Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|3288
Gene name
LocationContig_21:135291..136259
Strand+
Gene length (bp)968
Transcript length (bp)888
Coding sequence length (bp)888
Protein length (aa) 296

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF08690 GET2 GET complex subunit GET2 1.2E-42 10 290

Swissprot hits

(None)

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

Domain # Start End Length
1 169 191 22
2 218 237 19
3 271 293 22

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup1344
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|4336
Ophiocordyceps australis map64 (Brazil) OphauB2|3288 (this protein)
Ophiocordyceps camponoti-floridani Ophcf2|06687
Ophiocordyceps camponoti-rufipedis Ophun1|93
Ophiocordyceps kimflemingae Ophio5|6067
Ophiocordyceps subramaniannii Hirsu2|10744

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|3288
MAEGATGSSSPAEQARLRKERREAKIKAGGSARLSKITGMGERVVGDSSDATATPMAKTAAVAADPEEVDISQHY
YAPRTTQRRDETPLGPQPSEAELRKMMLGLDNQSSTLGPGGAPAEQDALAQMMSQMMGGSGLGPGASPFAGMPSP
MMQAQQQPGPDAYTTLFRLVHAIVGLGLGLYVIMVTPFTGTRLEREREALAATSSLGYASELEHHRRFFFWLFAS
AETILLSTRFLLDKGRAPPPGMLWTLLAYLPEPWKGYLGVGLRYGQIFTTVRTDILACMFVMGVCAWCRS*
Coding >OphauB2|3288
ATGGCAGAGGGTGCGACAGGCTCATCAAGCCCAGCCGAGCAGGCGCGGCTGCGCAAGGAGCGCCGAGAGGCCAAG
ATCAAGGCTGGTGGCTCTGCGCGCCTGAGCAAGATTACGGGCATGGGAGAGCGGGTTGTCGGTGATTCTTCTGAT
GCGACTGCGACGCCAATGGCCAAGACGGCAGCCGTGGCAGCAGATCCAGAAGAAGTCGACATTTCACAGCACTAC
TATGCCCCGCGGACGACGCAGAGACGCGACGAGACGCCCCTGGGGCCACAGCCGTCCGAGGCGGAGCTGCGGAAA
ATGATGCTTGGTCTGGATAACCAGTCGTCGACGCTGGGCCCGGGAGGAGCCCCTGCAGAGCAAGACGCGCTGGCC
CAGATGATGTCGCAAATGATGGGTGGCAGCGGGCTTGGACCCGGCGCGTCGCCCTTTGCCGGCATGCCCTCGCCA
ATGATGCAGGCGCAGCAGCAACCAGGGCCCGACGCATACACGACGCTCTTTCGCCTCGTGCACGCCATTGTTGGC
CTGGGGCTGGGCCTCTACGTCATCATGGTGACGCCCTTTACCGGCACGCGTCTGGAGCGTGAGCGCGAGGCCCTG
GCTGCCACGTCTAGCCTGGGATACGCCAGCGAGCTGGAGCATCATCGCCGCTTCTTCTTTTGGCTTTTTGCCTCG
GCCGAGACAATTCTCCTCTCGACGCGCTTTCTCCTCGACAAGGGCCGTGCGCCCCCGCCCGGCATGCTCTGGACG
CTTTTGGCTTATCTCCCGGAGCCATGGAAGGGCTACCTCGGCGTGGGACTGCGCTATGGCCAAATATTCACAACG
GTCCGAACAGATATCCTGGCATGCATGTTTGTCATGGGAGTGTGTGCTTGGTGCCGGTCTTGA
Transcript >OphauB2|3288
ATGGCAGAGGGTGCGACAGGCTCATCAAGCCCAGCCGAGCAGGCGCGGCTGCGCAAGGAGCGCCGAGAGGCCAAG
ATCAAGGCTGGTGGCTCTGCGCGCCTGAGCAAGATTACGGGCATGGGAGAGCGGGTTGTCGGTGATTCTTCTGAT
GCGACTGCGACGCCAATGGCCAAGACGGCAGCCGTGGCAGCAGATCCAGAAGAAGTCGACATTTCACAGCACTAC
TATGCCCCGCGGACGACGCAGAGACGCGACGAGACGCCCCTGGGGCCACAGCCGTCCGAGGCGGAGCTGCGGAAA
ATGATGCTTGGTCTGGATAACCAGTCGTCGACGCTGGGCCCGGGAGGAGCCCCTGCAGAGCAAGACGCGCTGGCC
CAGATGATGTCGCAAATGATGGGTGGCAGCGGGCTTGGACCCGGCGCGTCGCCCTTTGCCGGCATGCCCTCGCCA
ATGATGCAGGCGCAGCAGCAACCAGGGCCCGACGCATACACGACGCTCTTTCGCCTCGTGCACGCCATTGTTGGC
CTGGGGCTGGGCCTCTACGTCATCATGGTGACGCCCTTTACCGGCACGCGTCTGGAGCGTGAGCGCGAGGCCCTG
GCTGCCACGTCTAGCCTGGGATACGCCAGCGAGCTGGAGCATCATCGCCGCTTCTTCTTTTGGCTTTTTGCCTCG
GCCGAGACAATTCTCCTCTCGACGCGCTTTCTCCTCGACAAGGGCCGTGCGCCCCCGCCCGGCATGCTCTGGACG
CTTTTGGCTTATCTCCCGGAGCCATGGAAGGGCTACCTCGGCGTGGGACTGCGCTATGGCCAAATATTCACAACG
GTCCGAACAGATATCCTGGCATGCATGTTTGTCATGGGAGTGTGTGCTTGGTGCCGGTCTTGA
Gene >OphauB2|3288
ATGGCAGAGGGTGCGACAGGCTCATCAAGCCCAGCCGAGCAGGCGCGGCTGCGCAAGGAGCGCCGAGAGGCCAAG
ATCAAGGCTGGTGGCTCTGCGCGCCTGAGCAAGATTACGGGCATGGGAGAGCGGGTTGTCGGTGGTGCGTCGGGA
GCTCTAGTCGTCGTGTCTCATTACAGCCTTTTTTTTTTTTGGCGTGCTGACAAGTGGTTGAGTGCCTAGATTCTT
CTGATGCGACTGCGACGCCAATGGCCAAGACGGCAGCCGTGGCAGCAGATCCAGAAGAAGTCGACATTTCACAGC
ACTACTATGCCCCGCGGACGACGCAGAGACGCGACGAGACGCCCCTGGGGCCACAGCCGTCCGAGGCGGAGCTGC
GGAAAATGATGCTTGGTCTGGATAACCAGTCGTCGACGCTGGGCCCGGGAGGAGCCCCTGCAGAGCAAGACGCGC
TGGCCCAGATGATGTCGCAAATGATGGGTGGCAGCGGGCTTGGACCCGGCGCGTCGCCCTTTGCCGGCATGCCCT
CGCCAATGATGCAGGCGCAGCAGCAACCAGGGCCCGACGCATACACGACGCTCTTTCGCCTCGTGCACGCCATTG
TTGGCCTGGGGCTGGGCCTCTACGTCATCATGGTGACGCCCTTTACCGGCACGCGTCTGGAGCGTGAGCGCGAGG
CCCTGGCTGCCACGTCTAGCCTGGGATACGCCAGCGAGCTGGAGCATCATCGCCGCTTCTTCTTTTGGCTTTTTG
CCTCGGCCGAGACAATTCTCCTCTCGACGCGCTTTCTCCTCGACAAGGGCCGTGCGCCCCCGCCCGGCATGCTCT
GGACGCTTTTGGCTTATCTCCCGGAGCCATGGAAGGGCTACCTCGGCGTGGGACTGCGCTATGGCCAAATATTCA
CAACGGTCCGAACAGATATCCTGGCATGCATGTTTGTCATGGGAGTGTGTGCTTGGTGCCGGTCTTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail