Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|3234
Gene name
LocationContig_209:24117..25182
Strand+
Gene length (bp)1065
Transcript length (bp)1065
Coding sequence length (bp)1065
Protein length (aa) 355

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00892 EamA EamA-like transporter family 8.8E-09 14 122
PF00892 EamA EamA-like transporter family 3.4E-08 167 306

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q04835|YM87_YEAST Uncharacterized membrane protein YMR253C OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YMR253C PE=1 SV=1 1 306 5.0E-56
sp|Q08980|YP264_YEAST Probable transport protein YPL264C OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YPL264C PE=1 SV=1 8 306 7.0E-56
sp|Q2M3R5|S35G1_HUMAN Solute carrier family 35 member G1 OS=Homo sapiens GN=SLC35G1 PE=1 SV=1 15 202 4.0E-10
sp|Q8BY79|S35G1_MOUSE Solute carrier family 35 member G1 OS=Mus musculus GN=Slc35g1 PE=2 SV=1 14 202 8.0E-09

GO

GO Term Description Terminal node
GO:0016020 membrane Yes
GO:0016021 integral component of membrane Yes
GO:0110165 cellular anatomical entity No
GO:0031224 intrinsic component of membrane No
GO:0005575 cellular_component No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 33 0.5

Transmembrane Domains

Domain # Start End Length
1 54 76 22
2 81 100 19
3 113 132 19
4 164 186 22
5 193 215 22
6 235 257 22
7 281 303 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|3234
MNLSARILELEGGGMHPVQVLLLRQLLTSSCCFGYMWWNKVPGFPFGGSDVRWLLVTRGFTGFMGILGMWYSMMY
LPLADATVITFLAPGVAGLGCYLLLREPFTRAEQVATLVALLGVILIAQPTAFFAGPESSLDDTSSSSQQHSGSL
PDANHQTTSKERLMAVGVAMLGVIGAAGAFTALRAIGKRANPVVSVNLFAVICTVVCGGALIVAPALDIDQPALC
WVTPSSVKQWLLILALAALGFIMQYLLTAGLGADKSNRANAMVYTQMLFAVAFDRWVFGHSMGLMSLLGCSLILG
SAISVVLAKRPVTVQPLKADDCERQGSLGGDAEGAPMLVAAGGNATSVDRDGNR*
Coding >OphauB2|3234
ATGAATCTGAGTGCTCGCATACTCGAACTCGAAGGTGGAGGCATGCATCCTGTCCAGGTGTTGCTTCTCAGACAA
CTCCTGACGTCGAGCTGCTGTTTCGGGTATATGTGGTGGAACAAGGTACCTGGGTTCCCTTTTGGCGGCAGTGAT
GTGCGCTGGCTTCTAGTGACGCGAGGCTTTACCGGCTTCATGGGAATTTTGGGCATGTGGTATTCCATGATGTAT
CTCCCACTAGCTGATGCCACTGTCATTACCTTTTTGGCGCCTGGAGTTGCGGGTCTGGGCTGCTACCTCTTACTT
CGCGAGCCATTCACGCGGGCCGAGCAAGTAGCAACCCTTGTGGCACTACTTGGTGTCATTCTCATTGCACAGCCC
ACGGCCTTCTTTGCCGGCCCAGAATCGTCACTGGACGACACTAGCAGCAGCAGTCAGCAGCACAGTGGCAGCCTT
CCCGATGCCAATCATCAAACCACGTCCAAGGAAAGGCTCATGGCTGTCGGTGTTGCCATGCTTGGAGTCATTGGA
GCGGCTGGAGCCTTTACCGCATTGCGAGCCATTGGCAAGCGCGCAAACCCTGTCGTCTCGGTCAACCTCTTTGCT
GTGATCTGCACTGTTGTATGTGGCGGTGCTCTAATTGTCGCTCCGGCTCTCGACATTGACCAACCGGCACTGTGC
TGGGTGACGCCTTCATCAGTCAAGCAATGGCTGCTCATCTTGGCTCTTGCAGCGCTGGGTTTCATCATGCAGTAT
CTCTTGACTGCTGGCCTGGGAGCGGACAAGTCGAATCGGGCCAATGCCATGGTTTATACGCAAATGCTCTTCGCA
GTCGCCTTTGACCGCTGGGTGTTTGGTCACTCCATGGGGCTCATGAGTCTGCTGGGCTGCTCCTTGATATTAGGA
AGTGCTATCAGTGTGGTCCTTGCCAAGAGACCCGTCACGGTCCAGCCACTCAAGGCAGACGATTGCGAGAGACAA
GGCTCATTGGGCGGAGATGCAGAAGGGGCTCCGATGCTCGTTGCGGCTGGAGGCAATGCCACGAGTGTCGACCGA
GATGGCAACCGGTGA
Transcript >OphauB2|3234
ATGAATCTGAGTGCTCGCATACTCGAACTCGAAGGTGGAGGCATGCATCCTGTCCAGGTGTTGCTTCTCAGACAA
CTCCTGACGTCGAGCTGCTGTTTCGGGTATATGTGGTGGAACAAGGTACCTGGGTTCCCTTTTGGCGGCAGTGAT
GTGCGCTGGCTTCTAGTGACGCGAGGCTTTACCGGCTTCATGGGAATTTTGGGCATGTGGTATTCCATGATGTAT
CTCCCACTAGCTGATGCCACTGTCATTACCTTTTTGGCGCCTGGAGTTGCGGGTCTGGGCTGCTACCTCTTACTT
CGCGAGCCATTCACGCGGGCCGAGCAAGTAGCAACCCTTGTGGCACTACTTGGTGTCATTCTCATTGCACAGCCC
ACGGCCTTCTTTGCCGGCCCAGAATCGTCACTGGACGACACTAGCAGCAGCAGTCAGCAGCACAGTGGCAGCCTT
CCCGATGCCAATCATCAAACCACGTCCAAGGAAAGGCTCATGGCTGTCGGTGTTGCCATGCTTGGAGTCATTGGA
GCGGCTGGAGCCTTTACCGCATTGCGAGCCATTGGCAAGCGCGCAAACCCTGTCGTCTCGGTCAACCTCTTTGCT
GTGATCTGCACTGTTGTATGTGGCGGTGCTCTAATTGTCGCTCCGGCTCTCGACATTGACCAACCGGCACTGTGC
TGGGTGACGCCTTCATCAGTCAAGCAATGGCTGCTCATCTTGGCTCTTGCAGCGCTGGGTTTCATCATGCAGTAT
CTCTTGACTGCTGGCCTGGGAGCGGACAAGTCGAATCGGGCCAATGCCATGGTTTATACGCAAATGCTCTTCGCA
GTCGCCTTTGACCGCTGGGTGTTTGGTCACTCCATGGGGCTCATGAGTCTGCTGGGCTGCTCCTTGATATTAGGA
AGTGCTATCAGTGTGGTCCTTGCCAAGAGACCCGTCACGGTCCAGCCACTCAAGGCAGACGATTGCGAGAGACAA
GGCTCATTGGGCGGAGATGCAGAAGGGGCTCCGATGCTCGTTGCGGCTGGAGGCAATGCCACGAGTGTCGACCGA
GATGGCAACCGGTGA
Gene >OphauB2|3234
ATGAATCTGAGTGCTCGCATACTCGAACTCGAAGGTGGAGGCATGCATCCTGTCCAGGTGTTGCTTCTCAGACAA
CTCCTGACGTCGAGCTGCTGTTTCGGGTATATGTGGTGGAACAAGGTACCTGGGTTCCCTTTTGGCGGCAGTGAT
GTGCGCTGGCTTCTAGTGACGCGAGGCTTTACCGGCTTCATGGGAATTTTGGGCATGTGGTATTCCATGATGTAT
CTCCCACTAGCTGATGCCACTGTCATTACCTTTTTGGCGCCTGGAGTTGCGGGTCTGGGCTGCTACCTCTTACTT
CGCGAGCCATTCACGCGGGCCGAGCAAGTAGCAACCCTTGTGGCACTACTTGGTGTCATTCTCATTGCACAGCCC
ACGGCCTTCTTTGCCGGCCCAGAATCGTCACTGGACGACACTAGCAGCAGCAGTCAGCAGCACAGTGGCAGCCTT
CCCGATGCCAATCATCAAACCACGTCCAAGGAAAGGCTCATGGCTGTCGGTGTTGCCATGCTTGGAGTCATTGGA
GCGGCTGGAGCCTTTACCGCATTGCGAGCCATTGGCAAGCGCGCAAACCCTGTCGTCTCGGTCAACCTCTTTGCT
GTGATCTGCACTGTTGTATGTGGCGGTGCTCTAATTGTCGCTCCGGCTCTCGACATTGACCAACCGGCACTGTGC
TGGGTGACGCCTTCATCAGTCAAGCAATGGCTGCTCATCTTGGCTCTTGCAGCGCTGGGTTTCATCATGCAGTAT
CTCTTGACTGCTGGCCTGGGAGCGGACAAGTCGAATCGGGCCAATGCCATGGTTTATACGCAAATGCTCTTCGCA
GTCGCCTTTGACCGCTGGGTGTTTGGTCACTCCATGGGGCTCATGAGTCTGCTGGGCTGCTCCTTGATATTAGGA
AGTGCTATCAGTGTGGTCCTTGCCAAGAGACCCGTCACGGTCCAGCCACTCAAGGCAGACGATTGCGAGAGACAA
GGCTCATTGGGCGGAGATGCAGAAGGGGCTCCGATGCTCGTTGCGGCTGGAGGCAATGCCACGAGTGTCGACCGA
GATGGCAACCGGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail