Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|3262
Gene name
LocationContig_21:77989..79160
Strand-
Gene length (bp)1171
Transcript length (bp)1101
Coding sequence length (bp)1101
Protein length (aa) 367

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF08551 DUF1751 Eukaryotic integral membrane protein (DUF1751) 5.4E-26 48 146

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q8LF05|RBL19_ARATH Rhomboid-like protein 19 OS=Arabidopsis thaliana GN=RBL19 PE=2 SV=1 41 305 4.0E-23
sp|Q12893|TM115_HUMAN Transmembrane protein 115 OS=Homo sapiens GN=TMEM115 PE=1 SV=1 56 339 1.0E-20
sp|A4FUB8|TM115_BOVIN Transmembrane protein 115 OS=Bos taurus GN=TMEM115 PE=2 SV=1 56 328 2.0E-19
sp|Q12239|TM115_YEAST Transmembrane protein 115 homolog OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YOL107W PE=1 SV=1 42 304 3.0E-18
sp|Q9WUH1|TM115_MOUSE Transmembrane protein 115 OS=Mus musculus GN=Tmem115 PE=1 SV=1 56 305 1.0E-17
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q8LF05|RBL19_ARATH Rhomboid-like protein 19 OS=Arabidopsis thaliana GN=RBL19 PE=2 SV=1 41 305 4.0E-23
sp|Q12893|TM115_HUMAN Transmembrane protein 115 OS=Homo sapiens GN=TMEM115 PE=1 SV=1 56 339 1.0E-20
sp|A4FUB8|TM115_BOVIN Transmembrane protein 115 OS=Bos taurus GN=TMEM115 PE=2 SV=1 56 328 2.0E-19
sp|Q12239|TM115_YEAST Transmembrane protein 115 homolog OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YOL107W PE=1 SV=1 42 304 3.0E-18
sp|Q9WUH1|TM115_MOUSE Transmembrane protein 115 OS=Mus musculus GN=Tmem115 PE=1 SV=1 56 305 1.0E-17
sp|O42826|PDH1_SCHPO Protein pdh1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pdh1 PE=3 SV=1 46 147 2.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0006890 retrograde vesicle-mediated transport, Golgi to endoplasmic reticulum Yes
GO:0016021 integral component of membrane Yes
GO:0110165 cellular anatomical entity No
GO:0016192 vesicle-mediated transport No
GO:0051179 localization No
GO:0008150 biological_process No
GO:0031224 intrinsic component of membrane No
GO:0051234 establishment of localization No
GO:0048193 Golgi vesicle transport No
GO:0005575 cellular_component No
GO:0006810 transport No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 26 0.5

Transmembrane Domains

Domain # Start End Length
1 10 28 18
2 40 59 19
3 63 85 22
4 97 119 22
5 134 156 22
6 168 190 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|3262
MPPRLNIPPVTRSVLIVLVFQSLLGAAIRYRQWTKHAEIIIPYLTLVPQLSLIYPWTFITSTLVEGNIVTLSIAG
VTLFHGGKYLERAWSSAELVKFLALVALLPNLMTFCVMMLFFALTRNESWALSVISGTVPVQISFLVAFSQLVPA
HTVTLFRGIISLRVPRFPLVYIGTVALLSLTPLLSRAAFWLALFGFLTSWTYLRFYKTVFPDLDSSQPASLRGDA
SDTFAFAEFFPAPMKPFVAAFSDQIFDVLVAIRLCTPFSQAELSMARGDRLLSRGTPGGARAEAERRRAIALKAL
DQRLSAATANAIHKMPSPVASPAQPSGPTIQIQPLPSTQTAMVSQPGHMLGETTFESEHDEEAKKS*
Coding >OphauB2|3262
ATGCCTCCGCGACTCAATATTCCTCCAGTCACGCGATCTGTCCTTATAGTCCTCGTCTTCCAGTCGCTCCTTGGC
GCTGCCATTCGCTACCGACAATGGACCAAGCATGCCGAAATCATCATACCATACCTGACATTGGTTCCGCAGCTT
TCTCTCATCTACCCTTGGACCTTTATTACGTCGACGCTGGTTGAGGGCAACATTGTCACCTTGTCAATTGCCGGA
GTCACACTCTTTCATGGTGGCAAGTATCTGGAACGCGCATGGTCTTCGGCCGAGTTGGTCAAATTTTTGGCTCTT
GTCGCGCTGCTGCCGAATCTAATGACGTTTTGCGTCATGATGCTGTTCTTTGCGCTGACGCGGAACGAGAGTTGG
GCCCTTTCCGTCATCTCTGGTACTGTCCCAGTCCAGATTTCTTTTCTAGTCGCCTTTAGCCAGCTCGTGCCCGCG
CATACCGTCACTCTCTTCCGAGGCATCATATCGTTAAGAGTACCTCGTTTTCCGCTCGTTTATATTGGGACTGTG
GCTCTCTTGTCGCTTACTCCATTACTATCCAGGGCCGCGTTTTGGCTGGCTCTGTTTGGCTTCCTCACCAGCTGG
ACCTACCTTCGATTCTACAAGACGGTGTTTCCAGACCTTGATTCATCGCAGCCCGCCTCTCTGCGGGGCGATGCA
AGTGATACTTTTGCGTTTGCCGAGTTCTTTCCCGCGCCCATGAAACCATTTGTGGCTGCTTTTTCGGACCAAATC
TTTGATGTCCTGGTCGCAATACGCCTCTGCACTCCCTTTTCGCAGGCCGAATTATCCATGGCTCGTGGGGACAGG
TTACTGTCAAGGGGCACGCCAGGTGGTGCTCGAGCAGAAGCGGAGCGAAGGCGAGCAATAGCTCTCAAGGCATTG
GATCAAAGACTCAGTGCCGCAACGGCAAATGCTATCCACAAGATGCCGTCCCCAGTGGCGTCTCCTGCTCAACCG
AGTGGACCGACTATCCAAATACAGCCGTTGCCAAGCACACAAACAGCCATGGTCTCTCAGCCCGGGCACATGCTG
GGCGAAACCACCTTTGAATCTGAACACGATGAAGAGGCAAAAAAGAGCTGA
Transcript >OphauB2|3262
ATGCCTCCGCGACTCAATATTCCTCCAGTCACGCGATCTGTCCTTATAGTCCTCGTCTTCCAGTCGCTCCTTGGC
GCTGCCATTCGCTACCGACAATGGACCAAGCATGCCGAAATCATCATACCATACCTGACATTGGTTCCGCAGCTT
TCTCTCATCTACCCTTGGACCTTTATTACGTCGACGCTGGTTGAGGGCAACATTGTCACCTTGTCAATTGCCGGA
GTCACACTCTTTCATGGTGGCAAGTATCTGGAACGCGCATGGTCTTCGGCCGAGTTGGTCAAATTTTTGGCTCTT
GTCGCGCTGCTGCCGAATCTAATGACGTTTTGCGTCATGATGCTGTTCTTTGCGCTGACGCGGAACGAGAGTTGG
GCCCTTTCCGTCATCTCTGGTACTGTCCCAGTCCAGATTTCTTTTCTAGTCGCCTTTAGCCAGCTCGTGCCCGCG
CATACCGTCACTCTCTTCCGAGGCATCATATCGTTAAGAGTACCTCGTTTTCCGCTCGTTTATATTGGGACTGTG
GCTCTCTTGTCGCTTACTCCATTACTATCCAGGGCCGCGTTTTGGCTGGCTCTGTTTGGCTTCCTCACCAGCTGG
ACCTACCTTCGATTCTACAAGACGGTGTTTCCAGACCTTGATTCATCGCAGCCCGCCTCTCTGCGGGGCGATGCA
AGTGATACTTTTGCGTTTGCCGAGTTCTTTCCCGCGCCCATGAAACCATTTGTGGCTGCTTTTTCGGACCAAATC
TTTGATGTCCTGGTCGCAATACGCCTCTGCACTCCCTTTTCGCAGGCCGAATTATCCATGGCTCGTGGGGACAGG
TTACTGTCAAGGGGCACGCCAGGTGGTGCTCGAGCAGAAGCGGAGCGAAGGCGAGCAATAGCTCTCAAGGCATTG
GATCAAAGACTCAGTGCCGCAACGGCAAATGCTATCCACAAGATGCCGTCCCCAGTGGCGTCTCCTGCTCAACCG
AGTGGACCGACTATCCAAATACAGCCGTTGCCAAGCACACAAACAGCCATGGTCTCTCAGCCCGGGCACATGCTG
GGCGAAACCACCTTTGAATCTGAACACGATGAAGAGGCAAAAAAGAGCTGA
Gene >OphauB2|3262
ATGCCTCCGCGACTCAATATTCCTCCAGTCACGCGATCTGTCCTTATAGTCCTCGTCTTCCAGTCGCTCCTTGGC
GCTGCCATTCGCTACCGACAATGGACCAAGCATGCCGAAATCATCATACCATACCTGACATTGGTTCCGCAGCTT
TCTCTCATCTACCCTTGGACCTTTATTACGTCGACGCTGGTTGAGGGCAACATTGTCACCTTGTCAATTGCCGGA
GTCACACTCTTTCATGGTGGCAAGTATCTGGAACGCGCATGGTCTTCGGCCGAGTTGGTCAAATTTTTGGCTCTT
GTCGCGCTGCTGCCGAATCTAATGACGTTTTGCGTCATGATGCTGTTCTTTGCGCTGACGCGGAACGAGAGTTGG
GCGTACGTCCTTTTTTTTTGGTCATTGGTATAAGCAATTCGAAGCCATCTGCTGACTGTGTGCATTGAGTAGCCT
TTCCGTCATCTCTGGTACTGTCCCAGTCCAGATTTCTTTTCTAGTCGCCTTTAGCCAGCTCGTGCCCGCGCATAC
CGTCACTCTCTTCCGAGGCATCATATCGTTAAGAGTACCTCGTTTTCCGCTCGTTTATATTGGGACTGTGGCTCT
CTTGTCGCTTACTCCATTACTATCCAGGGCCGCGTTTTGGCTGGCTCTGTTTGGCTTCCTCACCAGCTGGACCTA
CCTTCGATTCTACAAGACGGTGTTTCCAGACCTTGATTCATCGCAGCCCGCCTCTCTGCGGGGCGATGCAAGTGA
TACTTTTGCGTTTGCCGAGTTCTTTCCCGCGCCCATGAAACCATTTGTGGCTGCTTTTTCGGACCAAATCTTTGA
TGTCCTGGTCGCAATACGCCTCTGCACTCCCTTTTCGCAGGCCGAATTATCCATGGCTCGTGGGGACAGGTTACT
GTCAAGGGGCACGCCAGGTGGTGCTCGAGCAGAAGCGGAGCGAAGGCGAGCAATAGCTCTCAAGGCATTGGATCA
AAGACTCAGTGCCGCAACGGCAAATGCTATCCACAAGATGCCGTCCCCAGTGGCGTCTCCTGCTCAACCGAGTGG
ACCGACTATCCAAATACAGCCGTTGCCAAGCACACAAACAGCCATGGTCTCTCAGCCCGGGCACATGCTGGGCGA
AACCACCTTTGAATCTGAACACGATGAAGAGGCAAAAAAGAGCTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail