGTGCGAGCCTGTAATGGTGTCAAATTTCGTCGGCTAATGACTTGCAGAGCTGCTCGGGGATCTCG
TTTAAATCACAAGCTCTTTACTTCATTGTCTACGTCACAAGATATCTAGGTATGTCTTGATCATTTCCAATCAAT
TCCTCGCACACCATAATCTGCTGTCGCTATCTTTCAATACCCAAGTTTTTCTACCTTTTTCCGCTAACCATTTGG
GACAGACCTCTTTTCGACCGAGAGCCTCTACAACCTTTGCTTCAAAATCCTCTTCATCGGATCGCAAGGCTATAT
CCTTTACCTCATGACAAATGCATACAAGCCAACAAACGATCCCAATGTCGACACCTTTCGCGTTCAGTACCTTCT
CGCTGGTGCCGCCGTCCTGGCAATCTTGTTCCCCTACAAATACACATTTTCCGAGATACTCTGGGCCTTTTCGAT
TTGGCTAGAGGCCGTGGCCATTCTGCCGCAGCTCTTCATGCTACAACGCACAGGCGAGGCCGAAACTATCACGAC
GCACTATCTCTTTGCCCTGGGCCTCTATCGTGCCCTCTACATACCCAATTGGGTCTACCGCTACTTTTCCGAGCC
TACGCACAAGCCCGATTGGATTGCCATTGTTGCTGGTCTCATCCAAACCGTCCTCTACAGCGACTTCTTTTACGT
CTACTACACCAAAGTGCTCAAAGGCAAAAAGTTCAAGCTGCCAGTATAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail