Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|3279
Gene name
LocationContig_21:117849..118528
Strand+
Gene length (bp)679
Transcript length (bp)627
Coding sequence length (bp)627
Protein length (aa) 209

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF05047 L51_S25_CI-B8 Mitochondrial ribosomal protein L51 / S25 / CI-B8 domain 1.1E-13 35 135

Swissprot hits

(None)

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 23 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|3279
MFNVRCGPGAAKLPMNITKIHMDFCASLIGGHQGAKKFWRENLPRLKYHNPQIPMLVNRHDENSKDSALSIFMRT
TANPPVTVDAPSSTTVNPSATADASSSTSEDKLFYSSRHNMCPLPSPAPNERIVQIQMKNVHSTEILKRFVDESG
AKEIKLTDMDSKEQVYFDELAKQRVMSLEAFKRRKANKAKERAFLRQARKAGGPKEAA*
Coding >OphauB2|3279
ATGTTCAACGTTCGATGCGGTCCTGGAGCTGCCAAACTGCCCATGAACATCACCAAGATTCATATGGACTTTTGC
GCAAGCCTCATTGGGGGCCACCAAGGCGCCAAGAAATTCTGGCGTGAAAACCTGCCTAGACTCAAATACCACAAC
CCACAAATCCCAATGTTGGTAAATCGACACGATGAAAACAGCAAAGACTCTGCTCTCTCAATCTTTATGCGTACC
ACAGCCAACCCACCCGTTACTGTCGATGCTCCTTCCAGCACCACGGTCAATCCATCAGCTACCGCCGATGCTTCT
TCTAGCACCAGCGAAGATAAACTATTCTACTCCTCCCGGCACAACATGTGCCCGCTGCCATCACCAGCCCCCAAC
GAGCGCATAGTCCAAATCCAGATGAAGAATGTTCATTCCACGGAAATACTTAAGCGCTTCGTTGACGAGAGTGGT
GCCAAGGAGATCAAGTTGACCGATATGGATAGCAAAGAGCAGGTATACTTTGACGAACTTGCGAAACAGCGCGTA
ATGTCTTTGGAGGCTTTCAAGCGGAGAAAGGCAAACAAGGCAAAGGAAAGGGCTTTCCTTCGGCAGGCCAGAAAG
GCCGGCGGACCGAAAGAAGCCGCCTAG
Transcript >OphauB2|3279
ATGTTCAACGTTCGATGCGGTCCTGGAGCTGCCAAACTGCCCATGAACATCACCAAGATTCATATGGACTTTTGC
GCAAGCCTCATTGGGGGCCACCAAGGCGCCAAGAAATTCTGGCGTGAAAACCTGCCTAGACTCAAATACCACAAC
CCACAAATCCCAATGTTGGTAAATCGACACGATGAAAACAGCAAAGACTCTGCTCTCTCAATCTTTATGCGTACC
ACAGCCAACCCACCCGTTACTGTCGATGCTCCTTCCAGCACCACGGTCAATCCATCAGCTACCGCCGATGCTTCT
TCTAGCACCAGCGAAGATAAACTATTCTACTCCTCCCGGCACAACATGTGCCCGCTGCCATCACCAGCCCCCAAC
GAGCGCATAGTCCAAATCCAGATGAAGAATGTTCATTCCACGGAAATACTTAAGCGCTTCGTTGACGAGAGTGGT
GCCAAGGAGATCAAGTTGACCGATATGGATAGCAAAGAGCAGGTATACTTTGACGAACTTGCGAAACAGCGCGTA
ATGTCTTTGGAGGCTTTCAAGCGGAGAAAGGCAAACAAGGCAAAGGAAAGGGCTTTCCTTCGGCAGGCCAGAAAG
GCCGGCGGACCGAAAGAAGCCGCCTAG
Gene >OphauB2|3279
ATGTTCAACGTTCGATGCGGTCCTGGAGCTGCCAAACTGCCCATGAACATCACCAAGATTCATATGGACTTTTGC
GCAAGCCTCATTGGGGGCCACCAAGGCGCCAAGTGCGTCCTTATTTTACATGCCTCTGAAGCCAGCATTGCTCAC
CATGACCAGGAAATTCTGGCGTGAAAACCTGCCTAGACTCAAATACCACAACCCACAAATCCCAATGTTGGTAAA
TCGACACGATGAAAACAGCAAAGACTCTGCTCTCTCAATCTTTATGCGTACCACAGCCAACCCACCCGTTACTGT
CGATGCTCCTTCCAGCACCACGGTCAATCCATCAGCTACCGCCGATGCTTCTTCTAGCACCAGCGAAGATAAACT
ATTCTACTCCTCCCGGCACAACATGTGCCCGCTGCCATCACCAGCCCCCAACGAGCGCATAGTCCAAATCCAGAT
GAAGAATGTTCATTCCACGGAAATACTTAAGCGCTTCGTTGACGAGAGTGGTGCCAAGGAGATCAAGTTGACCGA
TATGGATAGCAAAGAGCAGGTATACTTTGACGAACTTGCGAAACAGCGCGTAATGTCTTTGGAGGCTTTCAAGCG
GAGAAAGGCAAACAAGGCAAAGGAAAGGGCTTTCCTTCGGCAGGCCAGAAAGGCCGGCGGACCGAAAGAAGCCGC
CTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail