Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|324
Gene name
LocationContig_102:15735..16950
Strand-
Gene length (bp)1215
Transcript length (bp)1155
Coding sequence length (bp)1155
Protein length (aa) 385

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

(None)

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

SignalP signal predicted Location Score
Yes 1 - 16 0.999178

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup98
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|3581
Ophiocordyceps australis map64 (Brazil) OphauB2|324 (this protein)
Ophiocordyceps camponoti-floridani Ophcf2|01007
Ophiocordyceps camponoti-rufipedis Ophun1|7143
Ophiocordyceps kimflemingae Ophio5|7930
Ophiocordyceps subramaniannii Hirsu2|156
Ophiocordyceps subramaniannii Hirsu2|2137
Ophiocordyceps subramaniannii Hirsu2|3139
Ophiocordyceps subramaniannii Hirsu2|3419
Ophiocordyceps subramaniannii Hirsu2|5164
Ophiocordyceps subramaniannii Hirsu2|7455
Ophiocordyceps subramaniannii Hirsu2|9490

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|324
MLTPLVLSLLSASASAQAVTKCSPPGKAPIGQPPVGQAGPGEAPDAKAACQPRPGNVTLDKFQLYPENAGVDTER
CLVYFSALYNSSVAVWNPLENKFLDSITIQNITGKASQHASGVRRDAAHDTLSIMLNAGAAFDTSGSDISGENYL
VSYDLKSKSVKYVKDLTTFTDGQFGGFQDFEHGDDGSTYVIGTYPGSLYKVSPDGNDVKALWQTKNENGNFLNIT
GVGKVDDNTLIVPGKSDVSGIYRFDVKSESCEPVKVPLTATNGNATLGADLDGALLPASYNREIFLISDNTDGTY
VIRSNDQWKSAEVLGVIPNPFLADGGSSVATVEVGSTIYAVTEFFGDAANPPVPGTLAGNRTEFPLNDITEEVAK
LTGKSAAQV*
Coding >OphauB2|324
ATGTTGACTCCTCTTGTCCTCTCTCTTCTTTCGGCCTCGGCCTCGGCCCAGGCCGTTACCAAGTGCAGTCCTCCG
GGCAAGGCACCCATTGGACAACCTCCTGTCGGACAAGCCGGCCCTGGAGAGGCGCCTGATGCAAAGGCTGCCTGC
CAGCCTCGTCCCGGAAACGTCACCCTCGACAAGTTCCAGCTCTACCCCGAAAATGCAGGCGTTGACACTGAGAGG
TGCTTGGTATACTTTAGCGCCCTGTATAACAGCTCGGTAGCGGTTTGGAACCCCCTGGAGAATAAATTCCTCGAT
AGCATCACAATCCAGAACATCACCGGGAAAGCTTCTCAACACGCCAGCGGTGTTCGTCGTGATGCCGCTCACGAC
ACCCTTTCCATCATGCTTAACGCCGGTGCCGCTTTCGATACCAGCGGATCCGACATTTCGGGCGAGAACTATCTC
GTTAGCTATGACCTTAAATCTAAATCGGTCAAATACGTCAAGGACCTTACAACATTTACCGACGGCCAATTTGGC
GGCTTTCAAGACTTCGAGCACGGCGATGACGGCAGCACCTATGTAATTGGAACATATCCCGGAAGCCTGTACAAG
GTCAGCCCCGATGGCAATGATGTTAAAGCTCTGTGGCAAACCAAGAATGAGAACGGCAACTTCCTCAACATCACG
GGAGTGGGCAAGGTTGACGACAACACCTTGATTGTCCCCGGCAAGAGTGATGTGAGCGGCATTTATCGCTTTGAC
GTCAAGTCTGAGTCATGCGAGCCCGTCAAGGTTCCCCTCACTGCTACCAATGGCAATGCCACATTGGGCGCAGAC
CTGGACGGCGCTCTGTTGCCAGCCTCTTACAACCGCGAGATCTTCCTCATTTCTGACAATACGGATGGAACCTAT
GTAATTCGCTCGAACGACCAGTGGAAGTCTGCTGAGGTGCTGGGAGTCATTCCCAACCCCTTCCTCGCTGATGGC
GGTTCTTCAGTTGCCACAGTCGAAGTCGGCTCGACCATTTATGCTGTCACTGAGTTCTTTGGCGATGCTGCCAAC
CCTCCAGTCCCTGGGACTCTTGCTGGCAACAGGACTGAGTTTCCTCTCAACGACATCACAGAAGAGGTAGCCAAG
CTTACTGGCAAGTCCGCTGCCCAAGTTTAA
Transcript >OphauB2|324
ATGTTGACTCCTCTTGTCCTCTCTCTTCTTTCGGCCTCGGCCTCGGCCCAGGCCGTTACCAAGTGCAGTCCTCCG
GGCAAGGCACCCATTGGACAACCTCCTGTCGGACAAGCCGGCCCTGGAGAGGCGCCTGATGCAAAGGCTGCCTGC
CAGCCTCGTCCCGGAAACGTCACCCTCGACAAGTTCCAGCTCTACCCCGAAAATGCAGGCGTTGACACTGAGAGG
TGCTTGGTATACTTTAGCGCCCTGTATAACAGCTCGGTAGCGGTTTGGAACCCCCTGGAGAATAAATTCCTCGAT
AGCATCACAATCCAGAACATCACCGGGAAAGCTTCTCAACACGCCAGCGGTGTTCGTCGTGATGCCGCTCACGAC
ACCCTTTCCATCATGCTTAACGCCGGTGCCGCTTTCGATACCAGCGGATCCGACATTTCGGGCGAGAACTATCTC
GTTAGCTATGACCTTAAATCTAAATCGGTCAAATACGTCAAGGACCTTACAACATTTACCGACGGCCAATTTGGC
GGCTTTCAAGACTTCGAGCACGGCGATGACGGCAGCACCTATGTAATTGGAACATATCCCGGAAGCCTGTACAAG
GTCAGCCCCGATGGCAATGATGTTAAAGCTCTGTGGCAAACCAAGAATGAGAACGGCAACTTCCTCAACATCACG
GGAGTGGGCAAGGTTGACGACAACACCTTGATTGTCCCCGGCAAGAGTGATGTGAGCGGCATTTATCGCTTTGAC
GTCAAGTCTGAGTCATGCGAGCCCGTCAAGGTTCCCCTCACTGCTACCAATGGCAATGCCACATTGGGCGCAGAC
CTGGACGGCGCTCTGTTGCCAGCCTCTTACAACCGCGAGATCTTCCTCATTTCTGACAATACGGATGGAACCTAT
GTAATTCGCTCGAACGACCAGTGGAAGTCTGCTGAGGTGCTGGGAGTCATTCCCAACCCCTTCCTCGCTGATGGC
GGTTCTTCAGTTGCCACAGTCGAAGTCGGCTCGACCATTTATGCTGTCACTGAGTTCTTTGGCGATGCTGCCAAC
CCTCCAGTCCCTGGGACTCTTGCTGGCAACAGGACTGAGTTTCCTCTCAACGACATCACAGAAGAGGTAGCCAAG
CTTACTGGCAAGTCCGCTGCCCAAGTTTAA
Gene >OphauB2|324
ATGTTGACTCCTCTTGTCCTCTCTCTTCTTTCGGCCTCGGCCTCGGCCCAGGCCGTTACCAAGTGCAGTCCTCCG
GGCAAGGCACCCATTGGACAACCTCCTGTCGGACAAGCCGGCCCTGGAGAGGCGCCTGATGCAAAGGCTGCCTGC
CAGCCTCGTCCCGGAAACGTCACCCTCGACAAGTTCCAGCTCTACCCCGAAAATGCAGGCGTTGACACTGAGAGG
TGCTTGGTATACTTTAGGTATGAATCCTGTCTTAATTAGTATTGACTAGTTCCGAAATCTAACACGCACAACAAC
AGCGCCCTGTATAACAGCTCGGTAGCGGTTTGGAACCCCCTGGAGAATAAATTCCTCGATAGCATCACAATCCAG
AACATCACCGGGAAAGCTTCTCAACACGCCAGCGGTGTTCGTCGTGATGCCGCTCACGACACCCTTTCCATCATG
CTTAACGCCGGTGCCGCTTTCGATACCAGCGGATCCGACATTTCGGGCGAGAACTATCTCGTTAGCTATGACCTT
AAATCTAAATCGGTCAAATACGTCAAGGACCTTACAACATTTACCGACGGCCAATTTGGCGGCTTTCAAGACTTC
GAGCACGGCGATGACGGCAGCACCTATGTAATTGGAACATATCCCGGAAGCCTGTACAAGGTCAGCCCCGATGGC
AATGATGTTAAAGCTCTGTGGCAAACCAAGAATGAGAACGGCAACTTCCTCAACATCACGGGAGTGGGCAAGGTT
GACGACAACACCTTGATTGTCCCCGGCAAGAGTGATGTGAGCGGCATTTATCGCTTTGACGTCAAGTCTGAGTCA
TGCGAGCCCGTCAAGGTTCCCCTCACTGCTACCAATGGCAATGCCACATTGGGCGCAGACCTGGACGGCGCTCTG
TTGCCAGCCTCTTACAACCGCGAGATCTTCCTCATTTCTGACAATACGGATGGAACCTATGTAATTCGCTCGAAC
GACCAGTGGAAGTCTGCTGAGGTGCTGGGAGTCATTCCCAACCCCTTCCTCGCTGATGGCGGTTCTTCAGTTGCC
ACAGTCGAAGTCGGCTCGACCATTTATGCTGTCACTGAGTTCTTTGGCGATGCTGCCAACCCTCCAGTCCCTGGG
ACTCTTGCTGGCAACAGGACTGAGTTTCCTCTCAACGACATCACAGAAGAGGTAGCCAAGCTTACTGGCAAGTCC
GCTGCCCAAGTTTAA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail