Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|3250
Gene name
LocationContig_21:43054..45789
Strand-
Gene length (bp)2735
Transcript length (bp)2508
Coding sequence length (bp)2508
Protein length (aa) 836

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF12505 DUF3712 Protein of unknown function (DUF3712) 1.3E-06 499 609

Swissprot hits

(None)

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 65 0.5

Transmembrane Domains

Domain # Start End Length
1 56 78 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|3250
MASSEQTPLISDEGHTNQHHNHGDTNSDETAPLLSRQQARPASTKHRGKGRSKWRWASLSAIAVLAVLVITIIVL
GFVLPPAVKEYAEQAVVIEPTSLSLESLTSSGVRARIQANFRLDGSRVADDTTRRLGRFATAIVRTLGTGETKVD
VLLPHYGDSLLGVAVLPPMTLDLVDGHNNQLDFVTEIMPGDAETMRRIVNEWLEGKLDQLKVTGAASLRLQSGIM
PLGTHFVMESLVLEAAGMPTLPEYKITNLVFHDVPIDDQGRMGVGANVSLSLHNDYAVGLDVPSLGLGVFVPNCD
ASEPNIKVAHAVTSIVQVRPKADVNVEASGIIEEIPKSLTRTCPNTELSPLDDLVKHYLHGDRARVFLRGEAPPG
SHLPDWLTTMLESLTVPFELPGGSFNNLLRNFSLTDVDFKLPSPFADPQAPEGKPRVSGTARALAVLPGGVNIRV
GVDSLRATGDLIYHKKKFGELNIEEWQKANSTMSSKGDEALVSIMSRVNNAPIDITDNDVFADILQKLLFGGDDI
LLDVKASVDVKVQTTLGKLVLKDIPAEGKIPVKHIAQDSLSHVNPAVGDLRIVETWRTGIRLHALVNMTNVTPYT
ATIPYVNIHVMKQGFVLGEAIVQDTALKHGVNSDISVGAIWDPTSFGGKEARQVGQRLVSDYLSGKKTTVQLQTH
GKTVPSMPALGKGLSRFNITLAAPRLKLPGSDGGGDGFIRDAVFHLLSSTASFMLASPLKHDTLHIERINATAYY
NHTEPIGQIVDTDQPFDAPPGLSQTPRLHVDWSPSRVGLGKLREAIGGSLKLDARANVTVRLGSWVEEFGFEGGG
IGARVSLLGV*
Coding >OphauB2|3250
ATGGCCAGCTCGGAACAGACGCCCCTTATCAGCGATGAGGGCCACACCAACCAACACCACAACCATGGTGACACA
AATAGCGACGAGACGGCACCTCTTCTCTCCCGTCAACAAGCCCGTCCCGCTTCAACAAAACACCGCGGTAAAGGA
AGGAGCAAGTGGCGCTGGGCGTCCTTGAGTGCCATTGCAGTTTTGGCTGTCCTTGTCATCACCATCATCGTCCTC
GGCTTTGTCCTTCCGCCAGCCGTCAAGGAATATGCCGAGCAAGCCGTCGTCATTGAGCCAACCAGTCTGTCTCTC
GAGTCCCTGACTTCGTCTGGCGTCCGTGCCCGTATACAGGCAAACTTTCGCCTGGATGGATCCCGCGTGGCCGAT
GACACAACAAGACGGCTGGGCCGCTTCGCCACTGCTATCGTTAGAACGCTAGGCACTGGTGAGACCAAGGTGGAC
GTGCTACTACCCCATTATGGTGACTCTTTGCTTGGCGTGGCGGTTTTGCCTCCCATGACGCTGGACTTGGTAGAC
GGACACAACAACCAGCTCGACTTTGTCACGGAAATCATGCCAGGAGACGCCGAGACGATGCGCAGGATTGTCAAT
GAGTGGCTGGAAGGCAAGCTCGACCAGCTCAAGGTAACAGGAGCTGCATCACTAAGACTACAATCCGGAATCATG
CCTCTGGGCACACATTTCGTGATGGAATCCTTGGTCTTAGAAGCCGCCGGGATGCCAACGCTTCCTGAATACAAG
ATAACAAATCTCGTCTTCCATGATGTGCCTATTGATGACCAAGGACGCATGGGGGTTGGCGCCAACGTGTCGCTT
AGCCTGCACAATGACTATGCCGTAGGTCTCGACGTTCCGTCCCTTGGCCTTGGCGTCTTTGTGCCCAATTGCGAT
GCCTCGGAACCCAACATCAAGGTTGCGCATGCTGTTACGAGTATCGTCCAAGTCCGTCCAAAGGCCGACGTCAAT
GTCGAGGCCTCGGGCATTATTGAGGAGATTCCCAAGTCGCTAACGCGCACGTGCCCCAATACTGAGCTTTCGCCG
CTCGATGATTTGGTCAAGCACTATTTGCACGGCGATAGGGCGCGAGTCTTTCTTCGCGGAGAAGCGCCTCCGGGC
TCGCACCTGCCTGACTGGCTGACGACGATGCTCGAGAGCTTGACAGTGCCCTTTGAACTTCCTGGTGGCTCTTTT
AACAATTTGCTTCGCAACTTTTCTCTCACCGACGTTGACTTCAAGTTGCCCAGCCCCTTTGCTGATCCACAAGCG
CCTGAAGGCAAACCGCGTGTATCGGGGACCGCTCGGGCCCTGGCGGTGCTTCCAGGCGGCGTAAACATTCGTGTT
GGGGTGGACAGCCTGAGGGCGACGGGAGACCTCATTTACCACAAGAAAAAGTTTGGCGAGCTTAATATTGAAGAG
TGGCAAAAGGCAAATTCAACCATGAGCTCAAAGGGCGACGAGGCGCTTGTTTCAATCATGTCGCGCGTGAATAAT
GCGCCAATCGACATTACCGACAACGACGTGTTTGCCGATATTCTGCAGAAGCTCTTGTTTGGCGGTGATGACATT
CTTCTTGATGTCAAGGCGTCGGTTGATGTCAAGGTGCAGACAACGCTGGGCAAGCTGGTCTTGAAGGATATCCCG
GCCGAGGGCAAGATTCCAGTAAAACATATCGCTCAGGACTCGTTGTCACATGTGAACCCCGCGGTGGGGGATTTA
CGCATCGTCGAGACGTGGCGGACTGGTATCCGTTTGCACGCCTTGGTGAACATGACCAATGTGACTCCATACACC
GCCACGATTCCCTATGTCAATATTCACGTCATGAAGCAGGGCTTTGTGCTGGGTGAAGCCATTGTACAAGACACG
GCGTTGAAGCATGGAGTCAATTCGGATATTTCTGTTGGCGCGATTTGGGATCCGACGTCGTTTGGCGGAAAGGAA
GCTCGGCAGGTTGGCCAGCGGCTGGTATCTGACTACCTGTCTGGCAAGAAGACGACGGTGCAGCTGCAAACGCAC
GGCAAGACGGTGCCCTCGATGCCGGCTCTGGGCAAAGGCCTGTCGAGATTCAACATTACGCTGGCGGCTCCTCGC
CTCAAGCTCCCTGGGTCCGACGGCGGCGGCGACGGCTTTATTCGTGACGCAGTCTTTCACCTCTTATCGTCGACT
GCCAGTTTCATGCTTGCCTCGCCTCTAAAGCACGACACACTTCATATTGAGCGCATCAATGCCACAGCCTACTAC
AACCACACGGAGCCCATTGGGCAGATTGTCGACACTGATCAGCCCTTTGACGCACCACCAGGTCTGTCGCAGACG
CCTCGCCTGCATGTAGACTGGTCTCCCAGCCGGGTGGGCCTTGGGAAGCTGCGGGAAGCCATTGGCGGCTCGCTC
AAGCTCGATGCCCGCGCAAACGTGACTGTGCGCCTGGGCAGCTGGGTTGAAGAGTTTGGGTTTGAGGGAGGAGGC
ATTGGGGCCAGAGTATCGCTGCTCGGAGTTTAG
Transcript >OphauB2|3250
ATGGCCAGCTCGGAACAGACGCCCCTTATCAGCGATGAGGGCCACACCAACCAACACCACAACCATGGTGACACA
AATAGCGACGAGACGGCACCTCTTCTCTCCCGTCAACAAGCCCGTCCCGCTTCAACAAAACACCGCGGTAAAGGA
AGGAGCAAGTGGCGCTGGGCGTCCTTGAGTGCCATTGCAGTTTTGGCTGTCCTTGTCATCACCATCATCGTCCTC
GGCTTTGTCCTTCCGCCAGCCGTCAAGGAATATGCCGAGCAAGCCGTCGTCATTGAGCCAACCAGTCTGTCTCTC
GAGTCCCTGACTTCGTCTGGCGTCCGTGCCCGTATACAGGCAAACTTTCGCCTGGATGGATCCCGCGTGGCCGAT
GACACAACAAGACGGCTGGGCCGCTTCGCCACTGCTATCGTTAGAACGCTAGGCACTGGTGAGACCAAGGTGGAC
GTGCTACTACCCCATTATGGTGACTCTTTGCTTGGCGTGGCGGTTTTGCCTCCCATGACGCTGGACTTGGTAGAC
GGACACAACAACCAGCTCGACTTTGTCACGGAAATCATGCCAGGAGACGCCGAGACGATGCGCAGGATTGTCAAT
GAGTGGCTGGAAGGCAAGCTCGACCAGCTCAAGGTAACAGGAGCTGCATCACTAAGACTACAATCCGGAATCATG
CCTCTGGGCACACATTTCGTGATGGAATCCTTGGTCTTAGAAGCCGCCGGGATGCCAACGCTTCCTGAATACAAG
ATAACAAATCTCGTCTTCCATGATGTGCCTATTGATGACCAAGGACGCATGGGGGTTGGCGCCAACGTGTCGCTT
AGCCTGCACAATGACTATGCCGTAGGTCTCGACGTTCCGTCCCTTGGCCTTGGCGTCTTTGTGCCCAATTGCGAT
GCCTCGGAACCCAACATCAAGGTTGCGCATGCTGTTACGAGTATCGTCCAAGTCCGTCCAAAGGCCGACGTCAAT
GTCGAGGCCTCGGGCATTATTGAGGAGATTCCCAAGTCGCTAACGCGCACGTGCCCCAATACTGAGCTTTCGCCG
CTCGATGATTTGGTCAAGCACTATTTGCACGGCGATAGGGCGCGAGTCTTTCTTCGCGGAGAAGCGCCTCCGGGC
TCGCACCTGCCTGACTGGCTGACGACGATGCTCGAGAGCTTGACAGTGCCCTTTGAACTTCCTGGTGGCTCTTTT
AACAATTTGCTTCGCAACTTTTCTCTCACCGACGTTGACTTCAAGTTGCCCAGCCCCTTTGCTGATCCACAAGCG
CCTGAAGGCAAACCGCGTGTATCGGGGACCGCTCGGGCCCTGGCGGTGCTTCCAGGCGGCGTAAACATTCGTGTT
GGGGTGGACAGCCTGAGGGCGACGGGAGACCTCATTTACCACAAGAAAAAGTTTGGCGAGCTTAATATTGAAGAG
TGGCAAAAGGCAAATTCAACCATGAGCTCAAAGGGCGACGAGGCGCTTGTTTCAATCATGTCGCGCGTGAATAAT
GCGCCAATCGACATTACCGACAACGACGTGTTTGCCGATATTCTGCAGAAGCTCTTGTTTGGCGGTGATGACATT
CTTCTTGATGTCAAGGCGTCGGTTGATGTCAAGGTGCAGACAACGCTGGGCAAGCTGGTCTTGAAGGATATCCCG
GCCGAGGGCAAGATTCCAGTAAAACATATCGCTCAGGACTCGTTGTCACATGTGAACCCCGCGGTGGGGGATTTA
CGCATCGTCGAGACGTGGCGGACTGGTATCCGTTTGCACGCCTTGGTGAACATGACCAATGTGACTCCATACACC
GCCACGATTCCCTATGTCAATATTCACGTCATGAAGCAGGGCTTTGTGCTGGGTGAAGCCATTGTACAAGACACG
GCGTTGAAGCATGGAGTCAATTCGGATATTTCTGTTGGCGCGATTTGGGATCCGACGTCGTTTGGCGGAAAGGAA
GCTCGGCAGGTTGGCCAGCGGCTGGTATCTGACTACCTGTCTGGCAAGAAGACGACGGTGCAGCTGCAAACGCAC
GGCAAGACGGTGCCCTCGATGCCGGCTCTGGGCAAAGGCCTGTCGAGATTCAACATTACGCTGGCGGCTCCTCGC
CTCAAGCTCCCTGGGTCCGACGGCGGCGGCGACGGCTTTATTCGTGACGCAGTCTTTCACCTCTTATCGTCGACT
GCCAGTTTCATGCTTGCCTCGCCTCTAAAGCACGACACACTTCATATTGAGCGCATCAATGCCACAGCCTACTAC
AACCACACGGAGCCCATTGGGCAGATTGTCGACACTGATCAGCCCTTTGACGCACCACCAGGTCTGTCGCAGACG
CCTCGCCTGCATGTAGACTGGTCTCCCAGCCGGGTGGGCCTTGGGAAGCTGCGGGAAGCCATTGGCGGCTCGCTC
AAGCTCGATGCCCGCGCAAACGTGACTGTGCGCCTGGGCAGCTGGGTTGAAGAGTTTGGGTTTGAGGGAGGAGGC
ATTGGGGCCAGAGTATCGCTGCTCGGAGTTTAG
Gene >OphauB2|3250
ATGGCCAGCTCGGAACAGACGCCCCTTATCAGCGATGAGGGCCACACCAACCAACACCACAACCATGGTGACACA
AATAGCGACGAGACGGCACCTCTTCTCTCCCGTCAACAAGCCCGTCCCGCTTCAACAAAACACCGCGGTAAAGGA
AGGAGCAAGTGGCGCTGGGCGTCCTTGAGTGCCATTGCAGTTTTGGCTGTCCTTGTCATCACCATCATCGTCCTC
GGCTTTGTCCTTCCGCCAGCCGTCAAGGAATATGCCGAGCAAGCCGTCGTCATTGAGCCAACCAGTCTGTCTCTC
GAGTCCCTGACTTCGTCTGGCGTCCGTGCCCGTATACAGGCAAACTTTCGCCTGGATGGATCCCGCGTGGCCGAT
GACACAACAAGACGGCTGGGCCGCTTCGCCACTGCTATCGTTAGAACGCTAGGCACTGGTGAGACCAAGGTGGAC
GTGCTACTACCCCATTATGGTGACTCTTTGCTTGGCGTGGCGGTTTTGCCTCCCATGACGCTGGACTTGGTAGAC
GGACACAACAACCAGCTCGACTTTGTCACGGAAATCATGCCAGGAGACGCCGAGACGATGCGCAGGATTGTCAAT
GAGTGGCTGGAAGGCAAGCTCGACCAGCTCAAGGTAACAGGAGCTGCATCACTAAGACTACAATCCGGAATCATG
CCTCTGGGCACACATTTCGTGATGGAATCCTTGGTCTTAGAAGGTCAATCTCTCTACCGCGCCTTTGCCACTTTG
TATTTTGGACAGAAGACGATCAAATAGGACCTGGATCTGGGCTAACGCGCTTGCAGCCGCCGGGATGCCAACGCT
TCCTGAATACAAGATAACAAATCTCGTCTTCCATGATGTGCCTATTGATGACCAAGGACGCATGGGGGTTGGCGC
CAACGTGTCGCTTAGCCTGCACAATGACTATGCCGTAGGTCTCGACGTTCCGTCCCTTGGCCTTGGCGTCTTTGT
GCCCAATTGCGATGCCTCGGAACCCAACATCAAGGTTGCGCATGCTGTTACGAGTATCGTCCAAGTCCGTCCAAA
GGCCGACGTCAATGTCGAGGCCTCGGGCATTATTGAGGAGATTCCCAAGTCGCTAACGCGCACGTGCCCCAATAC
TGAGCTTTCGCCGCTCGATGATTTGGTCAAGCACTATTTGCACGGCGATAGGGCGCGAGTCTTTCTTCGCGGAGA
AGCGCCTCCGGGCTCGCACCTGCCTGACTGGCTGACGACGATGCTCGAGAGCTTGACAGTGCCCTTTGAACTTCC
TGGTGGCTCTTTTAACAATTTGCTTCGCAACTTTTCTCTCACCGACGTTGACTTCAAGTTGCCCAGCCCCTTTGC
TGATCCACAAGCGCCTGAAGGCAAACCGCGTGTATCGGGGACCGCTCGGGCCCTGGCGGTGCTTCCAGGCGGCGT
AAACATTCGTGTTGGGGTGGACAGCCTGAGGGCGACGGGAGACCTCATTTACCACAAGAAAAAGTTTGGCGAGCT
TAATATTGAAGAGTGGCAAAAGGCAAATTCAACCATGAGCTCAAAGGGCGACGAGGCGCTTGTTTCAATCATGTC
GCGCGTGAATAATGCGCCAATCGACATTACCGACAACGACGTGTTTGCCGATATTCTGCAGAAGCTCTTGTTTGG
CGGTGATGACATTCTTCTTGATGTCAAGGCGTCGGTTGATGTCAAGGTGCAGACAACGCTGGGCAAGCTGGTCTT
GAAGGATATCCCGGCCGAGGGCAAGATTCCAGTAAAACGTCCGTCTTCGATTTAATTGTCTGTACGTCCCTAACA
CAAAAGGGCATGCCTTGGGGCGCCCTCTTGGTCTTGGCTGGCTGCTATGCCACTTGAGCGCTCTGTTGATGCGAG
ACACGATTGAGGCTAAGACGGCTACAGATATCGCTCAGGACTCGTTGTCACATGTGAACCCCGCGGTGGGGGATT
TACGCATCGTCGAGACGTGGCGGACTGGTATCCGTTTGCACGCCTTGGTGAACATGACCAATGTGACTCCATACA
CCGCCACGATTCCCTATGTCAATATTCACGTCATGAAGCAGGGCTTTGTGCTGGGTGAAGCCATTGTACAAGACA
CGGCGTTGAAGCATGGAGTCAATTCGGATATTTCTGTTGGCGCGATTTGGGATCCGACGTCGTTTGGCGGAAAGG
AAGCTCGGCAGGTTGGCCAGCGGCTGGTATCTGACTACCTGTCTGGCAAGAAGACGACGGTGCAGCTGCAAACGC
ACGGCAAGACGGTGCCCTCGATGCCGGCTCTGGGCAAAGGCCTGTCGAGATTCAACATTACGCTGGCGGCTCCTC
GCCTCAAGCTCCCTGGGTCCGACGGCGGCGGCGACGGCTTTATTCGTGACGCAGTCTTTCACCTCTTATCGTCGA
CTGCCAGTTTCATGCTTGCCTCGCCTCTAAAGCACGACACACTTCATATTGAGCGCATCAATGCCACAGCCTACT
ACAACCACACGGAGCCCATTGGGCAGATTGTCGACACTGATCAGCCCTTTGACGCACCACCAGGTCTGTCGCAGA
CGCCTCGCCTGCATGTAGACTGGTCTCCCAGCCGGGTGGGCCTTGGGAAGCTGCGGGAAGCCATTGGCGGCTCGC
TCAAGCTCGATGCCCGCGCAAACGTGACTGTGCGCCTGGGCAGCTGGGTTGAAGAGTTTGGGTTTGAGGGAGGAG
GCATTGGGGCCAGAGTATCGCTGCTCGGAGTTTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail