Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|3347
Gene name
LocationContig_212:9254..11945
Strand+
Gene length (bp)2691
Transcript length (bp)2034
Coding sequence length (bp)2034
Protein length (aa) 678

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00083 Sugar_tr Sugar (and other) transporter 4.2E-64 140 564

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9XIH6|PLT2_ARATH Putative polyol transporter 2 OS=Arabidopsis thaliana GN=PLT2 PE=3 SV=1 110 565 7.0E-34
sp|Q9XIH7|PLT1_ARATH Putative polyol transporter 1 OS=Arabidopsis thaliana GN=PLT1 PE=3 SV=1 110 565 2.0E-32
sp|C0SPB2|YWTG_BACSU Putative metabolite transport protein YwtG OS=Bacillus subtilis (strain 168) GN=ywtG PE=3 SV=1 110 562 1.0E-27
sp|Q9ZNS0|PLT3_ARATH Probable polyol transporter 3 OS=Arabidopsis thaliana GN=PLT3 PE=3 SV=1 117 564 5.0E-27
sp|Q8VZ80|PLT5_ARATH Polyol transporter 5 OS=Arabidopsis thaliana GN=PLT5 PE=1 SV=2 160 599 1.0E-26
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9XIH6|PLT2_ARATH Putative polyol transporter 2 OS=Arabidopsis thaliana GN=PLT2 PE=3 SV=1 110 565 7.0E-34
sp|Q9XIH7|PLT1_ARATH Putative polyol transporter 1 OS=Arabidopsis thaliana GN=PLT1 PE=3 SV=1 110 565 2.0E-32
sp|C0SPB2|YWTG_BACSU Putative metabolite transport protein YwtG OS=Bacillus subtilis (strain 168) GN=ywtG PE=3 SV=1 110 562 1.0E-27
sp|Q9ZNS0|PLT3_ARATH Probable polyol transporter 3 OS=Arabidopsis thaliana GN=PLT3 PE=3 SV=1 117 564 5.0E-27
sp|Q8VZ80|PLT5_ARATH Polyol transporter 5 OS=Arabidopsis thaliana GN=PLT5 PE=1 SV=2 160 599 1.0E-26
sp|P45598|ARAE_KLEOX Arabinose-proton symporter OS=Klebsiella oxytoca GN=araE PE=3 SV=1 93 562 1.0E-26
sp|P87110|ITR2_SCHPO Myo-inositol transporter 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=itr2 PE=2 SV=1 145 563 2.0E-26
sp|O74849|GHT6_SCHPO High-affinity fructose transporter ght6 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ght6 PE=1 SV=1 149 564 5.0E-26
sp|Q8GXR2|PLT6_ARATH Probable polyol transporter 6 OS=Arabidopsis thaliana GN=PLT6 PE=2 SV=2 110 564 7.0E-26
sp|Q8TFG1|GHT7_SCHPO Probable high-affinity hexose transporter ght7 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ght7 PE=3 SV=1 146 625 8.0E-26
sp|P0AE24|ARAE_ECOLI Arabinose-proton symporter OS=Escherichia coli (strain K12) GN=araE PE=1 SV=1 93 562 2.0E-25
sp|P0AE25|ARAE_ECO57 Arabinose-proton symporter OS=Escherichia coli O157:H7 GN=araE PE=3 SV=1 93 562 2.0E-25
sp|Q01440|GTR1_LEIDO Membrane transporter D1 OS=Leishmania donovani PE=3 SV=1 91 564 2.0E-25
sp|P46333|CSBC_BACSU Probable metabolite transport protein CsbC OS=Bacillus subtilis (strain 168) GN=csbC PE=1 SV=3 116 561 1.0E-23
sp|P43581|HXT10_YEAST Hexose transporter HXT10 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HXT10 PE=1 SV=1 161 604 2.0E-23
sp|O74969|GHT2_SCHPO High-affinity glucose transporter ght2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ght2 PE=1 SV=1 146 564 6.0E-23
sp|Q9P3U6|GHT1_SCHPO High-affinity glucose transporter ght1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ght1 PE=1 SV=1 146 564 6.0E-23
sp|Q8MKK4|TRE12_DROME Facilitated trehalose transporter Tret1-2 homolog OS=Drosophila melanogaster GN=Tret1-2 PE=2 SV=1 92 562 9.0E-23
sp|P40886|HXT8_YEAST Hexose transporter HXT8 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HXT8 PE=1 SV=1 149 594 9.0E-23
sp|Q0WWW9|XYLL3_ARATH D-xylose-proton symporter-like 3, chloroplastic OS=Arabidopsis thaliana GN=At5g59250 PE=2 SV=2 123 561 2.0E-22
sp|Q8VZR6|INT1_ARATH Inositol transporter 1 OS=Arabidopsis thaliana GN=INT1 PE=1 SV=1 157 563 5.0E-22
sp|Q6AWX0|XYLL2_ARATH D-xylose-proton symporter-like 2 OS=Arabidopsis thaliana GN=At5g17010 PE=1 SV=1 144 561 8.0E-22
sp|A9ZSY3|TRET1_BOMMO Facilitated trehalose transporter Tret1 OS=Bombyx mori GN=Tret1 PE=1 SV=1 145 570 9.0E-22
sp|P0AEP1|GALP_ECOLI Galactose-proton symporter OS=Escherichia coli (strain K12) GN=galP PE=1 SV=1 110 562 1.0E-21
sp|P0AEP2|GALP_ECOL6 Galactose-proton symporter OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=galP PE=3 SV=1 110 562 1.0E-21
sp|P78831|GHT5_SCHPO High-affinity glucose transporter ght5 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ght5 PE=1 SV=2 146 564 2.0E-21
sp|P30606|ITR2_YEAST Myo-inositol transporter 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ITR2 PE=1 SV=2 161 563 2.0E-21
sp|P23585|HXT2_YEAST High-affinity glucose transporter HXT2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HXT2 PE=1 SV=1 161 564 2.0E-21
sp|P53387|KHT2_KLULC Hexose transporter 2 OS=Kluyveromyces lactis GN=KHT2 PE=3 SV=1 161 594 2.0E-21
sp|O59932|GHT4_SCHPO High-affinity hexose transporter ght4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ght4 PE=3 SV=2 125 564 2.0E-21
sp|P13181|GAL2_YEAST Galactose transporter OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GAL2 PE=1 SV=3 161 603 3.0E-21
sp|Q92253|RCO3_NEUCR Probable glucose transporter rco-3 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=rco-3 PE=3 SV=2 149 564 7.0E-21
sp|B4QBN2|TRE11_DROSI Facilitated trehalose transporter Tret1-1 OS=Drosophila simulans GN=Tret1-1 PE=3 SV=2 156 562 8.0E-21
sp|P30605|ITR1_YEAST Myo-inositol transporter 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ITR1 PE=1 SV=2 161 603 2.0E-20
sp|Q8L6Z8|XYLL1_ARATH D-xylose-proton symporter-like 1 OS=Arabidopsis thaliana GN=At3g03090 PE=2 SV=1 144 561 2.0E-20
sp|B0WC46|TRET1_CULQU Facilitated trehalose transporter Tret1 OS=Culex quinquefasciatus GN=Tret1 PE=3 SV=1 44 562 2.0E-20
sp|P58353|GTR5_BOVIN Solute carrier family 2, facilitated glucose transporter member 5 OS=Bos taurus GN=SLC2A5 PE=1 SV=2 123 594 2.0E-20
sp|Q8WMN1|GTR5_SHEEP Solute carrier family 2, facilitated glucose transporter member 5 OS=Ovis aries GN=SLC2A5 PE=2 SV=1 87 564 3.0E-20
sp|B4HNS1|TRE12_DROSE Facilitated trehalose transporter Tret1-2 homolog OS=Drosophila sechellia GN=Tret1-2 PE=3 SV=1 92 562 3.0E-20
sp|Q9SX48|STP9_ARATH Sugar transport protein 9 OS=Arabidopsis thaliana GN=STP9 PE=1 SV=1 141 563 3.0E-20
sp|P43427|GTR5_RAT Solute carrier family 2, facilitated glucose transporter member 5 OS=Rattus norvegicus GN=Slc2a5 PE=1 SV=1 162 569 6.0E-20
sp|A9ZSY2|TRET1_APILI Facilitated trehalose transporter Tret1 OS=Apis mellifera ligustica GN=Tret1 PE=1 SV=1 93 570 7.0E-20
sp|B4QBN3|TRE12_DROSI Facilitated trehalose transporter Tret1-2 homolog OS=Drosophila simulans GN=Tret1-2 PE=3 SV=1 92 562 9.0E-20
sp|B4HNS0|TRE11_DROSE Facilitated trehalose transporter Tret1-1 OS=Drosophila sechellia GN=Tret1-1 PE=3 SV=1 41 562 1.0E-19
sp|P40885|HXT9_YEAST Hexose transporter HXT9 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HXT9 PE=1 SV=1 161 564 1.0E-19
sp|P54723|YFIG_BACSU Putative metabolite transport protein YfiG OS=Bacillus subtilis (strain 168) GN=yfiG PE=3 SV=1 66 570 1.0E-19
sp|O04249|STP7_ARATH Sugar transport protein 7 OS=Arabidopsis thaliana GN=STP7 PE=2 SV=1 123 560 1.0E-19
sp|P15325|QUTD_EMENI Quinate permease OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=qutD PE=1 SV=2 146 619 1.0E-19
sp|B3NSE1|TRET1_DROER Facilitated trehalose transporter Tret1 OS=Drosophila erecta GN=Tret1 PE=3 SV=1 156 562 1.0E-19
sp|Q7PIR5|TRET1_ANOGA Facilitated trehalose transporter Tret1 OS=Anopheles gambiae GN=Tret1 PE=1 SV=3 156 562 2.0E-19
sp|P54862|HXT11_YEAST Hexose transporter HXT11 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HXT11 PE=1 SV=1 161 561 2.0E-19
sp|Q9P3U7|GHT8_SCHPO Probable high-affinity hexose transporter ght8, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ght8 PE=1 SV=1 146 649 5.0E-19
sp|Q4U3U4|QAY_NEUTR Quinate permease OS=Neurospora terricola GN=qa-y PE=3 SV=1 146 567 6.0E-19
sp|Q92339|GHT3_SCHPO High-affinity gluconate transporter ght3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ght3 PE=3 SV=1 125 564 6.0E-19
sp|B4P624|TRET1_DROYA Facilitated trehalose transporter Tret1 OS=Drosophila yakuba GN=Tret1 PE=3 SV=1 156 562 6.0E-19
sp|Q4U3U6|QAY_NEUAF Quinate permease OS=Neurospora africana GN=qa-y PE=3 SV=1 146 567 7.0E-19
sp|P49374|HGT1_KLULA High-affinity glucose transporter OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=HGT1 PE=3 SV=1 146 564 7.0E-19
sp|P11636|QAY_NEUCR Quinate permease OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=qa-y PE=3 SV=2 146 567 8.0E-19
sp|Q10710|STA_RICCO Sugar carrier protein A OS=Ricinus communis GN=STA PE=2 SV=1 131 560 1.0E-18
sp|Q0WUU6|PLT4_ARATH Probable polyol transporter 4 OS=Arabidopsis thaliana GN=PLT4 PE=2 SV=1 162 564 1.0E-18
sp|A5LGM7|TRET1_POLVA Facilitated trehalose transporter Tret1 OS=Polypedilum vanderplanki GN=Tret1 PE=1 SV=1 156 562 1.0E-18
sp|Q6MYX6|QUTD_ASPFU Probable quinate permease OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=qutD PE=3 SV=1 156 564 2.0E-18
sp|A1Z8N1|TRE11_DROME Facilitated trehalose transporter Tret1-1 OS=Drosophila melanogaster GN=Tret1-1 PE=1 SV=1 156 562 2.0E-18
sp|Q10286|ITR1_SCHPO Myo-inositol transporter 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=itr1 PE=3 SV=1 146 568 3.0E-18
sp|Q9LT15|STP10_ARATH Sugar transport protein 10 OS=Arabidopsis thaliana GN=STP10 PE=2 SV=1 119 563 3.0E-18
sp|Q17NV8|TRET1_AEDAE Facilitated trehalose transporter Tret1 OS=Aedes aegypti GN=Tret1 PE=3 SV=1 160 562 3.0E-18
sp|O44827|FGT1_CAEEL Facilitated glucose transporter protein 1 OS=Caenorhabditis elegans GN=fgt-1 PE=1 SV=2 162 570 5.0E-18
sp|A2QQV6|QUTD_ASPNC Probable quinate permease OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=qutD PE=3 SV=1 156 564 6.0E-18
sp|O34718|IOLT_BACSU Major myo-inositol transporter IolT OS=Bacillus subtilis (strain 168) GN=iolT PE=2 SV=1 141 564 6.0E-18
sp|Q291H8|TRET1_DROPS Facilitated trehalose transporter Tret1 OS=Drosophila pseudoobscura pseudoobscura GN=Tret1 PE=3 SV=3 156 562 6.0E-18
sp|B4GAP7|TRET1_DROPE Facilitated trehalose transporter Tret1 OS=Drosophila persimilis GN=Tret1 PE=3 SV=2 156 562 6.0E-18
sp|Q12300|RGT2_YEAST High-affinity glucose transporter RGT2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RGT2 PE=1 SV=1 213 593 7.0E-18
sp|B4MYA4|TRET1_DROWI Facilitated trehalose transporter Tret1 OS=Drosophila willistoni GN=Tret1 PE=3 SV=1 156 562 8.0E-18
sp|A1D2R3|QUTD_NEOFI Probable quinate permease OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=qutD PE=3 SV=1 146 564 9.0E-18
sp|P32466|HXT3_YEAST Low-affinity glucose transporter HXT3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HXT3 PE=1 SV=1 185 593 1.0E-17
sp|P32465|HXT1_YEAST Low-affinity glucose transporter HXT1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HXT1 PE=1 SV=1 161 593 2.0E-17
sp|Q0D135|QUTD_ASPTN Probable quinate permease OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=qutD PE=3 SV=1 156 564 2.0E-17
sp|B3MG58|TRET1_DROAN Facilitated trehalose transporter Tret1 OS=Drosophila ananassae GN=Tret1 PE=3 SV=2 156 562 2.0E-17
sp|Q2U2Y9|QUTD_ASPOR Probable quinate permease OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=qutD PE=3 SV=1 156 564 2.0E-17
sp|B8NIM7|QUTD_ASPFN Probable quinate permease OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / NRRL 3357 / JCM 12722 / SRRC 167) GN=qutD PE=3 SV=1 156 564 2.0E-17
sp|P10870|SNF3_YEAST High-affinity glucose transporter SNF3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SNF3 PE=1 SV=3 144 567 2.0E-17
sp|P32467|HXT4_YEAST Low-affinity glucose transporter HXT4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HXT4 PE=1 SV=1 185 564 2.0E-17
sp|A6ZT02|HXT4_YEAS7 Low-affinity glucose transporter HXT4 OS=Saccharomyces cerevisiae (strain YJM789) GN=HXT4 PE=3 SV=1 185 564 2.0E-17
sp|P47842|GTR3_CANLF Solute carrier family 2, facilitated glucose transporter member 3 OS=Canis lupus familiaris GN=SLC2A3 PE=2 SV=1 161 564 4.0E-17
sp|P38695|HXT5_YEAST Probable glucose transporter HXT5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HXT5 PE=1 SV=1 161 603 4.0E-17
sp|A1CPX0|QUTD_ASPCL Probable quinate permease OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=qutD PE=3 SV=1 156 564 4.0E-17
sp|B4KR05|TRET1_DROMO Facilitated trehalose transporter Tret1 OS=Drosophila mojavensis GN=Tret1 PE=3 SV=2 41 562 5.0E-17
sp|C7GWV6|HXT4_YEAS2 Low-affinity glucose transporter HXT4 OS=Saccharomyces cerevisiae (strain JAY291) GN=HXT4 PE=3 SV=1 185 564 7.0E-17
sp|P39003|HXT6_YEAST High-affinity hexose transporter HXT6 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HXT6 PE=1 SV=2 185 593 8.0E-17
sp|P39004|HXT7_YEAST High-affinity hexose transporter HXT6 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HXT7 PE=1 SV=1 185 593 8.0E-17
sp|Q41144|STC_RICCO Sugar carrier protein C OS=Ricinus communis GN=STC PE=2 SV=1 144 564 8.0E-17
sp|P54854|HXT15_YEAST Hexose transporter HXT15 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HXT15 PE=1 SV=1 162 564 9.0E-17
sp|Q9WV38|GTR5_MOUSE Solute carrier family 2, facilitated glucose transporter member 5 OS=Mus musculus GN=Slc2a5 PE=1 SV=2 162 569 1.0E-16
sp|P13355|GTR1_RABIT Solute carrier family 2, facilitated glucose transporter member 1 OS=Oryctolagus cuniculus GN=SLC2A1 PE=2 SV=1 161 564 1.0E-16
sp|P47185|HXT16_YEAST Hexose transporter HXT16 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HXT16 PE=3 SV=1 162 564 1.0E-16
sp|P42833|HXT14_YEAST Hexose transporter HXT14 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HXT14 PE=1 SV=2 157 564 1.0E-16
sp|P53631|HXT17_YEAST Hexose transporter HXT17 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HXT17 PE=3 SV=1 162 564 2.0E-16
sp|P11168|GTR2_HUMAN Solute carrier family 2, facilitated glucose transporter member 2 OS=Homo sapiens GN=SLC2A2 PE=1 SV=1 104 560 2.0E-16
sp|P93051|ERDL7_ARATH Sugar transporter ERD6-like 7 OS=Arabidopsis thaliana GN=At2g48020 PE=2 SV=2 145 563 2.0E-16
sp|P0AGF4|XYLE_ECOLI D-xylose-proton symporter OS=Escherichia coli (strain K12) GN=xylE PE=1 SV=1 146 570 3.0E-16
sp|P0AGF5|XYLE_ECO57 D-xylose-proton symporter OS=Escherichia coli O157:H7 GN=xylE PE=3 SV=1 146 570 3.0E-16
sp|Q9FRL3|ERDL6_ARATH Sugar transporter ERD6-like 6 OS=Arabidopsis thaliana GN=At1g75220 PE=1 SV=1 146 564 3.0E-16
sp|P39924|HXT13_YEAST Hexose transporter HXT13 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HXT13 PE=1 SV=1 162 564 4.0E-16
sp|B4LPX5|TRET1_DROVI Facilitated trehalose transporter Tret1 OS=Drosophila virilis GN=Tret1 PE=3 SV=2 156 562 4.0E-16
sp|P18631|RAG1_KLULA Low-affinity glucose transporter OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=RAG1 PE=1 SV=1 184 593 7.0E-16
sp|P58351|GTR2_BOVIN Solute carrier family 2, facilitated glucose transporter member 2 OS=Bos taurus GN=SLC2A2 PE=2 SV=2 104 503 7.0E-16
sp|P20303|GTR1_PIG Solute carrier family 2, facilitated glucose transporter member 1 OS=Sus scrofa GN=SLC2A1 PE=2 SV=2 161 564 9.0E-16
sp|Q8GW61|STP14_ARATH Sugar transport protein 14 OS=Arabidopsis thaliana GN=STP14 PE=2 SV=2 141 560 1.0E-15
sp|P14246|GTR2_MOUSE Solute carrier family 2, facilitated glucose transporter member 2 OS=Mus musculus GN=Slc2a2 PE=1 SV=3 108 560 1.0E-15
sp|P27674|GTR1_BOVIN Solute carrier family 2, facilitated glucose transporter member 1 OS=Bos taurus GN=SLC2A1 PE=1 SV=1 161 564 1.0E-15
sp|P47843|GTR3_SHEEP Solute carrier family 2, facilitated glucose transporter member 3 OS=Ovis aries GN=SLC2A3 PE=2 SV=1 161 564 1.0E-15
sp|Q07647|GTR3_RAT Solute carrier family 2, facilitated glucose transporter member 3 OS=Rattus norvegicus GN=Slc2a3 PE=1 SV=1 161 564 1.0E-15
sp|Q6NWF1|GTR12_DANRE Solute carrier family 2, facilitated glucose transporter member 12 OS=Danio rerio GN=slc2a12 PE=2 SV=2 161 459 2.0E-15
sp|Q5R608|GTR3_PONAB Solute carrier family 2, facilitated glucose transporter member 3 OS=Pongo abelii GN=SLC2A3 PE=2 SV=1 185 564 2.0E-15
sp|P11167|GTR1_RAT Solute carrier family 2, facilitated glucose transporter member 1 OS=Rattus norvegicus GN=Slc2a1 PE=1 SV=1 161 564 2.0E-15
sp|P12336|GTR2_RAT Solute carrier family 2, facilitated glucose transporter member 2 OS=Rattus norvegicus GN=Slc2a2 PE=2 SV=1 108 560 3.0E-15
sp|P32037|GTR3_MOUSE Solute carrier family 2, facilitated glucose transporter member 3 OS=Mus musculus GN=Slc2a3 PE=1 SV=1 161 564 3.0E-15
sp|P11169|GTR3_HUMAN Solute carrier family 2, facilitated glucose transporter member 3 OS=Homo sapiens GN=SLC2A3 PE=1 SV=1 185 564 4.0E-15
sp|Q39525|HUP3_PARKE H(+)/hexose cotransporter 3 OS=Parachlorella kessleri GN=HUP3 PE=2 SV=1 121 565 5.0E-15
sp|P17809|GTR1_MOUSE Solute carrier family 2, facilitated glucose transporter member 1 OS=Mus musculus GN=Slc2a1 PE=1 SV=4 161 564 6.0E-15
sp|Q56ZZ7|PLST4_ARATH Plastidic glucose transporter 4 OS=Arabidopsis thaliana GN=At5g16150 PE=1 SV=2 194 561 8.0E-15
sp|B0XQS8|QUTD_ASPFC Probable quinate permease OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=qutD PE=3 SV=1 156 564 9.0E-15
sp|P11166|GTR1_HUMAN Solute carrier family 2, facilitated glucose transporter member 1 OS=Homo sapiens GN=SLC2A1 PE=1 SV=2 161 564 1.0E-14
sp|P28568|GTR3_CHICK Solute carrier family 2, facilitated glucose transporter member 3 OS=Gallus gallus GN=SLC2A3 PE=2 SV=1 161 564 1.0E-14
sp|P0C6A1|GTR7_MOUSE Solute carrier family 2, facilitated glucose transporter member 7 OS=Mus musculus GN=Slc2a7 PE=3 SV=1 153 574 1.0E-14
sp|Q8IRI6|GTR1_DROME Glucose transporter type 1 OS=Drosophila melanogaster GN=Glut1 PE=2 SV=4 161 564 1.0E-14
sp|Q90592|GTR2_CHICK Solute carrier family 2, facilitated glucose transporter member 2 OS=Gallus gallus GN=SLC2A2 PE=2 SV=1 160 568 1.0E-14
sp|P58352|GTR3_BOVIN Solute carrier family 2, facilitated glucose transporter member 3 OS=Bos taurus GN=SLC2A3 PE=2 SV=1 161 564 1.0E-14
sp|Q93YP9|ERDL4_ARATH Sugar transporter ERD6-like 4 OS=Arabidopsis thaliana GN=At1g19450 PE=2 SV=1 146 564 2.0E-14
sp|A4ZYQ5|GTR7_RAT Solute carrier family 2, facilitated glucose transporter member 7 OS=Rattus norvegicus GN=Slc2a7 PE=2 SV=1 162 569 2.0E-14
sp|P15686|HUP1_PARKE H(+)/hexose cotransporter 1 OS=Parachlorella kessleri GN=HUP1 PE=2 SV=2 141 565 2.0E-14
sp|Q6PXP3|GTR7_HUMAN Solute carrier family 2, facilitated glucose transporter member 7 OS=Homo sapiens GN=SLC2A7 PE=2 SV=2 162 569 2.0E-14
sp|O04036|ERD6_ARATH Sugar transporter ERD6 OS=Arabidopsis thaliana GN=ERD6 PE=1 SV=3 146 563 2.0E-14
sp|P23586|STP1_ARATH Sugar transport protein 1 OS=Arabidopsis thaliana GN=STP1 PE=1 SV=2 144 564 2.0E-14
sp|P79365|GTR1_SHEEP Solute carrier family 2, facilitated glucose transporter member 1 (Fragment) OS=Ovis aries GN=SLC2A1 PE=2 SV=1 185 560 2.0E-14
sp|Q5RB09|GTR9_PONAB Solute carrier family 2, facilitated glucose transporter member 9 OS=Pongo abelii GN=SLC2A9 PE=2 SV=1 96 571 2.0E-14
sp|Q8GXK5|EDL14_ARATH Sugar transporter ERD6-like 14 OS=Arabidopsis thaliana GN=At4g04750 PE=2 SV=2 162 570 3.0E-14
sp|Q39228|STP4_ARATH Sugar transport protein 4 OS=Arabidopsis thaliana GN=STP4 PE=1 SV=1 121 563 3.0E-14
sp|O65413|STP12_ARATH Sugar transport protein 12 OS=Arabidopsis thaliana GN=STP12 PE=2 SV=1 141 564 3.0E-14
sp|Q94AZ2|STP13_ARATH Sugar transport protein 13 OS=Arabidopsis thaliana GN=STP13 PE=1 SV=2 118 562 4.0E-14
sp|Q9LNV3|STP2_ARATH Sugar transport protein 2 OS=Arabidopsis thaliana GN=STP2 PE=1 SV=3 124 560 4.0E-14
sp|Q93Y91|STP5_ARATH Sugar transport protein 5 OS=Arabidopsis thaliana GN=STP5 PE=2 SV=1 132 563 9.0E-14
sp|Q9SBA7|STP8_ARATH Sugar transport protein 8 OS=Arabidopsis thaliana GN=STP8 PE=2 SV=2 123 560 1.0E-13
sp|Q32NG5|GTR12_XENLA Solute carrier family 2, facilitated glucose transporter member 12 OS=Xenopus laevis GN=slc2a12 PE=2 SV=1 150 453 1.0E-13
sp|P94493|YNCC_BACSU Putative metabolite transport protein YncC OS=Bacillus subtilis (strain 168) GN=yncC PE=3 SV=2 161 564 1.0E-13
sp|Q8TDB8|GTR14_HUMAN Solute carrier family 2, facilitated glucose transporter member 14 OS=Homo sapiens GN=SLC2A14 PE=2 SV=1 161 564 2.0E-13
sp|Q9SFG0|STP6_ARATH Sugar transport protein 6 OS=Arabidopsis thaliana GN=STP6 PE=1 SV=1 111 560 2.0E-13
sp|B4J913|TRET1_DROGR Facilitated trehalose transporter Tret1 OS=Drosophila grimshawi GN=Tret1 PE=3 SV=1 156 561 2.0E-13
sp|O23492|INT4_ARATH Inositol transporter 4 OS=Arabidopsis thaliana GN=INT4 PE=1 SV=1 157 438 3.0E-13
sp|P40441|HXT12_YEAST Putative hexose transporter 12 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HXT12 PE=5 SV=1 161 561 3.0E-13
sp|P46896|GTR1_CHICK Solute carrier family 2, facilitated glucose transporter member 1 OS=Gallus gallus GN=SLC2A1 PE=2 SV=1 161 564 4.0E-13
sp|Q07423|HEX6_RICCO Hexose carrier protein HEX6 OS=Ricinus communis GN=HEX6 PE=2 SV=1 119 561 7.0E-13
sp|Q9NRM0|GTR9_HUMAN Solute carrier family 2, facilitated glucose transporter member 9 OS=Homo sapiens GN=SLC2A9 PE=1 SV=2 96 571 8.0E-13
sp|Q9C757|INT2_ARATH Probable inositol transporter 2 OS=Arabidopsis thaliana GN=INT2 PE=1 SV=1 162 447 1.0E-12
sp|Q5RET7|GTR5_PONAB Solute carrier family 2, facilitated glucose transporter member 5 OS=Pongo abelii GN=SLC2A5 PE=2 SV=1 124 564 1.0E-12
sp|Q5J316|GTR12_BOVIN Solute carrier family 2, facilitated glucose transporter member 12 OS=Bos taurus GN=SLC2A12 PE=1 SV=1 161 442 2.0E-12
sp|Q8BFW9|GTR12_MOUSE Solute carrier family 2, facilitated glucose transporter member 12 OS=Mus musculus GN=Slc2a12 PE=2 SV=1 161 446 2.0E-12
sp|O52733|XYLT_LACBR D-xylose-proton symporter OS=Lactobacillus brevis GN=xylT PE=3 SV=1 129 561 3.0E-12
sp|Q9XSC2|GTR3_RABIT Solute carrier family 2, facilitated glucose transporter member 3 (Fragment) OS=Oryctolagus cuniculus GN=SLC2A3 PE=2 SV=1 185 564 3.0E-12
sp|Q2V4B9|PLST3_ARATH Probable plastidic glucose transporter 3 OS=Arabidopsis thaliana GN=At1g79820 PE=2 SV=2 146 561 4.0E-12
sp|P21906|GLF_ZYMMO Glucose facilitated diffusion protein OS=Zymomonas mobilis subsp. mobilis (strain ATCC 31821 / ZM4 / CP4) GN=glf PE=3 SV=2 150 568 8.0E-12
sp|Q9M0Z9|EDL15_ARATH Sugar transporter ERD6-like 15 OS=Arabidopsis thaliana GN=At4g04760 PE=3 SV=2 162 567 1.0E-11
sp|Q9FMX3|STP11_ARATH Sugar transport protein 11 OS=Arabidopsis thaliana GN=STP11 PE=1 SV=1 141 563 1.0E-11
sp|Q8TD20|GTR12_HUMAN Solute carrier family 2, facilitated glucose transporter member 12 OS=Homo sapiens GN=SLC2A12 PE=2 SV=1 161 442 1.0E-11
sp|P39932|STL1_YEAST Sugar transporter STL1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=STL1 PE=1 SV=2 162 586 2.0E-11
sp|Q8LBI9|EDL16_ARATH Sugar transporter ERD6-like 16 OS=Arabidopsis thaliana GN=At5g18840 PE=2 SV=2 146 561 2.0E-11
sp|Q9NY64|GTR8_HUMAN Solute carrier family 2, facilitated glucose transporter member 8 OS=Homo sapiens GN=SLC2A8 PE=1 SV=3 266 564 2.0E-11
sp|Q9BE72|GTR12_MACFA Solute carrier family 2, facilitated glucose transporter member 12 OS=Macaca fascicularis GN=SLC2A12 PE=2 SV=1 161 442 2.0E-11
sp|P96710|ARAE_BACSU Arabinose-proton symporter OS=Bacillus subtilis (strain 168) GN=araE PE=2 SV=2 69 563 3.0E-11
sp|Q94CI7|EDL17_ARATH Sugar transporter ERD6-like 17 OS=Arabidopsis thaliana GN=SFP1 PE=2 SV=2 106 561 3.0E-11
sp|P15729|GLCP_SYNY3 Glucose transport protein OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=gtr PE=3 SV=2 147 560 1.0E-10
sp|Q96QE2|MYCT_HUMAN Proton myo-inositol cotransporter OS=Homo sapiens GN=SLC2A13 PE=1 SV=3 461 564 1.0E-10
sp|Q921A2|MYCT_RAT Proton myo-inositol cotransporter OS=Rattus norvegicus GN=Slc2a13 PE=1 SV=2 461 564 1.0E-10
sp|Q3UHK1|MYCT_MOUSE Proton myo-inositol cotransporter OS=Mus musculus GN=Slc2a13 PE=1 SV=2 461 564 1.0E-10
sp|Q27994|GTR4_BOVIN Solute carrier family 2, facilitated glucose transporter member 4 OS=Bos taurus GN=SLC2A4 PE=2 SV=2 157 564 2.0E-10
sp|Q0WQ63|ERDL8_ARATH Sugar transporter ERD6-like 8 OS=Arabidopsis thaliana GN=At3g05150 PE=2 SV=1 146 561 3.0E-10
sp|Q9BYW1|GTR11_HUMAN Solute carrier family 2, facilitated glucose transporter member 11 OS=Homo sapiens GN=SLC2A11 PE=2 SV=1 122 562 4.0E-10
sp|Q96290|MSSP1_ARATH Monosaccharide-sensing protein 1 OS=Arabidopsis thaliana GN=MSSP1 PE=1 SV=2 109 308 1.0E-09
sp|P58354|GTR8_BOVIN Solute carrier family 2, facilitated glucose transporter member 8 OS=Bos taurus GN=SLC2A8 PE=2 SV=2 266 564 1.0E-09
sp|Q0WVE9|PLST1_ARATH Probable plastidic glucose transporter 1 OS=Arabidopsis thaliana GN=At1g05030 PE=2 SV=2 146 561 1.0E-09
sp|Q9FYG3|PLST2_ARATH Probable plastidic glucose transporter 2 OS=Arabidopsis thaliana GN=At1g67300 PE=2 SV=1 146 561 2.0E-09
sp|O23492|INT4_ARATH Inositol transporter 4 OS=Arabidopsis thaliana GN=INT4 PE=1 SV=1 466 566 3.0E-09
sp|Q863Y9|GTR5_HORSE Solute carrier family 2, facilitated glucose transporter member 5 OS=Equus caballus GN=SLC2A5 PE=2 SV=1 145 564 3.0E-09
sp|P14142|GTR4_MOUSE Solute carrier family 2, facilitated glucose transporter member 4 OS=Mus musculus GN=Slc2a4 PE=1 SV=3 278 503 4.0E-09
sp|P19357|GTR4_RAT Solute carrier family 2, facilitated glucose transporter member 4 OS=Rattus norvegicus GN=Slc2a4 PE=1 SV=1 278 503 6.0E-09
sp|Q9JIF3|GTR8_MOUSE Solute carrier family 2, facilitated glucose transporter member 8 OS=Mus musculus GN=Slc2a8 PE=1 SV=2 266 564 6.0E-09
sp|Q96QE2|MYCT_HUMAN Proton myo-inositol cotransporter OS=Homo sapiens GN=SLC2A13 PE=1 SV=3 157 432 1.0E-08
sp|Q04162|YD387_YEAST Probable metabolite transport protein YDR387C OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YDR387C PE=1 SV=1 354 564 1.0E-08
sp|Q3ECP7|ERDL5_ARATH Sugar transporter ERD6-like 5 OS=Arabidopsis thaliana GN=At1g54730 PE=2 SV=2 146 562 2.0E-08
sp|Q9JJZ1|GTR8_RAT Solute carrier family 2, facilitated glucose transporter member 8 OS=Rattus norvegicus GN=Slc2a8 PE=1 SV=1 266 564 2.0E-08
sp|P22732|GTR5_HUMAN Solute carrier family 2, facilitated glucose transporter member 5 OS=Homo sapiens GN=SLC2A5 PE=1 SV=1 124 594 3.0E-08
sp|Q8LPQ8|MSSP2_ARATH Monosaccharide-sensing protein 2 OS=Arabidopsis thaliana GN=MSSP2 PE=1 SV=2 372 570 4.0E-08
sp|Q4F7G0|ERDL2_ARATH Sugar transporter ERD6-like 2 OS=Arabidopsis thaliana GN=SUGTL3 PE=2 SV=1 162 561 4.0E-08
sp|Q9BE72|GTR12_MACFA Solute carrier family 2, facilitated glucose transporter member 12 OS=Macaca fascicularis GN=SLC2A12 PE=2 SV=1 462 598 5.0E-08
sp|Q5J316|GTR12_BOVIN Solute carrier family 2, facilitated glucose transporter member 12 OS=Bos taurus GN=SLC2A12 PE=1 SV=1 462 598 7.0E-08
sp|Q6GN01|GTR10_XENLA Solute carrier family 2, facilitated glucose transporter member 10 OS=Xenopus laevis GN=slc2a10 PE=2 SV=1 455 570 8.0E-08
sp|Q9ZQP6|INT3_ARATH Probable inositol transporter 3 OS=Arabidopsis thaliana GN=INT3 PE=2 SV=1 458 564 9.0E-08
sp|Q8TD20|GTR12_HUMAN Solute carrier family 2, facilitated glucose transporter member 12 OS=Homo sapiens GN=SLC2A12 PE=2 SV=1 462 598 1.0E-07
sp|Q3UHK1|MYCT_MOUSE Proton myo-inositol cotransporter OS=Mus musculus GN=Slc2a13 PE=1 SV=2 162 457 1.0E-07
sp|Q94CI6|EDL18_ARATH Sugar transporter ERD6-like 18 OS=Arabidopsis thaliana GN=SFP2 PE=2 SV=1 137 561 1.0E-07
sp|Q39524|HUP2_PARKE H(+)/hexose cotransporter 2 OS=Parachlorella kessleri GN=HUP2 PE=2 SV=1 213 565 1.0E-07
sp|Q8L7R8|STP3_ARATH Sugar transport protein 3 OS=Arabidopsis thaliana GN=STP3 PE=2 SV=2 120 560 1.0E-07
sp|Q9SD00|MSSP3_ARATH Monosaccharide-sensing protein 3 OS=Arabidopsis thaliana GN=MSSP3 PE=2 SV=1 144 308 2.0E-07
sp|P14672|GTR4_HUMAN Solute carrier family 2, facilitated glucose transporter member 4 OS=Homo sapiens GN=SLC2A4 PE=1 SV=1 157 503 2.0E-07
sp|Q0P4G6|GTR10_XENTR Solute carrier family 2, facilitated glucose transporter member 10 OS=Xenopus tropicalis GN=slc2a10 PE=2 SV=1 453 568 2.0E-07
sp|Q921A2|MYCT_RAT Proton myo-inositol cotransporter OS=Rattus norvegicus GN=Slc2a13 PE=1 SV=2 162 432 3.0E-07
sp|Q9UGQ3|GTR6_HUMAN Solute carrier family 2, facilitated glucose transporter member 6 OS=Homo sapiens GN=SLC2A6 PE=1 SV=2 268 573 3.0E-07
sp|Q96290|MSSP1_ARATH Monosaccharide-sensing protein 1 OS=Arabidopsis thaliana GN=MSSP1 PE=1 SV=2 372 565 4.0E-07
sp|Q9SD00|MSSP3_ARATH Monosaccharide-sensing protein 3 OS=Arabidopsis thaliana GN=MSSP3 PE=2 SV=1 357 570 5.0E-07
sp|Q8BFW9|GTR12_MOUSE Solute carrier family 2, facilitated glucose transporter member 12 OS=Mus musculus GN=Slc2a12 PE=2 SV=1 462 599 6.0E-07
sp|P25297|PHO84_YEAST Inorganic phosphate transporter PHO84 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PHO84 PE=1 SV=2 194 564 6.0E-07
sp|Q94AF9|EDL11_ARATH Sugar transporter ERD6-like 11 OS=Arabidopsis thaliana GN=At3g05165 PE=2 SV=2 162 561 1.0E-06
sp|Q9SCW7|ERDL1_ARATH Sugar transporter ERD6-like 1 OS=Arabidopsis thaliana GN=SUGTL4 PE=2 SV=2 162 562 1.0E-06
sp|Q93Z80|EDL10_ARATH Sugar transporter ERD6-like 10 OS=Arabidopsis thaliana GN=At3g05160 PE=2 SV=1 272 561 4.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0055085 transmembrane transport Yes
GO:0022857 transmembrane transporter activity Yes
GO:0016021 integral component of membrane Yes
GO:0110165 cellular anatomical entity No
GO:0009987 cellular process No
GO:0003674 molecular_function No
GO:0051179 localization No
GO:0005215 transporter activity No
GO:0008150 biological_process No
GO:0031224 intrinsic component of membrane No
GO:0051234 establishment of localization No
GO:0005575 cellular_component No
GO:0006810 transport No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 56 0.45

Transmembrane Domains

Domain # Start End Length
1 85 107 22
2 140 162 22
3 169 191 22
4 225 247 22
5 254 276 22
6 374 396 22
7 401 423 22
8 433 455 22
9 462 484 22
10 499 521 22
11 528 550 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|3347
MQNSLAYMTDQELQDDVRHFIDIHLPTVEYLDLLRAARVAKDARLYDEVSRHEKLEARYSLPVTLTRREKTALRR
EKDVAFSEKGMLVVIATVSVAALLQGLVQSSFNSASLYTALWGLDNTSHTGSFNNDDWRLGAANASPWFFAALLG
CPLSLPINYWYGRRGAIACAAFLILVSSIAAIFVKSWTQLFCVRIINGLGMGIKAVSTTILASETAVGFWRGSAI
LAWQLWVAFGIMMGFGFNLIFTMAASERITFGLIQGAPMVPSLVLLVMTIWLCPESPRYHLLKGPNYSVQKAYKA
LQQVRNTELQALRDLYLVHKALEQESVGVGDLDAHANLSPGVCWVFRDFFMQFKQLFQQQRLYNAVLSTSTVNLA
QQLCGVNVCAFYSGTLFSHVGAQSTVIAMAYSLGFGAINFFFALPAIKSIDTLGRRKWLIITLPFMALFMLGAAL
SALIENQSRRTWVTGLFLFMFAIAYSPGLGPMPFTLASESFPLSHREAGTAWAIAINLFFAGLLSILFPSIEAAL
GQAGSLGLFSGLNIVALVLVFLFVEETKRCSLEELDHIFAVSKRKFIRFQVTEYLPWLLKQCFPRSNRQPRPELY
KDLVWGSATSGDVRRETVDLDGTETGTIATETTPTAVMSISEAAQVRPDVVEIGDNRSIYAGSSLYSSHSTTSSR
RS*
Coding >OphauB2|3347
ATGCAGAATTCTCTTGCCTACATGACGGACCAAGAGCTGCAAGACGACGTCAGGCATTTTATTGACATTCACTTA
CCGACTGTGGAATACCTAGACCTATTGCGTGCTGCTAGAGTGGCCAAGGATGCCCGCCTGTACGACGAGGTTTCC
CGTCATGAGAAGCTCGAGGCTCGCTATTCTCTTCCTGTCACACTTACAAGAAGAGAGAAGACTGCCTTGCGCCGC
GAGAAGGATGTTGCGTTTAGTGAGAAGGGCATGCTAGTTGTCATTGCCACAGTGTCTGTAGCCGCACTTCTCCAA
GGTCTGGTCCAGTCATCCTTCAATTCGGCTTCTCTCTACACAGCGCTGTGGGGGCTTGATAACACGAGTCACACT
GGAAGCTTCAACAATGATGACTGGCGCCTCGGGGCTGCCAATGCCTCGCCGTGGTTCTTTGCTGCCCTTCTAGGT
TGCCCCCTCTCCCTTCCTATCAACTATTGGTACGGGAGGAGGGGAGCCATTGCTTGCGCAGCGTTCCTTATTCTC
GTGAGCTCAATCGCAGCCATTTTTGTCAAGTCTTGGACACAGCTATTCTGCGTGCGAATTATCAACGGCTTGGGC
ATGGGAATCAAGGCGGTGAGCACTACCATACTTGCGTCTGAGACGGCAGTCGGATTCTGGCGCGGCTCCGCCATT
CTTGCTTGGCAGCTCTGGGTCGCCTTTGGCATCATGATGGGCTTTGGCTTTAACCTCATCTTCACCATGGCCGCA
TCGGAGCGCATCACGTTTGGCCTTATCCAAGGAGCACCAATGGTTCCCAGCCTTGTCTTGCTCGTCATGACGATT
TGGCTTTGTCCCGAGTCTCCCCGATATCACCTCTTGAAAGGGCCCAATTATAGTGTCCAAAAGGCGTATAAAGCT
CTGCAGCAAGTCAGAAACACAGAGCTTCAAGCATTACGAGATTTATACCTTGTTCATAAAGCACTTGAACAGGAG
AGTGTGGGCGTCGGAGACTTGGATGCGCACGCAAATCTGTCGCCAGGAGTTTGTTGGGTATTTCGTGATTTCTTC
ATGCAGTTCAAACAACTCTTCCAGCAACAACGGCTGTATAATGCCGTCTTGTCTACGTCAACAGTCAACCTAGCG
CAGCAGCTCTGTGGAGTCAATGTTTGCGCATTTTACTCTGGCACTCTATTCAGCCATGTTGGGGCTCAGTCTACC
GTTATCGCAATGGCATATAGCCTTGGCTTTGGCGCCATCAACTTTTTCTTCGCACTACCAGCAATTAAAAGCATA
GATACGTTGGGCCGAAGGAAATGGCTAATTATAACCCTTCCTTTTATGGCATTGTTCATGCTAGGTGCCGCACTT
TCTGCCCTTATCGAAAACCAGAGCAGACGTACATGGGTCACTGGCTTATTTCTTTTCATGTTTGCAATTGCCTAC
TCTCCCGGTTTGGGTCCAATGCCTTTTACACTCGCATCCGAGAGTTTCCCTTTGTCTCATAGAGAAGCAGGCACG
GCTTGGGCCATTGCCATCAACCTCTTCTTTGCGGGATTATTGTCCATTTTGTTCCCCAGTATCGAAGCAGCACTT
GGGCAAGCTGGCAGCCTAGGATTGTTCAGCGGATTGAATATCGTGGCTTTGGTCCTTGTGTTTCTCTTTGTCGAA
GAGACCAAGCGTTGCAGTTTGGAAGAGCTGGACCACATTTTTGCCGTATCCAAACGCAAGTTCATTCGCTTCCAA
GTGACCGAGTACTTGCCCTGGCTGCTTAAGCAGTGCTTTCCTCGCTCAAACAGGCAACCACGGCCCGAATTGTAT
AAGGACCTTGTCTGGGGCTCTGCAACATCCGGTGATGTAAGAAGAGAAACGGTGGATCTTGATGGCACTGAAACG
GGAACGATTGCAACGGAGACGACGCCGACAGCCGTCATGAGCATTTCTGAGGCTGCCCAAGTTCGACCGGATGTC
GTGGAAATTGGGGACAACCGGTCCATATACGCTGGGAGTTCGCTGTACAGCAGTCATAGCACCACTAGTAGTAGG
AGAAGCTGA
Transcript >OphauB2|3347
ATGCAGAATTCTCTTGCCTACATGACGGACCAAGAGCTGCAAGACGACGTCAGGCATTTTATTGACATTCACTTA
CCGACTGTGGAATACCTAGACCTATTGCGTGCTGCTAGAGTGGCCAAGGATGCCCGCCTGTACGACGAGGTTTCC
CGTCATGAGAAGCTCGAGGCTCGCTATTCTCTTCCTGTCACACTTACAAGAAGAGAGAAGACTGCCTTGCGCCGC
GAGAAGGATGTTGCGTTTAGTGAGAAGGGCATGCTAGTTGTCATTGCCACAGTGTCTGTAGCCGCACTTCTCCAA
GGTCTGGTCCAGTCATCCTTCAATTCGGCTTCTCTCTACACAGCGCTGTGGGGGCTTGATAACACGAGTCACACT
GGAAGCTTCAACAATGATGACTGGCGCCTCGGGGCTGCCAATGCCTCGCCGTGGTTCTTTGCTGCCCTTCTAGGT
TGCCCCCTCTCCCTTCCTATCAACTATTGGTACGGGAGGAGGGGAGCCATTGCTTGCGCAGCGTTCCTTATTCTC
GTGAGCTCAATCGCAGCCATTTTTGTCAAGTCTTGGACACAGCTATTCTGCGTGCGAATTATCAACGGCTTGGGC
ATGGGAATCAAGGCGGTGAGCACTACCATACTTGCGTCTGAGACGGCAGTCGGATTCTGGCGCGGCTCCGCCATT
CTTGCTTGGCAGCTCTGGGTCGCCTTTGGCATCATGATGGGCTTTGGCTTTAACCTCATCTTCACCATGGCCGCA
TCGGAGCGCATCACGTTTGGCCTTATCCAAGGAGCACCAATGGTTCCCAGCCTTGTCTTGCTCGTCATGACGATT
TGGCTTTGTCCCGAGTCTCCCCGATATCACCTCTTGAAAGGGCCCAATTATAGTGTCCAAAAGGCGTATAAAGCT
CTGCAGCAAGTCAGAAACACAGAGCTTCAAGCATTACGAGATTTATACCTTGTTCATAAAGCACTTGAACAGGAG
AGTGTGGGCGTCGGAGACTTGGATGCGCACGCAAATCTGTCGCCAGGAGTTTGTTGGGTATTTCGTGATTTCTTC
ATGCAGTTCAAACAACTCTTCCAGCAACAACGGCTGTATAATGCCGTCTTGTCTACGTCAACAGTCAACCTAGCG
CAGCAGCTCTGTGGAGTCAATGTTTGCGCATTTTACTCTGGCACTCTATTCAGCCATGTTGGGGCTCAGTCTACC
GTTATCGCAATGGCATATAGCCTTGGCTTTGGCGCCATCAACTTTTTCTTCGCACTACCAGCAATTAAAAGCATA
GATACGTTGGGCCGAAGGAAATGGCTAATTATAACCCTTCCTTTTATGGCATTGTTCATGCTAGGTGCCGCACTT
TCTGCCCTTATCGAAAACCAGAGCAGACGTACATGGGTCACTGGCTTATTTCTTTTCATGTTTGCAATTGCCTAC
TCTCCCGGTTTGGGTCCAATGCCTTTTACACTCGCATCCGAGAGTTTCCCTTTGTCTCATAGAGAAGCAGGCACG
GCTTGGGCCATTGCCATCAACCTCTTCTTTGCGGGATTATTGTCCATTTTGTTCCCCAGTATCGAAGCAGCACTT
GGGCAAGCTGGCAGCCTAGGATTGTTCAGCGGATTGAATATCGTGGCTTTGGTCCTTGTGTTTCTCTTTGTCGAA
GAGACCAAGCGTTGCAGTTTGGAAGAGCTGGACCACATTTTTGCCGTATCCAAACGCAAGTTCATTCGCTTCCAA
GTGACCGAGTACTTGCCCTGGCTGCTTAAGCAGTGCTTTCCTCGCTCAAACAGGCAACCACGGCCCGAATTGTAT
AAGGACCTTGTCTGGGGCTCTGCAACATCCGGTGATGTAAGAAGAGAAACGGTGGATCTTGATGGCACTGAAACG
GGAACGATTGCAACGGAGACGACGCCGACAGCCGTCATGAGCATTTCTGAGGCTGCCCAAGTTCGACCGGATGTC
GTGGAAATTGGGGACAACCGGTCCATATACGCTGGGAGTTCGCTGTACAGCAGTCATAGCACCACTAGTAGTAGG
AGAAGCTGA
Gene >OphauB2|3347
ATGCAGAATTCTCTTGGTATTTTCTTGGCCCTCGAATCAGTACGAGGGGACTGGGCCAAAATTGCTTACATTTTA
ATCCAGCCTACATGACGGACCAAGAGCTGCAAGACGACGTCAGGCATTTTATTGACATTCACTTACCGACTGTGG
AATACCTAGACCTATTGCGTGCTGCTAGAGTGGCCAAGGATGCCCGCCTGTACGACGAGGTTTCCCGTCATGAGA
AGCTCGAGGCTCGCTATTCTCTTCCTGTCACACTTACAAGAAGAGAGAAGACTGCCTTGCGCCGCGAGAAGGATG
TTGCGTTTAGTGAGAAGGGCATGCTAGTTGTCATTGCCACAGTGTCTGTAGCCGCACTTCTCCAAGGTTGGTAGA
GTGCAAAGTGCGCCATGTCTTGACGCATATCTGATATGGTAGCTGCAGGTCTGGTCCAGTCATCCTTCAATTCGG
CTTCTCTCTACACAGCGCTGTGGGGGCTTGATAACACGAGTCACACTGGAAGCTTCAACAATGATGACTGGCGCC
TCGGGGCTGCCAATGCCTCGCCGTGGTTCTTTGCTGCCCTTCTAGGTTGCCCCCTCTCCCTTCCTATCAACTATT
GGTACGGGAGGAGGGGAGCCATTGCTTGCGCAGCGTTCCTTATTCTCGTGAGCTCAATCGCAGCCATTTTTGTCA
AGTCTTGGACACAGCTATTCTGCGTGCGAATTATCAACGGCTTGGGTTCGTGTCCCTCGGGCCATTTTGGCCTGT
ATACCCAGAGTTGGAGCTGACTGATGTTTCAGGCATGGGAATCAAGGCGGTGAGCACTACCATACTTGCGTCTGA
GACGGCAGTCGGATTCTGGCGCGGCTCCGCCATTCTTGCTTGGCAGCTCTGGTTGGACACACAAATTTCAAGATT
GAAACTGGGGTGAGCTGACTACTTCCAATTAGGGTCGCCTTTGGCATCATGATGGGCTTTGGCTTTAACCTCATC
TTCACCATGGCCGCATCGGAGCGCATCACGTTTGGCCTTATCCAAGGAGCACCAATGGTTCCCAGCCTTGTCTTG
CTCGTCATGACGATTTGGCTTTGTCCCGAGTCTCCCCGATATCACCTCTTGAAAGGGCCCAATTATAGTGTCCAA
AAGGCGTATAAAGCTCTGCAGCAAGTCAGAAACACAGAGGTACGATTATTAGATAGTTGACAACAGAATTGCATT
TAGCACTATATAACTGATGCGATTGACTACCTTTTCAGCTTCAAGCATTACGAGATTTATACCTTGTTCATAAAG
CACTTGAACAGGAGAGTGTGGGCGTCGGAGACTTGGATGCGCACGCAAATCTGTCGCCAGGAGTTTGTTGGGTAT
TTCGTGATTTCTTCATGCAGTTCAAACAACTCTTCCAGCAACAACGGCTGTATAATGCCGTCTTGTCTACGTCAA
CAGTCAACCTAGCGCAGCAGCTCTGTGGAGGTGAATTTCTAGGAACCCTGTCATGTTATTCAATTGAAACTTACT
TACTCTATGCAGTCAATGTTTGCGCATTTTACTCTGGTTAGCCGGGCTCGTGCGGCACACACAGTGCTTGACATG
TGCTAACTAGCAAGCCAAGGCACTCTATTCAGCCATGTTGGGGCTCAGTCTACCGTTATCGCAATGGCATATAGC
CTTGGCTTTGGTCAGCGACTCTCCTTTACTTCACATTCATAGCCTGCTCTATCTCTAACGCTTATATACTATATC
TAAAGGCGCCATCAACTTTTTCTTCGCACTACCAGCAATTAAAAGCATAGATACGTTGGGCCGAAGGAAATGGCT
AATTATAACCCTTCCTTTTATGGCATTGTTCATGCTAGGTGCCGCACTTTCTGCCCTTATCGAAAACCAGAGCAG
ACGTACATGGGTCACTGGCTTATTTCTTTTCAGTAAGTCGACAGGACGCTGAAGAAGATGATGGCTTATATTTTG
ATCATTGGATAGTGTTTGCAATTGCCTACTCTCCCGGTTTGGGTCCAATGCCTTTTACACTCGCATCCGAGAGTT
TCCCTTTGTCTCATAGAGAAGCAGTGAGGCACTTTGACTTGCTACTGGCTCTAATTCTTGCTGACTGCTTAGGGC
ACGGCTTGGGCCATTGCCATCAACCTCTTCTTTGCGGGATTATTGTCCATTTTGTTCCCCAGGTCAGTTTATTAG
AATAATGAGGTGGTCCTGTCAATATGCTGACGCCCAGTCAGTATCGAAGCAGCACTTGGGCAAGCTGGCAGCCTA
GGATTGTTCAGCGGATTGAATATCGTGGCTTTGGTCCTTGTGTTTCTCTTTGTCGAAGAGACCAAGCGTTGCAGT
TTGGAAGAGCTGGACCACATTTTTGCCGTATCCAAACGCAAGTTCATTCGCTTCCAAGTGACCGAGTACTTGCCC
TGGCTGCTTAAGCAGTGCTTTCCTCGCTCAAACAGGCAACCACGGCCCGAATTGTATAAGGACCTTGTCTGGGGC
TCTGCAACATCCGGTGATGTAAGAAGAGAAACGGTGGATCTTGATGGCACTGAAACGGGAACGATTGCAACGGAG
ACGACGCCGACAGCCGTCATGAGCATTTCTGAGGCTGCCCAAGTTCGACCGGATGTCGTGGAAATTGGGGACAAC
CGGTCCATATACGCTGGGAGTTCGCTGTACAGCAGTCATAGCACCACTAGTAGTAGGAGAAGCTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail