Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|3331
Gene name
LocationContig_210:27469..27784
Strand-
Gene length (bp)315
Transcript length (bp)315
Coding sequence length (bp)315
Protein length (aa) 105

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00463 ICL Isocitrate lyase family 1.0E-54 1 103

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P0CT06|ACEA_MAGO7 Isocitrate lyase OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=ICL1 PE=3 SV=1 1 104 2.0E-59
sp|L7HUY5|ACEA_MAGOY Isocitrate lyase OS=Magnaporthe oryzae (strain Y34) GN=ICL1 PE=2 SV=2 1 104 2.0E-59
sp|P28299|ACEA_NEUCR Isocitrate lyase OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=acu-3 PE=2 SV=2 1 104 1.0E-57
sp|Q4HYR2|ACEA_GIBZE Isocitrate lyase OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=ICL1 PE=3 SV=1 1 103 2.0E-55
sp|Q96TP5|ACEA_COCIM Isocitrate lyase OS=Coccidioides immitis (strain RS) GN=ICL1 PE=2 SV=2 1 103 4.0E-52
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P0CT06|ACEA_MAGO7 Isocitrate lyase OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=ICL1 PE=3 SV=1 1 104 2.0E-59
sp|L7HUY5|ACEA_MAGOY Isocitrate lyase OS=Magnaporthe oryzae (strain Y34) GN=ICL1 PE=2 SV=2 1 104 2.0E-59
sp|P28299|ACEA_NEUCR Isocitrate lyase OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=acu-3 PE=2 SV=2 1 104 1.0E-57
sp|Q4HYR2|ACEA_GIBZE Isocitrate lyase OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=ICL1 PE=3 SV=1 1 103 2.0E-55
sp|Q96TP5|ACEA_COCIM Isocitrate lyase OS=Coccidioides immitis (strain RS) GN=ICL1 PE=2 SV=2 1 103 4.0E-52
sp|Q6T267|ACEA_ASPFU Isocitrate lyase OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=icl1 PE=3 SV=2 1 103 2.0E-49
sp|P28298|ACEA_EMENI Isocitrate lyase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=acuD PE=1 SV=3 1 103 3.0E-49
sp|Q6BRY4|ACEA_DEBHA Isocitrate lyase OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=ICL1 PE=3 SV=1 1 103 8.0E-48
sp|Q86ZF1|ACEA_LEPMC Isocitrate lyase OS=Leptosphaeria maculans GN=ICL1 PE=2 SV=1 1 103 2.0E-46
sp|P41555|ACEA_YARLI Isocitrate lyase OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=ICL1 PE=3 SV=3 1 103 2.0E-45
sp|P20014|ACEA_CANTR Isocitrate lyase OS=Candida tropicalis GN=ICL1 PE=3 SV=1 1 103 7.0E-45
sp|Q9P8Q7|ACEA_CANAX Isocitrate lyase OS=Candida albicans GN=ICL1 PE=3 SV=1 1 103 9.0E-45
sp|Q96WZ5|ACEA_TALMA Isocitrate lyase OS=Talaromyces marneffei GN=icl1 PE=3 SV=1 1 103 9.0E-45
sp|Q9HFN2|ACEA_CYBJA Isocitrate lyase OS=Cyberlindnera jadinii GN=ICL1 PE=3 SV=1 6 103 5.0E-44
sp|O94198|ACEA_ASHGO Isocitrate lyase OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=ICL1 PE=3 SV=1 1 103 7.0E-42
sp|Q9C124|ACEA_PICPA Isocitrate lyase OS=Komagataella pastoris GN=ICL1 PE=3 SV=1 1 103 2.0E-40
sp|Q6FPK7|ACEA_CANGA Isocitrate lyase OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=ICL1 PE=3 SV=2 1 103 2.0E-40
sp|P28240|ACEA_YEAST Isocitrate lyase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ICL1 PE=1 SV=1 1 103 9.0E-39
sp|Q8NJ72|ACEA_KLULA Isocitrate lyase OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=ICL1 PE=2 SV=1 1 103 2.0E-37
sp|O13439|ACEA_COPCI Isocitrate lyase OS=Coprinopsis cinerea GN=ACU-7 PE=3 SV=1 5 103 3.0E-35
sp|A8NR45|ACEA_COPC7 Isocitrate lyase OS=Coprinopsis cinerea (strain Okayama-7 / 130 / ATCC MYA-4618 / FGSC 9003) GN=ACU-7 PE=3 SV=1 5 103 3.0E-35
sp|P49296|ACEA_CUCSA Isocitrate lyase OS=Cucumis sativus PE=3 SV=1 1 103 6.0E-33
sp|P49297|ACEA_SOLLC Isocitrate lyase OS=Solanum lycopersicum PE=2 SV=1 9 104 1.0E-32
sp|P25248|ACEA_BRANA Isocitrate lyase OS=Brassica napus PE=2 SV=1 4 103 2.0E-32
sp|Q43097|ACEA_PINTA Isocitrate lyase OS=Pinus taeda GN=ICL 8 PE=2 SV=1 1 104 2.0E-32
sp|P17069|ACEA_GOSHI Isocitrate lyase OS=Gossypium hirsutum PE=2 SV=1 9 103 2.0E-32
sp|P28297|ACEA_ARATH Isocitrate lyase OS=Arabidopsis thaliana GN=ICL PE=1 SV=2 4 103 4.0E-32
sp|Q6Z6M4|ACEA_ORYSJ Isocitrate lyase OS=Oryza sativa subsp. japonica GN=ICL PE=1 SV=1 1 103 5.0E-32
sp|Q9SE26|ACEA_DENCR Isocitrate lyase OS=Dendrobium crumenatum GN=ICL PE=2 SV=1 1 103 5.0E-32
sp|P93110|ACEA_CUCMA Isocitrate lyase OS=Cucurbita maxima PE=2 SV=1 1 103 8.0E-32
sp|P15479|ACEA_RICCO Isocitrate lyase OS=Ricinus communis PE=2 SV=1 9 103 4.0E-31
sp|P45456|ACEA1_SOYBN Isocitrate lyase 1 (Fragment) OS=Glycine max GN=ICL1 PE=2 SV=1 1 103 2.0E-30
sp|P45457|ACEA2_SOYBN Isocitrate lyase 2 (Fragment) OS=Glycine max GN=ICL2 PE=2 SV=1 1 103 3.0E-30
sp|G9NNY7|ACEB_HYPAI 2-methylisocitrate lyase, mitochondrial OS=Hypocrea atroviridis (strain ATCC 20476 / IMI 206040) GN=mcl PE=3 SV=1 7 103 4.0E-23
sp|C8V9Y5|ACEB_EMENI Methylisocitrate lyase, mitochondrial OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=mclA PE=1 SV=1 7 100 5.0E-17
sp|Q6BZP5|ACEB_YARLI 2-methylisocitrate lyase, mitochondrial OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YALI0F31999g PE=1 SV=1 7 103 7.0E-17
sp|Q12031|ACEB_YEAST Mitochondrial 2-methylisocitrate lyase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ICL2 PE=1 SV=1 7 103 8.0E-16
sp|P20699|ACEA_HELAN Isocitrate lyase (Fragment) OS=Helianthus annuus PE=2 SV=1 46 101 1.0E-14
sp|Q10663|GCP_CAEEL Bifunctional glyoxylate cycle protein OS=Caenorhabditis elegans GN=icl-1 PE=1 SV=2 1 104 3.0E-12
sp|P0A9G6|ACEA_ECOLI Isocitrate lyase OS=Escherichia coli (strain K12) GN=aceA PE=1 SV=1 8 103 2.0E-11
sp|P0A9G7|ACEA_ECOL6 Isocitrate lyase OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=aceA PE=3 SV=1 8 103 2.0E-11
sp|P51066|ACEA_SALTY Isocitrate lyase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=aceA PE=3 SV=2 8 103 4.0E-11
sp|P41554|ACEA_RHOFA Isocitrate lyase OS=Rhodococcus fascians GN=icl PE=3 SV=1 9 104 6.0E-08
sp|P42449|ACEA_CORGL Isocitrate lyase OS=Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / LMG 3730 / NCIMB 10025) GN=aceA PE=1 SV=2 9 104 1.0E-07
sp|Q8RQN6|ACEA_COREF Isocitrate lyase OS=Corynebacterium efficiens (strain DSM 44549 / YS-314 / AJ 12310 / JCM 11189 / NBRC 100395) GN=aceA PE=3 SV=4 9 104 2.0E-07
sp|P9WKK7|ACEA_MYCTU Isocitrate lyase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=icl PE=1 SV=1 9 104 3.0E-07
sp|P9WKK6|ACEA1_MYCTO Isocitrate lyase 1 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=icl1 PE=1 SV=1 9 104 3.0E-07
sp|H8EVV4|ACEA1_MYCTE Isocitrate lyase 1 OS=Mycobacterium tuberculosis (strain ATCC 35801 / TMC 107 / Erdman) GN=icl1 PE=1 SV=1 9 104 3.0E-07
sp|P0A5H4|ACEA1_MYCBO Isocitrate lyase 1 OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=icl PE=3 SV=1 9 104 3.0E-07
sp|Q9K9H0|ACEA_BACHD Isocitrate lyase OS=Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125) GN=aceA PE=3 SV=1 7 104 1.0E-06
sp|Q9I0K4|ACEA_PSEAE Isocitrate lyase OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=PA2634 PE=1 SV=1 14 104 7.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0004451 isocitrate lyase activity Yes
GO:0019752 carboxylic acid metabolic process Yes
GO:0016829 lyase activity No
GO:0003824 catalytic activity No
GO:0009987 cellular process No
GO:0003674 molecular_function No
GO:0008152 metabolic process No
GO:0008150 biological_process No
GO:0043436 oxoacid metabolic process No
GO:0016833 oxo-acid-lyase activity No
GO:0044237 cellular metabolic process No
GO:0071704 organic substance metabolic process No
GO:0044281 small molecule metabolic process No
GO:0006082 organic acid metabolic process No
GO:0016830 carbon-carbon lyase activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 36 0.5

Transmembrane Domains

Domain # Start End Length
1 13 35 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|3331
MPPSDQETYIRRLANLGYCWQFITLAGLHTTALISHRFAEAFSRIGMRAYGELVQVPEMDLGVDVVKHQKWSGAS
YVDELQKMVTGGVSSTAAMGKGVTEDQFH*
Coding >OphauB2|3331
ATGCCCCCCTCTGACCAAGAAACCTATATCCGCCGCCTCGCCAACCTCGGCTACTGCTGGCAATTCATCACCCTC
GCCGGCCTGCACACCACCGCCCTCATCTCCCACCGCTTCGCAGAGGCCTTTTCCCGCATCGGCATGCGCGCCTAC
GGCGAGCTCGTCCAGGTGCCCGAAATGGACTTGGGCGTCGACGTGGTCAAGCATCAGAAATGGAGTGGCGCGTCC
TATGTAGATGAGTTGCAGAAAATGGTGACGGGTGGGGTGAGTTCCACGGCCGCCATGGGAAAGGGCGTTACCGAG
GATCAGTTTCACTAG
Transcript >OphauB2|3331
ATGCCCCCCTCTGACCAAGAAACCTATATCCGCCGCCTCGCCAACCTCGGCTACTGCTGGCAATTCATCACCCTC
GCCGGCCTGCACACCACCGCCCTCATCTCCCACCGCTTCGCAGAGGCCTTTTCCCGCATCGGCATGCGCGCCTAC
GGCGAGCTCGTCCAGGTGCCCGAAATGGACTTGGGCGTCGACGTGGTCAAGCATCAGAAATGGAGTGGCGCGTCC
TATGTAGATGAGTTGCAGAAAATGGTGACGGGTGGGGTGAGTTCCACGGCCGCCATGGGAAAGGGCGTTACCGAG
GATCAGTTTCACTAG
Gene >OphauB2|3331
ATGCCCCCCTCTGACCAAGAAACCTATATCCGCCGCCTCGCCAACCTCGGCTACTGCTGGCAATTCATCACCCTC
GCCGGCCTGCACACCACCGCCCTCATCTCCCACCGCTTCGCAGAGGCCTTTTCCCGCATCGGCATGCGCGCCTAC
GGCGAGCTCGTCCAGGTGCCCGAAATGGACTTGGGCGTCGACGTGGTCAAGCATCAGAAATGGAGTGGCGCGTCC
TATGTAGATGAGTTGCAGAAAATGGTGACGGGTGGGGTGAGTTCCACGGCCGCCATGGGAAAGGGCGTTACCGAG
GATCAGTTTCACTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail