Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|3256
Gene name
LocationContig_21:63586..64513
Strand+
Gene length (bp)927
Transcript length (bp)927
Coding sequence length (bp)927
Protein length (aa) 309

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

(None)

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup1975
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|5611
Ophiocordyceps australis map64 (Brazil) OphauB2|3256 (this protein)
Ophiocordyceps camponoti-floridani Ophcf2|06662
Ophiocordyceps camponoti-rufipedis Ophun1|6034
Ophiocordyceps kimflemingae Ophio5|6204
Ophiocordyceps subramaniannii Hirsu2|217

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|3256
MASLPSKRPRLSLKIKTTGLRPDAASTALASALASAAAPAVDSRLTTPHLASSCPDTPLTATLPCPRRDAASVMT
ATPPLSAETDEPAARANAFAFCSSHLGLEARPDSQAHGPAQSPAAANARCSLPYTHPHSLHSILRNSPLSCRTTA
STASLRRHHHQHQHHHHQHQHHSHHHHQRTSKRVEYDSPLTQEITTNTYTKSHIDLLAEDMSSPNSPLSPQAAPW
PNEMQDAGQTPGPLDTLDRTTASRKRKRLADKHRHWVWTIDPDGSDDDDAHHGPSNRQPPPPSSINQLDPISPSL
PLPSATSP*
Coding >OphauB2|3256
ATGGCATCGCTGCCCTCCAAGAGGCCGCGCCTGTCCCTCAAGATCAAGACGACGGGCCTGCGCCCCGATGCTGCG
TCGACTGCCCTCGCCAGTGCCCTCGCCAGTGCCGCCGCCCCTGCTGTCGACAGCCGCCTCACCACGCCTCACCTG
GCCTCGTCGTGTCCCGACACCCCGCTGACGGCCACGCTGCCTTGTCCTCGCCGCGATGCTGCCAGCGTCATGACG
GCCACGCCCCCGCTGTCCGCCGAGACTGACGAGCCCGCCGCCCGCGCCAATGCCTTTGCCTTTTGCTCCTCGCAC
CTTGGTCTTGAAGCTCGCCCCGATTCTCAAGCCCATGGCCCAGCCCAGTCGCCCGCTGCCGCCAATGCTCGCTGC
TCTCTGCCCTATACCCACCCTCACAGCCTGCACAGCATCCTCCGCAACTCTCCCCTCTCTTGTAGAACAACAGCG
TCGACGGCCTCGTTGCGCCGCCACCACCACCAACATCAACACCACCACCACCAACATCAACACCACTCACACCAC
CACCACCAACGCACCTCTAAACGTGTCGAATACGACAGTCCCCTGACGCAGGAAATCACAACAAACACGTACACA
AAATCCCACATTGACCTCTTGGCCGAGGACATGTCGTCTCCCAACTCGCCCCTCTCGCCCCAAGCCGCCCCATGG
CCCAACGAGATGCAAGACGCCGGCCAAACTCCCGGCCCCTTGGACACCCTTGATCGCACCACGGCCTCGCGCAAG
CGCAAGAGATTAGCAGACAAGCATCGCCATTGGGTCTGGACCATTGACCCGGACGGCAGCGACGACGACGACGCC
CACCACGGCCCTTCCAATCGTCAGCCCCCGCCCCCCTCCTCCATCAATCAGCTCGACCCAATTAGCCCTAGCCTG
CCTCTGCCCAGCGCTACATCTCCCTGA
Transcript >OphauB2|3256
ATGGCATCGCTGCCCTCCAAGAGGCCGCGCCTGTCCCTCAAGATCAAGACGACGGGCCTGCGCCCCGATGCTGCG
TCGACTGCCCTCGCCAGTGCCCTCGCCAGTGCCGCCGCCCCTGCTGTCGACAGCCGCCTCACCACGCCTCACCTG
GCCTCGTCGTGTCCCGACACCCCGCTGACGGCCACGCTGCCTTGTCCTCGCCGCGATGCTGCCAGCGTCATGACG
GCCACGCCCCCGCTGTCCGCCGAGACTGACGAGCCCGCCGCCCGCGCCAATGCCTTTGCCTTTTGCTCCTCGCAC
CTTGGTCTTGAAGCTCGCCCCGATTCTCAAGCCCATGGCCCAGCCCAGTCGCCCGCTGCCGCCAATGCTCGCTGC
TCTCTGCCCTATACCCACCCTCACAGCCTGCACAGCATCCTCCGCAACTCTCCCCTCTCTTGTAGAACAACAGCG
TCGACGGCCTCGTTGCGCCGCCACCACCACCAACATCAACACCACCACCACCAACATCAACACCACTCACACCAC
CACCACCAACGCACCTCTAAACGTGTCGAATACGACAGTCCCCTGACGCAGGAAATCACAACAAACACGTACACA
AAATCCCACATTGACCTCTTGGCCGAGGACATGTCGTCTCCCAACTCGCCCCTCTCGCCCCAAGCCGCCCCATGG
CCCAACGAGATGCAAGACGCCGGCCAAACTCCCGGCCCCTTGGACACCCTTGATCGCACCACGGCCTCGCGCAAG
CGCAAGAGATTAGCAGACAAGCATCGCCATTGGGTCTGGACCATTGACCCGGACGGCAGCGACGACGACGACGCC
CACCACGGCCCTTCCAATCGTCAGCCCCCGCCCCCCTCCTCCATCAATCAGCTCGACCCAATTAGCCCTAGCCTG
CCTCTGCCCAGCGCTACATCTCCCTGA
Gene >OphauB2|3256
ATGGCATCGCTGCCCTCCAAGAGGCCGCGCCTGTCCCTCAAGATCAAGACGACGGGCCTGCGCCCCGATGCTGCG
TCGACTGCCCTCGCCAGTGCCCTCGCCAGTGCCGCCGCCCCTGCTGTCGACAGCCGCCTCACCACGCCTCACCTG
GCCTCGTCGTGTCCCGACACCCCGCTGACGGCCACGCTGCCTTGTCCTCGCCGCGATGCTGCCAGCGTCATGACG
GCCACGCCCCCGCTGTCCGCCGAGACTGACGAGCCCGCCGCCCGCGCCAATGCCTTTGCCTTTTGCTCCTCGCAC
CTTGGTCTTGAAGCTCGCCCCGATTCTCAAGCCCATGGCCCAGCCCAGTCGCCCGCTGCCGCCAATGCTCGCTGC
TCTCTGCCCTATACCCACCCTCACAGCCTGCACAGCATCCTCCGCAACTCTCCCCTCTCTTGTAGAACAACAGCG
TCGACGGCCTCGTTGCGCCGCCACCACCACCAACATCAACACCACCACCACCAACATCAACACCACTCACACCAC
CACCACCAACGCACCTCTAAACGTGTCGAATACGACAGTCCCCTGACGCAGGAAATCACAACAAACACGTACACA
AAATCCCACATTGACCTCTTGGCCGAGGACATGTCGTCTCCCAACTCGCCCCTCTCGCCCCAAGCCGCCCCATGG
CCCAACGAGATGCAAGACGCCGGCCAAACTCCCGGCCCCTTGGACACCCTTGATCGCACCACGGCCTCGCGCAAG
CGCAAGAGATTAGCAGACAAGCATCGCCATTGGGTCTGGACCATTGACCCGGACGGCAGCGACGACGACGACGCC
CACCACGGCCCTTCCAATCGTCAGCCCCCGCCCCCCTCCTCCATCAATCAGCTCGACCCAATTAGCCCTAGCCTG
CCTCTGCCCAGCGCTACATCTCCCTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail