Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|3205
Gene name
LocationContig_207:424..2404
Strand+
Gene length (bp)1980
Transcript length (bp)1980
Coding sequence length (bp)1980
Protein length (aa) 660

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01490 Aa_trans Transmembrane amino acid transporter protein 1.6E-79 267 653

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q10074|AVT3_SCHPO Vacuolar amino acid transporter 3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=avt3 PE=1 SV=1 10 654 6.0E-125
sp|P36062|AVT3_YEAST Vacuolar amino acid transporter 3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=AVT3 PE=1 SV=1 125 656 2.0E-123
sp|P50944|AVT4_YEAST Vacuolar amino acid transporter 4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=AVT4 PE=1 SV=1 86 654 4.0E-99
sp|Q4KL91|S36A4_XENLA Proton-coupled amino acid transporter 4 OS=Xenopus laevis GN=slc36a4 PE=2 SV=1 221 657 7.0E-39
sp|Q7Z2H8|S36A1_HUMAN Proton-coupled amino acid transporter 1 OS=Homo sapiens GN=SLC36A1 PE=1 SV=1 234 658 6.0E-34
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q10074|AVT3_SCHPO Vacuolar amino acid transporter 3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=avt3 PE=1 SV=1 10 654 6.0E-125
sp|P36062|AVT3_YEAST Vacuolar amino acid transporter 3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=AVT3 PE=1 SV=1 125 656 2.0E-123
sp|P50944|AVT4_YEAST Vacuolar amino acid transporter 4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=AVT4 PE=1 SV=1 86 654 4.0E-99
sp|Q4KL91|S36A4_XENLA Proton-coupled amino acid transporter 4 OS=Xenopus laevis GN=slc36a4 PE=2 SV=1 221 657 7.0E-39
sp|Q7Z2H8|S36A1_HUMAN Proton-coupled amino acid transporter 1 OS=Homo sapiens GN=SLC36A1 PE=1 SV=1 234 658 6.0E-34
sp|F4ILY9|ANTL1_ARATH Amino acid transporter ANTL1 OS=Arabidopsis thaliana GN=At2g42005 PE=2 SV=1 239 655 3.0E-32
sp|Q8BHK3|S36A2_MOUSE Proton-coupled amino acid transporter 2 OS=Mus musculus GN=Slc36a2 PE=1 SV=1 270 553 2.0E-31
sp|Q8CH36|S36A4_MOUSE Proton-coupled amino acid transporter 4 OS=Mus musculus GN=Slc36a4 PE=2 SV=1 220 653 6.0E-31
sp|Q495M3|S36A2_HUMAN Proton-coupled amino acid transporter 2 OS=Homo sapiens GN=SLC36A2 PE=1 SV=1 268 649 1.0E-29
sp|Q924A5|S36A1_RAT Proton-coupled amino acid transporter 1 OS=Rattus norvegicus GN=Slc36a1 PE=2 SV=1 234 658 3.0E-29
sp|Q8K415|S36A2_RAT Proton-coupled amino acid transporter 2 OS=Rattus norvegicus GN=Slc36a2 PE=1 SV=1 270 553 6.0E-29
sp|Q6YBV0|S36A4_HUMAN Proton-coupled amino acid transporter 4 OS=Homo sapiens GN=SLC36A4 PE=1 SV=1 234 653 3.0E-28
sp|Q9SVG0|ANTL2_ARATH Amino acid transporter ANTL2 OS=Arabidopsis thaliana GN=At4g38250 PE=1 SV=1 246 649 7.0E-28
sp|Q8K4D3|S36A1_MOUSE Proton-coupled amino acid transporter 1 OS=Mus musculus GN=Slc36a1 PE=2 SV=1 234 658 1.0E-27
sp|Q811P0|S36A3_MOUSE Proton-coupled amino acid transporter 3 OS=Mus musculus GN=Slc36a3 PE=2 SV=1 255 655 4.0E-27
sp|Q495N2|S36A3_HUMAN Proton-coupled amino acid transporter 3 OS=Homo sapiens GN=SLC36A3 PE=2 SV=2 268 619 4.0E-27
sp|Q4V8B1|S36A3_RAT Proton-coupled amino acid transporter 3 OS=Rattus norvegicus GN=Slc36a3 PE=2 SV=1 256 619 1.0E-26
sp|Q9SF09|ANT1_ARATH Amino acid transporter ANT1 OS=Arabidopsis thaliana GN=ANT1 PE=1 SV=1 231 653 4.0E-26
sp|Q9FKY3|ANTL3_ARATH Amino acid transporter ANTL3 OS=Arabidopsis thaliana GN=At5g65990 PE=2 SV=1 245 622 7.0E-26
sp|Q503G8|S38A6_DANRE Probable sodium-coupled neutral amino acid transporter 6 OS=Danio rerio GN=slc38a6 PE=2 SV=1 244 658 4.0E-12
sp|Q9JHZ9|S38A3_RAT Sodium-coupled neutral amino acid transporter 3 OS=Rattus norvegicus GN=Slc38a3 PE=2 SV=1 235 622 7.0E-12
sp|Q6DIV6|VIAAT_XENTR Vesicular inhibitory amino acid transporter OS=Xenopus tropicalis GN=slc32a1 PE=2 SV=1 218 646 1.0E-11
sp|Q9H2H9|S38A1_HUMAN Sodium-coupled neutral amino acid transporter 1 OS=Homo sapiens GN=SLC38A1 PE=1 SV=1 218 646 6.0E-11
sp|Q9JM15|S38A1_RAT Sodium-coupled neutral amino acid transporter 1 OS=Rattus norvegicus GN=Slc38a1 PE=1 SV=1 218 643 8.0E-11
sp|Q5R443|S38A1_PONAB Sodium-coupled neutral amino acid transporter 1 OS=Pongo abelii GN=SLC38A1 PE=2 SV=1 218 646 1.0E-10
sp|Q6PF45|VIAAT_XENLA Vesicular inhibitory amino acid transporter OS=Xenopus laevis GN=slc32a1 PE=2 SV=1 274 646 2.0E-10
sp|Q9DCP2|S38A3_MOUSE Sodium-coupled neutral amino acid transporter 3 OS=Mus musculus GN=Slc38a3 PE=1 SV=1 235 657 4.0E-10
sp|G3UVW3|S38A6_MOUSE Probable sodium-coupled neutral amino acid transporter 6 OS=Mus musculus GN=Slc38a6 PE=2 SV=1 241 658 6.0E-10
sp|Q8K2P7|S38A1_MOUSE Sodium-coupled neutral amino acid transporter 1 OS=Mus musculus GN=Slc38a1 PE=1 SV=1 218 558 6.0E-10
sp|Q99624|S38A3_HUMAN Sodium-coupled neutral amino acid transporter 3 OS=Homo sapiens GN=SLC38A3 PE=1 SV=1 265 656 7.0E-10
sp|Q6WWW3|S38A6_RAT Probable sodium-coupled neutral amino acid transporter 6 OS=Rattus norvegicus GN=Slc38a6 PE=2 SV=1 243 658 9.0E-10
sp|P47082|AVT1_YEAST Vacuolar amino acid transporter 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=AVT1 PE=1 SV=1 265 650 2.0E-09
sp|P34479|SKAT1_CAEEL Probable amino acid transporter skat-1 OS=Caenorhabditis elegans GN=skat-1 PE=2 SV=2 217 655 6.0E-09
sp|Q3U1J0|S38A5_MOUSE Sodium-coupled neutral amino acid transporter 5 OS=Mus musculus GN=Slc38a5 PE=1 SV=1 216 645 6.0E-09
sp|Q28HE5|S38A6_XENTR Probable sodium-coupled neutral amino acid transporter 6 OS=Xenopus tropicalis GN=slc38a6 PE=2 SV=1 226 626 7.0E-09
sp|Q5SPB1|S38A2_DANRE Sodium-coupled neutral amino acid transporter 2 OS=Danio rerio GN=slc38a2 PE=3 SV=1 221 659 9.0E-09
sp|Q5E9S9|S38A5_BOVIN Sodium-coupled neutral amino acid transporter 5 OS=Bos taurus GN=SLC38A5 PE=2 SV=1 216 656 2.0E-08
sp|O35633|VIAAT_MOUSE Vesicular inhibitory amino acid transporter OS=Mus musculus GN=Slc32a1 PE=1 SV=3 268 646 2.0E-08
sp|Q9H598|VIAAT_HUMAN Vesicular inhibitory amino acid transporter OS=Homo sapiens GN=SLC32A1 PE=2 SV=2 268 646 3.0E-08
sp|O35458|VIAAT_RAT Vesicular inhibitory amino acid transporter OS=Rattus norvegicus GN=Slc32a1 PE=1 SV=1 268 646 3.0E-08
sp|Q95KE2|VIAAT_MACFA Vesicular inhibitory amino acid transporter OS=Macaca fascicularis GN=SLC32A1 PE=2 SV=1 268 646 3.0E-08
sp|Q8IZM9|S38A6_HUMAN Probable sodium-coupled neutral amino acid transporter 6 OS=Homo sapiens GN=SLC38A6 PE=1 SV=2 274 658 2.0E-07
sp|A2VCW5|S38A5_RAT Sodium-coupled neutral amino acid transporter 5 OS=Rattus norvegicus GN=Slc38a5 PE=1 SV=1 216 645 2.0E-07
sp|Q6DEL1|S38A7_DANRE Putative sodium-coupled neutral amino acid transporter 7 OS=Danio rerio GN=slc38a7 PE=2 SV=1 229 616 1.0E-06
sp|Q8WUX1|S38A5_HUMAN Sodium-coupled neutral amino acid transporter 5 OS=Homo sapiens GN=SLC38A5 PE=1 SV=1 264 656 2.0E-06
sp|P34579|UNC47_CAEEL Vesicular GABA transporter OS=Caenorhabditis elegans GN=unc-47 PE=1 SV=2 181 641 8.0E-06
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 31 0.45

Transmembrane Domains

Domain # Start End Length
1 297 319 22
2 343 365 22
3 380 402 22
4 409 430 21
5 450 472 22
6 485 507 22
7 576 593 17
8 598 620 22
9 635 657 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|3205
MAAEFSETPGSQQSRRQAEILDRFLPEGYSADPEVSLSAGPVEVSPAFDGDDSAPINSACSNSHGHAPGSGPRPT
LVSGSGSGLVSRSSSGSGTASAISPAIAPDDLDTRGDGSSSQVPPVDLVESSLKLQGGDIHRDMFKIKARANSLR
RAATFSHQPSPRLHPADELTCPEQREPGGFRRQHLQYRARQRRFSGPLVVARNFVDFLDLYGSFAGEDLEDADTS
EDDESAIADDHDDLNDSQQPQERRPLLGRRRSSRRRIAHGDASTFKTFFTLLKAFIGTGIMFLPKAFRNGGILFS
SLTLVVISLINCFCFRLLLDCRQRYGGGYGELGAAIVGPRFRSLILASIALSQLGFVCAGLIFTAENLVAFVDAV
AKRPVIGDIGVSGFIAIQLVPLVPLALIRNISKLGLVALLADVFILAGLVYIWYYDVHTLLRSGIDPTVRLFNPS
DFTLTIGSAIFTFEGIGLILPIQSSMRKPEHFGSLLNFVMFLITIIFTSVGALCYATFGEDTKIQVISNFPQDSI
LVNAVQLLYSLAVLGGEPVQLFPAVRIIETSLFGERATGKKSLAIKWKKNGIRTAVMALCVVISMIGATDLDKFV
ALIGSFACVPLVYIYPAYLHYKGAAEKGWAKALDVALMVLGSIAMVYTTLVTVFQWIES*
Coding >OphauB2|3205
ATGGCTGCAGAGTTCAGCGAAACACCAGGAAGCCAGCAGAGCAGACGCCAGGCCGAAATTCTCGACCGCTTTTTG
CCCGAAGGCTACTCGGCTGACCCCGAAGTTAGTCTGTCCGCTGGTCCGGTCGAAGTCTCTCCAGCGTTTGACGGC
GACGACTCAGCGCCTATAAATTCGGCATGTAGCAACAGCCATGGCCACGCCCCCGGCTCCGGGCCTCGGCCAACA
TTGGTATCCGGCTCCGGCTCAGGGCTTGTCTCACGTTCCAGCTCTGGTAGTGGGACTGCCTCAGCTATATCACCA
GCTATAGCTCCAGATGACTTAGACACTAGGGGCGATGGCTCTTCATCTCAAGTCCCCCCAGTTGATCTGGTTGAA
TCGTCTCTCAAACTACAGGGCGGCGACATTCATCGCGACATGTTCAAGATCAAGGCACGCGCCAATTCACTCCGT
CGCGCCGCCACCTTTTCTCACCAACCATCGCCCCGTCTACACCCAGCCGACGAACTTACATGCCCGGAGCAGCGA
GAACCTGGCGGTTTTCGGCGCCAGCATTTGCAGTACCGCGCCCGCCAGCGTCGCTTCAGCGGGCCTCTAGTCGTC
GCACGAAACTTTGTCGACTTTCTCGACCTATACGGCAGCTTTGCCGGCGAGGATCTCGAGGATGCTGACACCTCC
GAAGATGACGAGTCTGCCATTGCCGACGATCACGATGACCTCAATGATTCTCAGCAGCCTCAGGAACGGAGACCT
CTTCTCGGGCGCCGTCGGAGCTCACGGCGGCGCATCGCACATGGTGATGCCTCGACCTTTAAGACCTTTTTTACT
CTGCTCAAAGCTTTCATTGGCACCGGCATCATGTTCCTTCCCAAGGCTTTCCGCAATGGTGGCATTCTTTTTTCC
TCGCTCACCCTGGTTGTTATTTCTCTCATCAACTGCTTCTGCTTCCGTCTCCTGCTCGACTGCCGCCAAAGATAC
GGTGGCGGCTATGGCGAGCTGGGTGCTGCCATCGTTGGCCCCCGGTTTCGCAGTCTCATTCTTGCATCGATAGCA
CTCTCTCAGCTTGGCTTCGTCTGCGCTGGCCTTATATTCACTGCCGAGAACTTGGTCGCCTTTGTCGATGCCGTA
GCAAAGCGCCCAGTCATTGGAGACATTGGAGTTTCTGGCTTCATCGCTATTCAACTTGTACCGCTTGTACCGCTC
GCTCTGATTCGTAACATCTCCAAGCTCGGCCTGGTTGCTCTCCTGGCGGATGTTTTCATTCTTGCTGGACTTGTT
TACATTTGGTACTATGATGTACACACTCTTCTTCGCTCGGGAATTGATCCGACAGTCCGTCTTTTTAATCCGTCC
GACTTCACACTTACTATCGGCTCGGCCATTTTCACGTTTGAGGGTATAGGGCTTATTCTTCCTATTCAATCAAGC
ATGCGCAAGCCTGAGCATTTTGGCAGCCTTCTCAACTTTGTCATGTTCCTGATTACCATAATCTTTACGTCTGTT
GGCGCTCTGTGCTACGCCACGTTTGGCGAGGACACCAAGATTCAAGTCATTTCAAACTTCCCGCAGGATTCTATA
CTTGTCAATGCGGTGCAGTTGCTCTATTCGCTCGCGGTACTTGGCGGTGAGCCAGTTCAGCTATTTCCCGCTGTT
CGCATCATTGAGACATCCCTGTTTGGTGAGCGGGCTACAGGCAAGAAGAGCCTGGCCATTAAGTGGAAGAAGAAT
GGCATCCGGACGGCTGTCATGGCTCTTTGCGTTGTCATCTCCATGATTGGTGCAACTGACCTTGACAAGTTTGTT
GCTCTGATTGGCAGCTTTGCATGTGTGCCTCTGGTATACATATACCCAGCATACCTGCACTACAAGGGCGCCGCC
GAGAAAGGGTGGGCCAAGGCTCTAGACGTGGCGCTCATGGTATTGGGAAGCATAGCCATGGTGTACACGACGCTC
GTGACTGTCTTTCAGTGGATAGAGAGCTAG
Transcript >OphauB2|3205
ATGGCTGCAGAGTTCAGCGAAACACCAGGAAGCCAGCAGAGCAGACGCCAGGCCGAAATTCTCGACCGCTTTTTG
CCCGAAGGCTACTCGGCTGACCCCGAAGTTAGTCTGTCCGCTGGTCCGGTCGAAGTCTCTCCAGCGTTTGACGGC
GACGACTCAGCGCCTATAAATTCGGCATGTAGCAACAGCCATGGCCACGCCCCCGGCTCCGGGCCTCGGCCAACA
TTGGTATCCGGCTCCGGCTCAGGGCTTGTCTCACGTTCCAGCTCTGGTAGTGGGACTGCCTCAGCTATATCACCA
GCTATAGCTCCAGATGACTTAGACACTAGGGGCGATGGCTCTTCATCTCAAGTCCCCCCAGTTGATCTGGTTGAA
TCGTCTCTCAAACTACAGGGCGGCGACATTCATCGCGACATGTTCAAGATCAAGGCACGCGCCAATTCACTCCGT
CGCGCCGCCACCTTTTCTCACCAACCATCGCCCCGTCTACACCCAGCCGACGAACTTACATGCCCGGAGCAGCGA
GAACCTGGCGGTTTTCGGCGCCAGCATTTGCAGTACCGCGCCCGCCAGCGTCGCTTCAGCGGGCCTCTAGTCGTC
GCACGAAACTTTGTCGACTTTCTCGACCTATACGGCAGCTTTGCCGGCGAGGATCTCGAGGATGCTGACACCTCC
GAAGATGACGAGTCTGCCATTGCCGACGATCACGATGACCTCAATGATTCTCAGCAGCCTCAGGAACGGAGACCT
CTTCTCGGGCGCCGTCGGAGCTCACGGCGGCGCATCGCACATGGTGATGCCTCGACCTTTAAGACCTTTTTTACT
CTGCTCAAAGCTTTCATTGGCACCGGCATCATGTTCCTTCCCAAGGCTTTCCGCAATGGTGGCATTCTTTTTTCC
TCGCTCACCCTGGTTGTTATTTCTCTCATCAACTGCTTCTGCTTCCGTCTCCTGCTCGACTGCCGCCAAAGATAC
GGTGGCGGCTATGGCGAGCTGGGTGCTGCCATCGTTGGCCCCCGGTTTCGCAGTCTCATTCTTGCATCGATAGCA
CTCTCTCAGCTTGGCTTCGTCTGCGCTGGCCTTATATTCACTGCCGAGAACTTGGTCGCCTTTGTCGATGCCGTA
GCAAAGCGCCCAGTCATTGGAGACATTGGAGTTTCTGGCTTCATCGCTATTCAACTTGTACCGCTTGTACCGCTC
GCTCTGATTCGTAACATCTCCAAGCTCGGCCTGGTTGCTCTCCTGGCGGATGTTTTCATTCTTGCTGGACTTGTT
TACATTTGGTACTATGATGTACACACTCTTCTTCGCTCGGGAATTGATCCGACAGTCCGTCTTTTTAATCCGTCC
GACTTCACACTTACTATCGGCTCGGCCATTTTCACGTTTGAGGGTATAGGGCTTATTCTTCCTATTCAATCAAGC
ATGCGCAAGCCTGAGCATTTTGGCAGCCTTCTCAACTTTGTCATGTTCCTGATTACCATAATCTTTACGTCTGTT
GGCGCTCTGTGCTACGCCACGTTTGGCGAGGACACCAAGATTCAAGTCATTTCAAACTTCCCGCAGGATTCTATA
CTTGTCAATGCGGTGCAGTTGCTCTATTCGCTCGCGGTACTTGGCGGTGAGCCAGTTCAGCTATTTCCCGCTGTT
CGCATCATTGAGACATCCCTGTTTGGTGAGCGGGCTACAGGCAAGAAGAGCCTGGCCATTAAGTGGAAGAAGAAT
GGCATCCGGACGGCTGTCATGGCTCTTTGCGTTGTCATCTCCATGATTGGTGCAACTGACCTTGACAAGTTTGTT
GCTCTGATTGGCAGCTTTGCATGTGTGCCTCTGGTATACATATACCCAGCATACCTGCACTACAAGGGCGCCGCC
GAGAAAGGGTGGGCCAAGGCTCTAGACGTGGCGCTCATGGTATTGGGAAGCATAGCCATGGTGTACACGACGCTC
GTGACTGTCTTTCAGTGGATAGAGAGCTAG
Gene >OphauB2|3205
ATGGCTGCAGAGTTCAGCGAAACACCAGGAAGCCAGCAGAGCAGACGCCAGGCCGAAATTCTCGACCGCTTTTTG
CCCGAAGGCTACTCGGCTGACCCCGAAGTTAGTCTGTCCGCTGGTCCGGTCGAAGTCTCTCCAGCGTTTGACGGC
GACGACTCAGCGCCTATAAATTCGGCATGTAGCAACAGCCATGGCCACGCCCCCGGCTCCGGGCCTCGGCCAACA
TTGGTATCCGGCTCCGGCTCAGGGCTTGTCTCACGTTCCAGCTCTGGTAGTGGGACTGCCTCAGCTATATCACCA
GCTATAGCTCCAGATGACTTAGACACTAGGGGCGATGGCTCTTCATCTCAAGTCCCCCCAGTTGATCTGGTTGAA
TCGTCTCTCAAACTACAGGGCGGCGACATTCATCGCGACATGTTCAAGATCAAGGCACGCGCCAATTCACTCCGT
CGCGCCGCCACCTTTTCTCACCAACCATCGCCCCGTCTACACCCAGCCGACGAACTTACATGCCCGGAGCAGCGA
GAACCTGGCGGTTTTCGGCGCCAGCATTTGCAGTACCGCGCCCGCCAGCGTCGCTTCAGCGGGCCTCTAGTCGTC
GCACGAAACTTTGTCGACTTTCTCGACCTATACGGCAGCTTTGCCGGCGAGGATCTCGAGGATGCTGACACCTCC
GAAGATGACGAGTCTGCCATTGCCGACGATCACGATGACCTCAATGATTCTCAGCAGCCTCAGGAACGGAGACCT
CTTCTCGGGCGCCGTCGGAGCTCACGGCGGCGCATCGCACATGGTGATGCCTCGACCTTTAAGACCTTTTTTACT
CTGCTCAAAGCTTTCATTGGCACCGGCATCATGTTCCTTCCCAAGGCTTTCCGCAATGGTGGCATTCTTTTTTCC
TCGCTCACCCTGGTTGTTATTTCTCTCATCAACTGCTTCTGCTTCCGTCTCCTGCTCGACTGCCGCCAAAGATAC
GGTGGCGGCTATGGCGAGCTGGGTGCTGCCATCGTTGGCCCCCGGTTTCGCAGTCTCATTCTTGCATCGATAGCA
CTCTCTCAGCTTGGCTTCGTCTGCGCTGGCCTTATATTCACTGCCGAGAACTTGGTCGCCTTTGTCGATGCCGTA
GCAAAGCGCCCAGTCATTGGAGACATTGGAGTTTCTGGCTTCATCGCTATTCAACTTGTACCGCTTGTACCGCTC
GCTCTGATTCGTAACATCTCCAAGCTCGGCCTGGTTGCTCTCCTGGCGGATGTTTTCATTCTTGCTGGACTTGTT
TACATTTGGTACTATGATGTACACACTCTTCTTCGCTCGGGAATTGATCCGACAGTCCGTCTTTTTAATCCGTCC
GACTTCACACTTACTATCGGCTCGGCCATTTTCACGTTTGAGGGTATAGGGCTTATTCTTCCTATTCAATCAAGC
ATGCGCAAGCCTGAGCATTTTGGCAGCCTTCTCAACTTTGTCATGTTCCTGATTACCATAATCTTTACGTCTGTT
GGCGCTCTGTGCTACGCCACGTTTGGCGAGGACACCAAGATTCAAGTCATTTCAAACTTCCCGCAGGATTCTATA
CTTGTCAATGCGGTGCAGTTGCTCTATTCGCTCGCGGTACTTGGCGGTGAGCCAGTTCAGCTATTTCCCGCTGTT
CGCATCATTGAGACATCCCTGTTTGGTGAGCGGGCTACAGGCAAGAAGAGCCTGGCCATTAAGTGGAAGAAGAAT
GGCATCCGGACGGCTGTCATGGCTCTTTGCGTTGTCATCTCCATGATTGGTGCAACTGACCTTGACAAGTTTGTT
GCTCTGATTGGCAGCTTTGCATGTGTGCCTCTGGTATACATATACCCAGCATACCTGCACTACAAGGGCGCCGCC
GAGAAAGGGTGGGCCAAGGCTCTAGACGTGGCGCTCATGGTATTGGGAAGCATAGCCATGGTGTACACGACGCTC
GTGACTGTCTTTCAGTGGATAGAGAGCTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail