Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|3300
Gene name
LocationContig_21:162441..163578
Strand-
Gene length (bp)1137
Transcript length (bp)885
Coding sequence length (bp)885
Protein length (aa) 295

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

(None)

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup264
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|4823
Ophiocordyceps australis 1348a (Ghana) OphauG2|4824
Ophiocordyceps australis map64 (Brazil) OphauB2|3299
Ophiocordyceps australis map64 (Brazil) OphauB2|3300 (this protein)
Ophiocordyceps camponoti-floridani Ophcf2|06695
Ophiocordyceps camponoti-floridani Ophcf2|06696
Ophiocordyceps camponoti-rufipedis Ophun1|6321
Ophiocordyceps kimflemingae Ophio5|1555
Ophiocordyceps kimflemingae Ophio5|1556
Ophiocordyceps subramaniannii Hirsu2|10758
Ophiocordyceps subramaniannii Hirsu2|10759

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|3300
MAMNTKNWNDRADKDLFFTILSVKNIGVISGAEWTTIGNHMRALGYGFTNEGCRQHFQGLRRAQNKADANGAVTP
ESSRRVDPTLNPITRRPGPGRGRPRKQQQQQQQSEQQEQQSPQQHQQQAQQQSIGPNNVHSNVSMTTPVQMQAAV
GGPFPGAIAEPYYTNMMIPPATPNQSLQAHGPSTPPQGLDKAAVGAQDSAATLASDTGVPDGLHISQGDEAADAD
VDADGAESVQPEPSEENEDHPAKRQKMEQEEEPDVAAETEADPTHDPALEDEAVLALAEHNGFDNYGEA*
Coding >OphauB2|3300
ATGGCTATGAATACCAAGAACTGGAACGACCGTGCTGACAAGGACCTGTTCTTCACTATACTATCCGTAAAGAAT
ATTGGCGTTATCAGCGGCGCAGAATGGACCACGATAGGCAACCACATGAGAGCACTTGGATATGGCTTTACCAAT
GAAGGCTGTCGACAACACTTTCAAGGCCTCCGCCGGGCCCAGAACAAGGCCGACGCCAACGGCGCTGTCACGCCG
GAATCCTCTCGTCGCGTCGACCCAACTTTAAATCCTATTACTAGGAGACCGGGCCCAGGACGAGGTCGACCCAGG
AAGCAGCAGCAGCAGCAACAGCAATCTGAACAGCAAGAACAGCAGAGTCCTCAGCAGCACCAACAGCAGGCACAG
CAACAATCCATCGGGCCCAATAATGTACATAGCAACGTCTCCATGACCACTCCCGTCCAGATGCAAGCCGCAGTG
GGAGGGCCATTTCCAGGGGCCATAGCAGAGCCATATTATACCAACATGATGATACCTCCAGCAACTCCAAACCAG
TCTCTGCAGGCTCACGGGCCTTCGACTCCGCCGCAAGGACTCGACAAAGCCGCGGTCGGTGCCCAAGACTCAGCA
GCGACTCTGGCATCAGATACTGGTGTGCCTGACGGGCTGCACATTTCACAAGGCGACGAGGCTGCTGATGCAGAT
GTCGATGCAGATGGAGCAGAGAGTGTGCAGCCTGAGCCGTCAGAGGAAAACGAGGACCACCCAGCTAAGCGACAA
AAGATGGAACAAGAGGAAGAGCCCGATGTAGCAGCCGAGACTGAGGCAGATCCCACACACGACCCAGCTCTTGAA
GACGAAGCAGTGCTTGCTCTTGCTGAGCACAACGGATTTGACAATTACGGAGAGGCATAA
Transcript >OphauB2|3300
ATGGCTATGAATACCAAGAACTGGAACGACCGTGCTGACAAGGACCTGTTCTTCACTATACTATCCGTAAAGAAT
ATTGGCGTTATCAGCGGCGCAGAATGGACCACGATAGGCAACCACATGAGAGCACTTGGATATGGCTTTACCAAT
GAAGGCTGTCGACAACACTTTCAAGGCCTCCGCCGGGCCCAGAACAAGGCCGACGCCAACGGCGCTGTCACGCCG
GAATCCTCTCGTCGCGTCGACCCAACTTTAAATCCTATTACTAGGAGACCGGGCCCAGGACGAGGTCGACCCAGG
AAGCAGCAGCAGCAGCAACAGCAATCTGAACAGCAAGAACAGCAGAGTCCTCAGCAGCACCAACAGCAGGCACAG
CAACAATCCATCGGGCCCAATAATGTACATAGCAACGTCTCCATGACCACTCCCGTCCAGATGCAAGCCGCAGTG
GGAGGGCCATTTCCAGGGGCCATAGCAGAGCCATATTATACCAACATGATGATACCTCCAGCAACTCCAAACCAG
TCTCTGCAGGCTCACGGGCCTTCGACTCCGCCGCAAGGACTCGACAAAGCCGCGGTCGGTGCCCAAGACTCAGCA
GCGACTCTGGCATCAGATACTGGTGTGCCTGACGGGCTGCACATTTCACAAGGCGACGAGGCTGCTGATGCAGAT
GTCGATGCAGATGGAGCAGAGAGTGTGCAGCCTGAGCCGTCAGAGGAAAACGAGGACCACCCAGCTAAGCGACAA
AAGATGGAACAAGAGGAAGAGCCCGATGTAGCAGCCGAGACTGAGGCAGATCCCACACACGACCCAGCTCTTGAA
GACGAAGCAGTGCTTGCTCTTGCTGAGCACAACGGATTTGACAATTACGGAGAGGCATAA
Gene >OphauB2|3300
ATGGCTATGAATACCAAGAACTGGAACGACCGTGCTGACAAGGACCTGTTCTTCACTATACTATCCGTAAAGAAT
ATTGGCGTTATCAGCGGCGCAGAATGGACCACGATAGGCAACCACATGAGAGCACTTGGATATGGCTTTACCAAT
GAAGGCTGTCGGTCAGTACTTGCACCCATTTTTTACACTTGCACAGTGCCGCTTATATCAGATGCATCTCGGTGC
ATCAATTTATTTTTGCCTCCATGACGTTTGATAATGAGACGTAGTTGCTCACCTGACGAGCGTTGGATACCACCA
TGTCGTGCTGCCTGCATCTGTTTTGTTCTGGGCACTGACTCTTGCTCTCTATAGACAACACTTTCAAGGCCTCCG
CCGGGCCCAGAACAAGGCCGACGCCAACGGCGCTGTCACGCCGGAATCCTCTCGTCGCGTCGACCCAACTTTAAA
TCCTATTACTAGGAGACCGGGCCCAGGACGAGGTCGACCCAGGAAGCAGCAGCAGCAGCAACAGCAATCTGAACA
GCAAGAACAGCAGAGTCCTCAGCAGCACCAACAGCAGGCACAGCAACAATCCATCGGGCCCAATAATGTACATAG
CAACGTCTCCATGACCACTCCCGTCCAGATGCAAGCCGCAGTGGGAGGGCCATTTCCAGGGGCCATAGCAGAGCC
ATATTATACCAACATGATGATACCTCCAGCAACTCCAAACCAGTCTCTGCAGGCTCACGGGCCTTCGACTCCGCC
GCAAGGACTCGACAAAGCCGCGGTCGGTGCCCAAGACTCAGCAGCGACTCTGGCATCAGATACTGGTGTGCCTGA
CGGGCTGCACATTTCACAAGGCGACGAGGCTGCTGATGCAGATGTCGATGCAGATGGAGCAGAGAGTGTGCAGCC
TGAGCCGTCAGAGGAAAACGAGGACCACCCAGCTAAGCGACAAAAGATGGAACAAGAGGAAGAGCCCGATGTAGC
AGCCGAGACTGAGGCAGATCCCACACACGACCCAGCTCTTGAAGACGAAGCAGTGCTTGCTCTTGCTGAGCACAA
CGGGTTAGAAGAAACAAAGCTGCGATGCCTTGTATCGACTTGGCTAATTGAAGGTGCTGCAGATTTGACAATTAC
GGAGAGGCATAA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail