Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|3307
Gene name
LocationContig_21:177304..178158
Strand+
Gene length (bp)854
Transcript length (bp)462
Coding sequence length (bp)462
Protein length (aa) 154

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00241 Cofilin_ADF Cofilin/tropomyosin-type actin-binding protein 1.1E-38 12 145

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q4I963|COFI_GIBZE Cofilin OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=COF1 PE=3 SV=2 1 153 1.0E-87
sp|Q6BWX4|COFI_DEBHA Cofilin OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=COF1 PE=3 SV=1 1 150 2.0E-43
sp|Q6FV81|COFI_CANGA Cofilin OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=COF1 PE=3 SV=1 1 150 5.0E-42
sp|Q6C0Y0|COFI_YARLI Cofilin OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=COF1 PE=3 SV=1 1 150 6.0E-42
sp|Q96VU9|COFI_OGAPD Cofilin OS=Ogataea parapolymorpha (strain DL-1 / ATCC 26012 / NRRL Y-7560) GN=COF1 PE=2 SV=1 1 149 2.0E-41
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q4I963|COFI_GIBZE Cofilin OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=COF1 PE=3 SV=2 1 153 1.0E-87
sp|Q6BWX4|COFI_DEBHA Cofilin OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=COF1 PE=3 SV=1 1 150 2.0E-43
sp|Q6FV81|COFI_CANGA Cofilin OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=COF1 PE=3 SV=1 1 150 5.0E-42
sp|Q6C0Y0|COFI_YARLI Cofilin OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=COF1 PE=3 SV=1 1 150 6.0E-42
sp|Q96VU9|COFI_OGAPD Cofilin OS=Ogataea parapolymorpha (strain DL-1 / ATCC 26012 / NRRL Y-7560) GN=COF1 PE=2 SV=1 1 149 2.0E-41
sp|P78929|COFI_SCHPO Cofilin OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cof1 PE=1 SV=1 1 149 3.0E-41
sp|P0CM06|COFI_CRYNJ Cofilin OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=COF1 PE=3 SV=1 4 149 1.0E-40
sp|P0CM07|COFI_CRYNB Cofilin OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=COF1 PE=3 SV=1 4 149 1.0E-40
sp|Q6CQ22|COFI_KLULA Cofilin OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=COF1 PE=3 SV=1 1 150 6.0E-40
sp|Q759P0|COFI_ASHGO Cofilin OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=COF1 PE=3 SV=1 1 150 8.0E-40
sp|Q03048|COFI_YEAST Cofilin OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=COF1 PE=1 SV=1 1 150 5.0E-39
sp|Q9HF97|COFI_ZYGRO Cofilin OS=Zygosaccharomyces rouxii GN=cof1 PE=2 SV=1 1 149 1.0E-38
sp|Q4P6E9|COFI_USTMA Cofilin OS=Ustilago maydis (strain 521 / FGSC 9021) GN=COF1 PE=3 SV=1 4 149 5.0E-38
sp|P37167|ACTP_ACACA Actophorin OS=Acanthamoeba castellanii PE=1 SV=2 4 143 5.0E-26
sp|Q9FVI1|ADF2_PETHY Actin-depolymerizing factor 2 OS=Petunia hybrida GN=ADF2 PE=2 SV=1 4 138 1.0E-24
sp|Q9ZSK4|ADF3_ARATH Actin-depolymerizing factor 3 OS=Arabidopsis thaliana GN=ADF3 PE=1 SV=1 4 139 3.0E-24
sp|Q9FVI2|ADF1_PETHY Actin-depolymerizing factor 1 OS=Petunia hybrida GN=ADF1 PE=2 SV=1 4 138 1.0E-23
sp|Q39250|ADF1_ARATH Actin-depolymerizing factor 1 OS=Arabidopsis thaliana GN=ADF1 PE=1 SV=1 4 139 2.0E-23
sp|Q9ZSK3|ADF4_ARATH Actin-depolymerizing factor 4 OS=Arabidopsis thaliana GN=ADF4 PE=2 SV=2 4 146 8.0E-23
sp|Q8LFH6|ADF12_ARATH Actin-depolymerizing factor 12 OS=Arabidopsis thaliana GN=ADF12 PE=2 SV=2 4 138 2.0E-22
sp|Q67ZM4|ADF7_ARATH Actin-depolymerizing factor 7 OS=Arabidopsis thaliana GN=ADF7 PE=2 SV=1 4 143 4.0E-22
sp|Q39251|ADF2_ARATH Actin-depolymerizing factor 2 OS=Arabidopsis thaliana GN=ADF2 PE=2 SV=1 4 138 5.0E-22
sp|Q9LQ81|ADF10_ARATH Actin-depolymerizing factor 10 OS=Arabidopsis thaliana GN=ADF10 PE=2 SV=1 2 138 5.0E-22
sp|Q7XSN9|ADF6_ORYSJ Actin-depolymerizing factor 6 OS=Oryza sativa subsp. japonica GN=ADF6 PE=2 SV=2 2 143 8.0E-22
sp|Q570Y6|ADF8_ARATH Actin-depolymerizing factor 8 OS=Arabidopsis thaliana GN=ADF8 PE=2 SV=2 2 138 1.0E-21
sp|P30175|ADF_LILLO Actin-depolymerizing factor OS=Lilium longiflorum PE=2 SV=1 2 138 2.0E-21
sp|P0DJ27|COFB_DICDI Cofilin-1B OS=Dictyostelium discoideum GN=cofB PE=1 SV=1 4 149 5.0E-21
sp|P0DJ26|COFA_DICDI Cofilin-1A OS=Dictyostelium discoideum GN=cofA PE=1 SV=1 4 149 5.0E-21
sp|Q2QLT8|ADF11_ORYSJ Actin-depolymerizing factor 11 OS=Oryza sativa subsp. japonica GN=ADF11 PE=2 SV=1 4 141 6.0E-21
sp|Q6EUH7|ADF1_ORYSJ Actin-depolymerizing factor 1 OS=Oryza sativa subsp. japonica GN=ADF1 PE=2 SV=1 2 143 9.0E-21
sp|P21566|COF2_CHICK Cofilin-2 OS=Gallus gallus GN=CFL2 PE=1 SV=2 4 144 5.0E-20
sp|Q9ZNT3|ADF5_ARATH Actin-depolymerizing factor 5 OS=Arabidopsis thaliana GN=ADF5 PE=1 SV=1 1 138 5.0E-20
sp|Q9AY76|ADF2_ORYSJ Actin-depolymerizing factor 2 OS=Oryza sativa subsp. japonica GN=ADF2 PE=2 SV=1 4 141 8.0E-20
sp|Q9ZSK2|ADF6_ARATH Actin-depolymerizing factor 6 OS=Arabidopsis thaliana GN=ADF6 PE=1 SV=1 4 141 1.0E-19
sp|P45591|COF2_MOUSE Cofilin-2 OS=Mus musculus GN=Cfl2 PE=1 SV=1 4 144 1.0E-19
sp|Q5G6V9|COF2_PIG Cofilin-2 OS=Sus scrofa GN=CFL2 PE=2 SV=4 4 144 1.0E-19
sp|Q9Y281|COF2_HUMAN Cofilin-2 OS=Homo sapiens GN=CFL2 PE=1 SV=1 4 144 1.0E-19
sp|Q148F1|COF2_BOVIN Cofilin-2 OS=Bos taurus GN=CFL2 PE=2 SV=1 4 144 1.0E-19
sp|Q43694|ADF2_MAIZE Actin-depolymerizing factor 2 OS=Zea mays GN=ADF2 PE=2 SV=1 2 143 1.0E-19
sp|Q84TB6|ADF3_ORYSJ Actin-depolymerizing factor 3 OS=Oryza sativa subsp. japonica GN=ADF3 PE=1 SV=1 2 138 1.0E-19
sp|Q84TB3|ADF4_ORYSJ Actin-depolymerizing factor 4 OS=Oryza sativa subsp. japonica GN=ADF4 PE=2 SV=1 2 138 2.0E-19
sp|Q41764|ADF3_MAIZE Actin-depolymerizing factor 3 OS=Zea mays GN=ADF3 PE=1 SV=1 2 143 2.0E-19
sp|Q8H2P8|ADF9_ORYSJ Actin-depolymerizing factor 9 OS=Oryza sativa subsp. japonica GN=ADF9 PE=2 SV=1 2 138 6.0E-19
sp|O49606|ADF9_ARATH Actin-depolymerizing factor 9 OS=Arabidopsis thaliana GN=ADF9 PE=2 SV=2 2 143 1.0E-18
sp|P46251|ADF1_MAIZE Actin-depolymerizing factor 1 OS=Zea mays GN=ADF1 PE=2 SV=1 2 143 2.0E-18
sp|P45594|CADF_DROME Cofilin/actin-depolymerizing factor homolog OS=Drosophila melanogaster GN=tsr PE=1 SV=1 4 143 2.0E-18
sp|P86293|CADF2_PLAFX Cofilin/actin-depolymerizing factor homolog 2 OS=Plasmodium falciparum (isolate HB3) PE=2 SV=1 4 147 8.0E-18
sp|Q8ID92|CADF2_PLAF7 Cofilin/actin-depolymerizing factor homolog 2 OS=Plasmodium falciparum (isolate 3D7) GN=PF13_0326 PE=3 SV=1 4 147 8.0E-18
sp|P18760|COF1_MOUSE Cofilin-1 OS=Mus musculus GN=Cfl1 PE=1 SV=3 4 144 1.0E-17
sp|Q0DLA3|ADF7_ORYSJ Actin-depolymerizing factor 7 OS=Oryza sativa subsp. japonica GN=ADF7 PE=3 SV=2 4 138 2.0E-17
sp|P45592|COF1_RAT Cofilin-1 OS=Rattus norvegicus GN=Cfl1 PE=1 SV=3 4 144 3.0E-17
sp|P23528|COF1_HUMAN Cofilin-1 OS=Homo sapiens GN=CFL1 PE=1 SV=3 4 144 3.0E-17
sp|Q5XHH8|COF2_XENLA Cofilin-2 OS=Xenopus laevis GN=cfl2 PE=2 SV=1 4 144 4.0E-17
sp|Q5U4Y2|COF2_XENTR Cofilin-2 OS=Xenopus tropicalis GN=cfl2 PE=2 SV=1 4 144 4.0E-17
sp|Q6B7M7|COF1_SHEEP Cofilin-1 OS=Ovis aries GN=CFL1 PE=2 SV=3 4 144 6.0E-17
sp|P10668|COF1_PIG Cofilin-1 OS=Sus scrofa GN=CFL1 PE=1 SV=3 4 144 6.0E-17
sp|Q4R5C0|COF1_MACFA Cofilin-1 OS=Macaca fascicularis GN=CFL1 PE=2 SV=3 4 144 6.0E-17
sp|Q5E9F7|COF1_BOVIN Cofilin-1 OS=Bos taurus GN=CFL1 PE=2 SV=3 4 144 6.0E-17
sp|P30174|ADF_BRANA Actin-depolymerizing factor (Fragment) OS=Brassica napus PE=2 SV=1 74 143 3.0E-16
sp|Q10P87|ADF5_ORYSJ Actin-depolymerizing factor 5 OS=Oryza sativa subsp. japonica GN=ADF5 PE=2 SV=1 1 143 4.0E-16
sp|Q54R65|COF4_DICDI Cofilin-4 OS=Dictyostelium discoideum GN=cofE PE=3 SV=1 3 138 9.0E-16
sp|Q9LZT3|ADF11_ARATH Putative actin-depolymerizing factor 11 OS=Arabidopsis thaliana GN=ADF11 PE=3 SV=1 8 148 1.0E-15
sp|Q337A5|ADF10_ORYSJ Actin-depolymerizing factor 10 OS=Oryza sativa subsp. japonica GN=ADF10 PE=2 SV=1 2 141 1.0E-15
sp|Q7M0E3|DEST_RAT Destrin OS=Rattus norvegicus GN=Dstn PE=1 SV=3 4 143 1.0E-15
sp|P45593|COF1B_XENLA Cofilin-1-B OS=Xenopus laevis GN=cfl1-b PE=1 SV=3 4 138 2.0E-15
sp|Q8SAG3|ADF_VITVI Actin-depolymerizing factor OS=Vitis vinifera PE=2 SV=1 74 141 3.0E-15
sp|Q9R0P5|DEST_MOUSE Destrin OS=Mus musculus GN=Dstn PE=1 SV=3 4 143 3.0E-15
sp|P18359|DEST_CHICK Destrin OS=Gallus gallus GN=DSTN PE=1 SV=3 4 143 8.0E-15
sp|P60982|DEST_PIG Destrin OS=Sus scrofa GN=DSTN PE=1 SV=3 4 143 1.0E-14
sp|P60981|DEST_HUMAN Destrin OS=Homo sapiens GN=DSTN PE=1 SV=3 4 143 1.0E-14
sp|Q5E9D5|DEST_BOVIN Destrin OS=Bos taurus GN=DSTN PE=2 SV=3 4 143 1.0E-14
sp|P45695|COF1A_XENLA Cofilin-1-A OS=Xenopus laevis GN=cfl1-a PE=1 SV=3 4 138 5.0E-14
sp|Q6NX11|COF1_XENTR Cofilin-1 OS=Xenopus tropicalis GN=cfl1 PE=2 SV=3 4 138 6.0E-14
sp|Q0D744|ADF8_ORYSJ Putative actin-depolymerizing factor 8 OS=Oryza sativa subsp. japonica GN=ADF8 PE=3 SV=2 2 141 1.0E-13
sp|Q07749|ADF2_CAEEL Actin-depolymerizing factor 2, isoform c OS=Caenorhabditis elegans GN=unc-60 PE=1 SV=1 4 143 3.0E-13
sp|Q07750|ADF1_CAEEL Actin-depolymerizing factor 1, isoforms a/b OS=Caenorhabditis elegans GN=unc-60 PE=1 SV=2 4 144 7.0E-12
sp|Q556H5|COF3_DICDI Cofilin-3 OS=Dictyostelium discoideum GN=cofD-1 PE=3 SV=1 6 152 1.0E-08
sp|Q12792|TWF1_HUMAN Twinfilin-1 OS=Homo sapiens GN=TWF1 PE=1 SV=3 26 125 1.0E-06
sp|Q5R7N2|TWF1_PONAB Twinfilin-1 OS=Pongo abelii GN=TWF1 PE=2 SV=1 26 125 2.0E-06
sp|Q5RJR2|TWF1_RAT Twinfilin-1 OS=Rattus norvegicus GN=Twf1 PE=1 SV=1 26 125 3.0E-06
sp|Q91YR1|TWF1_MOUSE Twinfilin-1 OS=Mus musculus GN=Twf1 PE=1 SV=2 26 125 3.0E-06
sp|O94399|TWF1_SCHPO Twinfilin OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=twf1 PE=1 SV=1 33 149 5.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0003779 actin binding Yes
GO:0005515 protein binding No
GO:0008092 cytoskeletal protein binding No
GO:0003674 molecular_function No
GO:0005488 binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 58 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|3307
MSQSGASVSQECITAYNDLKLSKKLKYIIYKLSDDNKQIVVEEASDDKDWEKFRQKLINATSKSKSGTVGKGPRY
AVYDFEYSLASGDGVRNKLAFIAWSPDDAGVQPKMIYASSKEALKRALTGIAVELQANDPDDIEHESVLKTVSKG
LAG*
Coding >OphauB2|3307
ATGTCTCAGTCAGGAGCGAGCGTTTCTCAAGAGTGCATAACCGCCTACAATGATTTGAAGCTGTCCAAGAAACTC
AAATACATCATTTATAAGCTGTCGGACGACAACAAGCAGATTGTGGTTGAGGAAGCATCCGATGACAAGGACTGG
GAGAAGTTCCGCCAGAAGCTCATCAACGCCACGTCCAAGAGCAAGTCGGGCACCGTCGGCAAGGGTCCCCGCTAT
GCTGTTTACGACTTTGAGTACAGCCTAGCGTCTGGAGACGGTGTGCGAAACAAGCTCGCCTTTATCGCTTGGTCT
CCTGATGATGCTGGGGTTCAGCCCAAGATGATTTACGCTTCTTCCAAAGAAGCCTTGAAACGGGCCTTGACTGGT
ATCGCGGTGGAACTGCAGGCCAACGATCCAGATGATATCGAGCACGAATCCGTCCTCAAGACCGTCAGCAAGGGC
CTCGCTGGCTAG
Transcript >OphauB2|3307
ATGTCTCAGTCAGGAGCGAGCGTTTCTCAAGAGTGCATAACCGCCTACAATGATTTGAAGCTGTCCAAGAAACTC
AAATACATCATTTATAAGCTGTCGGACGACAACAAGCAGATTGTGGTTGAGGAAGCATCCGATGACAAGGACTGG
GAGAAGTTCCGCCAGAAGCTCATCAACGCCACGTCCAAGAGCAAGTCGGGCACCGTCGGCAAGGGTCCCCGCTAT
GCTGTTTACGACTTTGAGTACAGCCTAGCGTCTGGAGACGGTGTGCGAAACAAGCTCGCCTTTATCGCTTGGTCT
CCTGATGATGCTGGGGTTCAGCCCAAGATGATTTACGCTTCTTCCAAAGAAGCCTTGAAACGGGCCTTGACTGGT
ATCGCGGTGGAACTGCAGGCCAACGATCCAGATGATATCGAGCACGAATCCGTCCTCAAGACCGTCAGCAAGGGC
CTCGCTGGCTAG
Gene >OphauB2|3307
ATGGTGAGAAGCTCTCCAATAGAAAGTCGTGAACGACTGCGATGATACTGACTTTACGATGTAGTCTCAGTCAGG
GTTAGTTGTCCTGTTGACTTGTTCCATCCTCGGATGCGCCGTTGCTTGAATACTGGCTTCGCAGCCAGGCTCTCC
TGGCACAGGCGTATTTTCTCTGCCTCATTTCGGGCCCCGACAGACCGAATCGGCACTGATTATCTCGTCTGATTT
TTAGAGCGAGCGTTTCTCAAGAGTGCATAACCGCCTACAATGATTTGAAGCTGTCCAAGAAACTCAAATACATCA
TTTATAAGCTGTCGGACGACAACAAGCAGATTGTGGTTGAGGAAGCATCCGATGACAAGGACTGGGAGAAGTTCC
GCCAGAAGCTCATCAACGCCACGTCCAAGAGCAAGTCGGTTCGTCATTGACCTGCTACGTAACATTGCCACCGCA
GTATCTGATTGGAAGCAGGGCACCGTCGGCAAGGGTCCCCGCTATGCTGTTTACGACTTTGAGTACAGCCTAGCG
TCTGGAGACGGTGTGCGGTGTGTAATGACTTGGTATTTCGTCTTGGTTTCTTTCTGTACTTACTGACCGAATATA
GAAACAAGCTCGCCTTTATCGCTTGGTCTCCTGATGATGCTGGGGTTCAGGTAACAGAACAGCGTCTTGAACTCA
ACCTCATTTCTCACGCTAACCAAATGCCCACCTCGCAGCCCAAGATGATTTACGCTTCTTCCAAAGAAGCCTTGA
AACGGGCCTTGACTGGTATCGCGGTGGAACTGCAGGCCAACGATCCAGATGATATCGAGCACGAATCCGTCCTCA
AGACCGTCAGCAAGGGCCTCGCTGGCTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail