Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|3335
Gene name
LocationContig_211:8057..9290
Strand+
Gene length (bp)1233
Transcript length (bp)1233
Coding sequence length (bp)1233
Protein length (aa) 411

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

(None)

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup108
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|2055
Ophiocordyceps australis 1348a (Ghana) OphauG2|4948
Ophiocordyceps australis 1348a (Ghana) OphauG2|5391
Ophiocordyceps australis map64 (Brazil) OphauB2|1787
Ophiocordyceps australis map64 (Brazil) OphauB2|3127
Ophiocordyceps australis map64 (Brazil) OphauB2|3128
Ophiocordyceps australis map64 (Brazil) OphauB2|3183
Ophiocordyceps australis map64 (Brazil) OphauB2|3335 (this protein)
Ophiocordyceps camponoti-floridani Ophcf2|00223
Ophiocordyceps camponoti-rufipedis Ophun1|875
Ophiocordyceps kimflemingae Ophio5|6442
Ophiocordyceps subramaniannii Hirsu2|10638
Ophiocordyceps subramaniannii Hirsu2|2917
Ophiocordyceps subramaniannii Hirsu2|6025

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|3335
MHEIFQNGFTSQGSDTDLQKHLSFVGESGYISVTRSLSTAQDYAFGRQASQQNTGYIFIISPENLPDGHWIPGLF
PKDSAVQRNQEFAVPRQIPASAIAGAYKFKRKHGKVAVREWTANTDYRGGAQWKQPGHAISACKLRFCSWAHGFS
KNQVSRWGMRPGDAVKGSSGPINVPSKPSKLAKSTNTFVLSSKKSPTNDKTSNVVSNSRGDRQWGRIGDKKPDGS
KSSPIGDGNEPPLNGKKKVSASSSSGTIEAASNRRKAKTEHKPAGRDDEPPLRNGKTRPASPSSDLDEPPRNGKK
KLHKPSRPSGHDAKPGSPRKKPQGGSNSNSINKNIKSTVPPKKTRGKLRLGLQNKSPNRTKTPIILRFGLQNGFR
KAMIPKTLLGSANKAPRQRFESGVTRPGSHKPGSN*
Coding >OphauB2|3335
ATGCATGAGATATTCCAAAATGGATTTACCAGCCAAGGGTCTGACACTGATCTTCAAAAGCATCTAAGCTTTGTA
GGCGAGTCGGGTTACATATCAGTCACGCGCTCTCTTTCAACTGCTCAGGACTATGCCTTTGGTCGACAGGCATCT
CAACAGAACACGGGCTATATTTTTATCATCTCGCCTGAAAACTTACCCGACGGTCACTGGATACCTGGCCTCTTC
CCCAAAGATAGTGCTGTGCAGAGAAACCAAGAGTTTGCGGTGCCAAGACAAATCCCAGCCTCGGCCATTGCTGGC
GCTTATAAGTTTAAGCGCAAACATGGAAAAGTTGCTGTGAGAGAATGGACTGCGAATACTGACTATAGGGGGGGC
GCCCAGTGGAAGCAGCCTGGTCATGCAATTTCGGCTTGCAAACTGCGATTTTGTAGCTGGGCCCATGGCTTTTCC
AAAAACCAAGTGTCCCGTTGGGGCATGCGGCCAGGTGATGCGGTCAAGGGCTCCTCTGGCCCAATTAATGTGCCC
TCGAAGCCCTCGAAGCTTGCTAAAAGTACCAACACGTTCGTTCTAAGCAGTAAAAAATCGCCGACTAACGATAAA
ACTTCCAATGTAGTATCCAATTCGAGGGGCGATCGACAGTGGGGCCGTATTGGCGACAAGAAGCCAGATGGAAGC
AAAAGCTCTCCTATCGGTGATGGGAATGAACCACCACTAAATGGCAAAAAAAAGGTTTCAGCCAGTTCAAGCTCC
GGCACAATAGAAGCCGCGTCCAATAGAAGAAAAGCCAAGACTGAACACAAGCCTGCTGGCCGTGACGATGAACCA
CCGCTAAGAAATGGCAAGACACGTCCAGCAAGTCCAAGTTCTGATCTAGACGAGCCGCCGCGAAATGGAAAGAAA
AAGCTCCACAAGCCGTCTAGGCCCAGTGGCCATGACGCTAAGCCAGGCTCGCCCCGCAAGAAGCCTCAAGGCGGC
TCCAACTCCAACTCTATTAATAAGAATATCAAAAGCACGGTACCGCCCAAGAAGACACGGGGAAAGCTGCGACTC
GGCTTACAAAACAAGTCGCCGAATCGCACAAAGACACCGATAATTTTAAGATTTGGATTGCAGAATGGTTTTCGG
AAAGCCATGATACCAAAGACGCTGCTTGGCTCAGCAAACAAAGCTCCAAGACAGCGATTTGAGAGTGGAGTGACA
AGGCCAGGCAGTCATAAGCCGGGGTCGAATTGA
Transcript >OphauB2|3335
ATGCATGAGATATTCCAAAATGGATTTACCAGCCAAGGGTCTGACACTGATCTTCAAAAGCATCTAAGCTTTGTA
GGCGAGTCGGGTTACATATCAGTCACGCGCTCTCTTTCAACTGCTCAGGACTATGCCTTTGGTCGACAGGCATCT
CAACAGAACACGGGCTATATTTTTATCATCTCGCCTGAAAACTTACCCGACGGTCACTGGATACCTGGCCTCTTC
CCCAAAGATAGTGCTGTGCAGAGAAACCAAGAGTTTGCGGTGCCAAGACAAATCCCAGCCTCGGCCATTGCTGGC
GCTTATAAGTTTAAGCGCAAACATGGAAAAGTTGCTGTGAGAGAATGGACTGCGAATACTGACTATAGGGGGGGC
GCCCAGTGGAAGCAGCCTGGTCATGCAATTTCGGCTTGCAAACTGCGATTTTGTAGCTGGGCCCATGGCTTTTCC
AAAAACCAAGTGTCCCGTTGGGGCATGCGGCCAGGTGATGCGGTCAAGGGCTCCTCTGGCCCAATTAATGTGCCC
TCGAAGCCCTCGAAGCTTGCTAAAAGTACCAACACGTTCGTTCTAAGCAGTAAAAAATCGCCGACTAACGATAAA
ACTTCCAATGTAGTATCCAATTCGAGGGGCGATCGACAGTGGGGCCGTATTGGCGACAAGAAGCCAGATGGAAGC
AAAAGCTCTCCTATCGGTGATGGGAATGAACCACCACTAAATGGCAAAAAAAAGGTTTCAGCCAGTTCAAGCTCC
GGCACAATAGAAGCCGCGTCCAATAGAAGAAAAGCCAAGACTGAACACAAGCCTGCTGGCCGTGACGATGAACCA
CCGCTAAGAAATGGCAAGACACGTCCAGCAAGTCCAAGTTCTGATCTAGACGAGCCGCCGCGAAATGGAAAGAAA
AAGCTCCACAAGCCGTCTAGGCCCAGTGGCCATGACGCTAAGCCAGGCTCGCCCCGCAAGAAGCCTCAAGGCGGC
TCCAACTCCAACTCTATTAATAAGAATATCAAAAGCACGGTACCGCCCAAGAAGACACGGGGAAAGCTGCGACTC
GGCTTACAAAACAAGTCGCCGAATCGCACAAAGACACCGATAATTTTAAGATTTGGATTGCAGAATGGTTTTCGG
AAAGCCATGATACCAAAGACGCTGCTTGGCTCAGCAAACAAAGCTCCAAGACAGCGATTTGAGAGTGGAGTGACA
AGGCCAGGCAGTCATAAGCCGGGGTCGAATTGA
Gene >OphauB2|3335
ATGCATGAGATATTCCAAAATGGATTTACCAGCCAAGGGTCTGACACTGATCTTCAAAAGCATCTAAGCTTTGTA
GGCGAGTCGGGTTACATATCAGTCACGCGCTCTCTTTCAACTGCTCAGGACTATGCCTTTGGTCGACAGGCATCT
CAACAGAACACGGGCTATATTTTTATCATCTCGCCTGAAAACTTACCCGACGGTCACTGGATACCTGGCCTCTTC
CCCAAAGATAGTGCTGTGCAGAGAAACCAAGAGTTTGCGGTGCCAAGACAAATCCCAGCCTCGGCCATTGCTGGC
GCTTATAAGTTTAAGCGCAAACATGGAAAAGTTGCTGTGAGAGAATGGACTGCGAATACTGACTATAGGGGGGGC
GCCCAGTGGAAGCAGCCTGGTCATGCAATTTCGGCTTGCAAACTGCGATTTTGTAGCTGGGCCCATGGCTTTTCC
AAAAACCAAGTGTCCCGTTGGGGCATGCGGCCAGGTGATGCGGTCAAGGGCTCCTCTGGCCCAATTAATGTGCCC
TCGAAGCCCTCGAAGCTTGCTAAAAGTACCAACACGTTCGTTCTAAGCAGTAAAAAATCGCCGACTAACGATAAA
ACTTCCAATGTAGTATCCAATTCGAGGGGCGATCGACAGTGGGGCCGTATTGGCGACAAGAAGCCAGATGGAAGC
AAAAGCTCTCCTATCGGTGATGGGAATGAACCACCACTAAATGGCAAAAAAAAGGTTTCAGCCAGTTCAAGCTCC
GGCACAATAGAAGCCGCGTCCAATAGAAGAAAAGCCAAGACTGAACACAAGCCTGCTGGCCGTGACGATGAACCA
CCGCTAAGAAATGGCAAGACACGTCCAGCAAGTCCAAGTTCTGATCTAGACGAGCCGCCGCGAAATGGAAAGAAA
AAGCTCCACAAGCCGTCTAGGCCCAGTGGCCATGACGCTAAGCCAGGCTCGCCCCGCAAGAAGCCTCAAGGCGGC
TCCAACTCCAACTCTATTAATAAGAATATCAAAAGCACGGTACCGCCCAAGAAGACACGGGGAAAGCTGCGACTC
GGCTTACAAAACAAGTCGCCGAATCGCACAAAGACACCGATAATTTTAAGATTTGGATTGCAGAATGGTTTTCGG
AAAGCCATGATACCAAAGACGCTGCTTGGCTCAGCAAACAAAGCTCCAAGACAGCGATTTGAGAGTGGAGTGACA
AGGCCAGGCAGTCATAAGCCGGGGTCGAATTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail