Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|3189
Gene name
LocationContig_205:27126..27888
Strand+
Gene length (bp)762
Transcript length (bp)648
Coding sequence length (bp)648
Protein length (aa) 216

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01135 PCMT Protein-L-isoaspartate(D-aspartate) O-methyltransferase (PCMT) 3.2E-56 3 212

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9URZ1|PIMT_SCHPO Probable protein-L-isoaspartate O-methyltransferase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pcm2 PE=3 SV=1 6 214 7.0E-52
sp|Q27869|PIMT_DROME Protein-L-isoaspartate(D-aspartate) O-methyltransferase OS=Drosophila melanogaster GN=Pcmt PE=1 SV=2 4 211 8.0E-45
sp|Q43209|PIMT_WHEAT Protein-L-isoaspartate O-methyltransferase OS=Triticum aestivum GN=PCM PE=1 SV=1 3 210 5.0E-44
sp|P22061|PIMT_HUMAN Protein-L-isoaspartate(D-aspartate) O-methyltransferase OS=Homo sapiens GN=PCMT1 PE=1 SV=4 3 211 5.0E-44
sp|P23506|PIMT_MOUSE Protein-L-isoaspartate(D-aspartate) O-methyltransferase OS=Mus musculus GN=Pcmt1 PE=1 SV=3 3 211 6.0E-44
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9URZ1|PIMT_SCHPO Probable protein-L-isoaspartate O-methyltransferase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pcm2 PE=3 SV=1 6 214 7.0E-52
sp|Q27869|PIMT_DROME Protein-L-isoaspartate(D-aspartate) O-methyltransferase OS=Drosophila melanogaster GN=Pcmt PE=1 SV=2 4 211 8.0E-45
sp|Q43209|PIMT_WHEAT Protein-L-isoaspartate O-methyltransferase OS=Triticum aestivum GN=PCM PE=1 SV=1 3 210 5.0E-44
sp|P22061|PIMT_HUMAN Protein-L-isoaspartate(D-aspartate) O-methyltransferase OS=Homo sapiens GN=PCMT1 PE=1 SV=4 3 211 5.0E-44
sp|P23506|PIMT_MOUSE Protein-L-isoaspartate(D-aspartate) O-methyltransferase OS=Mus musculus GN=Pcmt1 PE=1 SV=3 3 211 6.0E-44
sp|Q5RA89|PIMT_PONAB Protein-L-isoaspartate(D-aspartate) O-methyltransferase OS=Pongo abelii GN=PCMT1 PE=2 SV=3 3 211 9.0E-44
sp|Q4R5H0|PIMT_MACFA Protein-L-isoaspartate(D-aspartate) O-methyltransferase OS=Macaca fascicularis GN=PCMT1 PE=2 SV=3 3 211 9.0E-44
sp|P80895|PIMT_PIG Protein-L-isoaspartate(D-aspartate) O-methyltransferase OS=Sus scrofa GN=PCMT1 PE=1 SV=3 3 211 1.0E-43
sp|P15246|PIMT_BOVIN Protein-L-isoaspartate(D-aspartate) O-methyltransferase OS=Bos taurus GN=PCMT1 PE=1 SV=2 3 211 2.0E-43
sp|Q64J17|PIMT2_ARATH Protein-L-isoaspartate O-methyltransferase 2 OS=Arabidopsis thaliana GN=PIMT2 PE=1 SV=1 1 211 2.0E-43
sp|P22062|PIMT_RAT Protein-L-isoaspartate(D-aspartate) O-methyltransferase OS=Rattus norvegicus GN=Pcmt1 PE=1 SV=2 3 211 4.0E-43
sp|Q42539|PIMT1_ARATH Protein-L-isoaspartate O-methyltransferase 1 OS=Arabidopsis thaliana GN=PIMT1 PE=1 SV=3 1 210 6.0E-43
sp|Q5F3N1|PIMT_CHICK Protein-L-isoaspartate(D-aspartate) O-methyltransferase OS=Gallus gallus GN=PCMT1 PE=2 SV=3 3 211 2.0E-42
sp|Q92047|PIMT_DANRE Protein-L-isoaspartate(D-aspartate) O-methyltransferase OS=Danio rerio GN=pcmt PE=2 SV=3 3 211 3.0E-42
sp|Q27873|PIMT_CAEEL Protein-L-isoaspartate O-methyltransferase OS=Caenorhabditis elegans GN=pcm-1 PE=2 SV=1 11 210 2.0E-41
sp|Q9GPS6|PIMT_DICDI Probable protein-L-isoaspartate O-methyltransferase OS=Dictyostelium discoideum GN=pcmA PE=3 SV=1 2 214 2.0E-32
sp|Q8TYL4|PIMT_METKA Protein-L-isoaspartate O-methyltransferase OS=Methanopyrus kandleri (strain AV19 / DSM 6324 / JCM 9639 / NBRC 100938) GN=pcm PE=3 SV=1 5 209 2.0E-29
sp|O27962|PIMT2_ARCFU Protein-L-isoaspartate O-methyltransferase 2 OS=Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126) GN=pcm2 PE=3 SV=1 3 209 2.0E-28
sp|A8AAV7|PIMT_IGNH4 Protein-L-isoaspartate O-methyltransferase OS=Ignicoccus hospitalis (strain KIN4/I / DSM 18386 / JCM 14125) GN=pcm PE=3 SV=1 4 211 1.0E-26
sp|Q8TT93|PIMT1_METAC Protein-L-isoaspartate O-methyltransferase 1 OS=Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A) GN=pcm1 PE=3 SV=1 11 210 5.0E-26
sp|A0B9U1|PIMT_METTP Protein-L-isoaspartate O-methyltransferase OS=Methanosaeta thermophila (strain DSM 6194 / JCM 14653 / NBRC 101360 / PT) GN=pcm PE=3 SV=1 11 210 6.0E-25
sp|A7HL14|PIMT_FERNB Protein-L-isoaspartate O-methyltransferase OS=Fervidobacterium nodosum (strain ATCC 35602 / DSM 5306 / Rt17-B1) GN=pcm PE=3 SV=1 11 209 7.0E-25
sp|A1RSC6|PIMT_PYRIL Protein-L-isoaspartate O-methyltransferase OS=Pyrobaculum islandicum (strain DSM 4184 / JCM 9189 / GEO3) GN=pcm PE=3 SV=1 1 212 7.0E-25
sp|O30199|PIMT1_ARCFU Protein-L-isoaspartate O-methyltransferase 1 OS=Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126) GN=pcm1 PE=3 SV=1 3 209 1.0E-24
sp|Q8PW90|PIMT_METMA Protein-L-isoaspartate O-methyltransferase OS=Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88) GN=pcm PE=3 SV=1 5 209 1.0E-24
sp|A3MY16|PIMT_PYRCJ Protein-L-isoaspartate O-methyltransferase OS=Pyrobaculum calidifontis (strain JCM 11548 / VA1) GN=pcm PE=3 SV=1 1 211 3.0E-24
sp|Q8TT94|PIMT2_METAC Protein-L-isoaspartate O-methyltransferase 2 OS=Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A) GN=pcm2 PE=3 SV=1 6 209 3.0E-24
sp|A6LNM3|PIMT_THEM4 Protein-L-isoaspartate O-methyltransferase OS=Thermosipho melanesiensis (strain DSM 12029 / CIP 104789 / BI429) GN=pcm PE=3 SV=1 1 210 4.0E-24
sp|A0LM89|PIMT2_SYNFM Protein-L-isoaspartate O-methyltransferase 2 OS=Syntrophobacter fumaroxidans (strain DSM 10017 / MPOB) GN=pcm2 PE=3 SV=1 10 210 7.0E-24
sp|A2BKH8|PIMT_HYPBU Protein-L-isoaspartate O-methyltransferase OS=Hyperthermus butylicus (strain DSM 5456 / JCM 9403 / PLM1-5) GN=pcm PE=3 SV=1 5 210 8.0E-24
sp|Q8ZYN0|PIMT_PYRAE Protein-L-isoaspartate O-methyltransferase OS=Pyrobaculum aerophilum (strain ATCC 51768 / IM2 / DSM 7523 / JCM 9630 / NBRC 100827) GN=pcm PE=1 SV=1 3 209 1.0E-23
sp|Q12UV0|PIMT_METBU Protein-L-isoaspartate O-methyltransferase OS=Methanococcoides burtonii (strain DSM 6242 / NBRC 107633 / OCM 468 / ACE-M) GN=pcm PE=3 SV=1 8 209 2.0E-23
sp|B3E6I4|PIMT_GEOLS Protein-L-isoaspartate O-methyltransferase OS=Geobacter lovleyi (strain ATCC BAA-1151 / DSM 17278 / SZ) GN=pcm PE=3 SV=1 7 209 6.0E-23
sp|Q1D6W9|PIMT_MYXXD Protein-L-isoaspartate O-methyltransferase OS=Myxococcus xanthus (strain DK 1622) GN=pcm PE=3 SV=1 1 213 9.0E-23
sp|Q0KB67|PIMT1_CUPNH Protein-L-isoaspartate O-methyltransferase 1 OS=Cupriavidus necator (strain ATCC 17699 / H16 / DSM 428 / Stanier 337) GN=pcm1 PE=3 SV=1 3 210 2.0E-22
sp|Q123X2|PIMT2_POLSJ Protein-L-isoaspartate O-methyltransferase 2 OS=Polaromonas sp. (strain JS666 / ATCC BAA-500) GN=pcm2 PE=3 SV=1 11 210 2.0E-22
sp|B1YC47|PIMT_PYRNV Protein-L-isoaspartate O-methyltransferase OS=Pyrobaculum neutrophilum (strain DSM 2338 / JCM 9278 / V24Sta) GN=pcm PE=3 SV=1 1 212 3.0E-22
sp|A6UWM1|PIMT_META3 Protein-L-isoaspartate O-methyltransferase OS=Methanococcus aeolicus (strain Nankai-3 / ATCC BAA-1280) GN=pcm PE=3 SV=1 1 209 4.0E-22
sp|O26915|PIMT_METTH Protein-L-isoaspartate O-methyltransferase OS=Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H) GN=pcm PE=3 SV=1 1 209 4.0E-22
sp|A4G087|PIMT_METM5 Protein-L-isoaspartate O-methyltransferase OS=Methanococcus maripaludis (strain C5 / ATCC BAA-1333) GN=pcm PE=3 SV=1 1 209 1.0E-21
sp|B1JB29|PIMT_PSEPW Protein-L-isoaspartate O-methyltransferase OS=Pseudomonas putida (strain W619) GN=pcm PE=3 SV=2 7 213 2.0E-21
sp|A3DMG3|PIMT_STAMF Protein-L-isoaspartate O-methyltransferase OS=Staphylothermus marinus (strain ATCC 43588 / DSM 3639 / JCM 9404 / F1) GN=pcm PE=3 SV=1 1 209 2.0E-21
sp|Q2YCR1|PIMT1_NITMU Protein-L-isoaspartate O-methyltransferase 1 OS=Nitrosospira multiformis (strain ATCC 25196 / NCIMB 11849) GN=pcm1 PE=3 SV=1 12 209 3.0E-21
sp|C3LS22|PIMT_VIBCM Protein-L-isoaspartate O-methyltransferase OS=Vibrio cholerae serotype O1 (strain M66-2) GN=pcm PE=3 SV=1 7 210 4.0E-21
sp|Q9KUI8|PIMT_VIBCH Protein-L-isoaspartate O-methyltransferase OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=pcm PE=3 SV=1 7 210 4.0E-21
sp|A5F9C1|PIMT_VIBC3 Protein-L-isoaspartate O-methyltransferase OS=Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395) GN=pcm PE=1 SV=1 7 210 4.0E-21
sp|Q3JAW6|PIMT2_NITOC Protein-L-isoaspartate O-methyltransferase 2 OS=Nitrosococcus oceani (strain ATCC 19707 / NCIMB 11848) GN=pcm2 PE=3 SV=1 11 210 7.0E-21
sp|A9KYG4|PIMT_SHEB9 Protein-L-isoaspartate O-methyltransferase OS=Shewanella baltica (strain OS195) GN=pcm PE=3 SV=1 11 211 8.0E-21
sp|B8E0T1|PIMT_DICTD Protein-L-isoaspartate O-methyltransferase OS=Dictyoglomus turgidum (strain Z-1310 / DSM 6724) GN=pcm PE=3 SV=1 7 209 9.0E-21
sp|B1ZPF0|PIMT_OPITP Protein-L-isoaspartate O-methyltransferase OS=Opitutus terrae (strain DSM 11246 / PB90-1) GN=pcm PE=3 SV=1 7 210 1.0E-20
sp|Q2NVM1|PIMT_SODGM Protein-L-isoaspartate O-methyltransferase OS=Sodalis glossinidius (strain morsitans) GN=pcm PE=3 SV=1 7 210 1.0E-20
sp|A6V1G4|PIMT_PSEA7 Protein-L-isoaspartate O-methyltransferase OS=Pseudomonas aeruginosa (strain PA7) GN=pcm PE=3 SV=2 1 213 1.0E-20
sp|A6VI91|PIMT_METM7 Protein-L-isoaspartate O-methyltransferase OS=Methanococcus maripaludis (strain C7 / ATCC BAA-1331) GN=pcm PE=3 SV=1 1 209 1.0E-20
sp|Q12PY8|PIMT_SHEDO Protein-L-isoaspartate O-methyltransferase OS=Shewanella denitrificans (strain OS217 / ATCC BAA-1090 / DSM 15013) GN=pcm PE=3 SV=1 1 211 1.0E-20
sp|A4WNC5|PIMT_PYRAR Protein-L-isoaspartate O-methyltransferase OS=Pyrobaculum arsenaticum (strain DSM 13514 / JCM 11321) GN=pcm PE=3 SV=1 3 209 1.0E-20
sp|A1RHF9|PIMT_SHESW Protein-L-isoaspartate O-methyltransferase OS=Shewanella sp. (strain W3-18-1) GN=pcm PE=3 SV=1 12 211 1.0E-20
sp|A4Y937|PIMT_SHEPC Protein-L-isoaspartate O-methyltransferase OS=Shewanella putrefaciens (strain CN-32 / ATCC BAA-453) GN=pcm PE=3 SV=1 12 211 1.0E-20
sp|A6WR22|PIMT_SHEB8 Protein-L-isoaspartate O-methyltransferase OS=Shewanella baltica (strain OS185) GN=pcm PE=3 SV=1 11 211 2.0E-20
sp|A3D789|PIMT_SHEB5 Protein-L-isoaspartate O-methyltransferase OS=Shewanella baltica (strain OS155 / ATCC BAA-1091) GN=pcm PE=3 SV=1 11 211 2.0E-20
sp|B8E8T7|PIMT_SHEB2 Protein-L-isoaspartate O-methyltransferase OS=Shewanella baltica (strain OS223) GN=pcm PE=3 SV=1 11 211 2.0E-20
sp|A0KGH9|PIMT_AERHH Protein-L-isoaspartate O-methyltransferase OS=Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / JCM 1027 / KCTC 2358 / NCIMB 9240) GN=pcm PE=3 SV=1 11 211 2.0E-20
sp|A9A8I9|PIMT_METM6 Protein-L-isoaspartate O-methyltransferase OS=Methanococcus maripaludis (strain C6 / ATCC BAA-1332) GN=pcm PE=3 SV=1 1 209 3.0E-20
sp|Q1I655|PIMT_PSEE4 Protein-L-isoaspartate O-methyltransferase OS=Pseudomonas entomophila (strain L48) GN=pcm PE=3 SV=2 7 213 3.0E-20
sp|P45683|PIMT_PSEAE Protein-L-isoaspartate O-methyltransferase OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=pcm PE=3 SV=2 30 213 4.0E-20
sp|Q02R96|PIMT_PSEAB Protein-L-isoaspartate O-methyltransferase OS=Pseudomonas aeruginosa (strain UCBPP-PA14) GN=pcm PE=3 SV=1 30 213 4.0E-20
sp|B7V8C3|PIMT_PSEA8 Protein-L-isoaspartate O-methyltransferase OS=Pseudomonas aeruginosa (strain LESB58) GN=pcm PE=3 SV=1 30 213 4.0E-20
sp|A6UR90|PIMT_METVS Protein-L-isoaspartate O-methyltransferase OS=Methanococcus vannielii (strain SB / ATCC 35089 / DSM 1224) GN=pcm PE=3 SV=1 1 211 4.0E-20
sp|Q6D1B6|PIMT_PECAS Protein-L-isoaspartate O-methyltransferase OS=Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) GN=pcm PE=3 SV=1 7 210 5.0E-20
sp|Q57636|PIMT_METJA Protein-L-isoaspartate O-methyltransferase OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=pcm PE=1 SV=1 1 174 5.0E-20
sp|A4VJV3|PIMT_PSEU5 Protein-L-isoaspartate O-methyltransferase OS=Pseudomonas stutzeri (strain A1501) GN=pcm PE=3 SV=2 30 213 8.0E-20
sp|B4RZG8|PIMT_ALTMD Protein-L-isoaspartate O-methyltransferase OS=Alteromonas macleodii (strain DSM 17117 / Deep ecotype) GN=pcm1 PE=3 SV=1 1 210 8.0E-20
sp|Q8EBR6|PIMT_SHEON Protein-L-isoaspartate O-methyltransferase OS=Shewanella oneidensis (strain MR-1) GN=pcm PE=3 SV=1 7 211 1.0E-19
sp|B5YF00|PIMT_DICT6 Protein-L-isoaspartate O-methyltransferase OS=Dictyoglomus thermophilum (strain ATCC 35947 / DSM 3960 / H-6-12) GN=pcm PE=3 SV=1 7 209 1.0E-19
sp|A8FST4|PIMT1_SHESH Protein-L-isoaspartate O-methyltransferase 1 OS=Shewanella sediminis (strain HAW-EB3) GN=pcm1 PE=3 SV=1 12 211 1.0E-19
sp|Q7NRV0|PIMT_CHRVO Protein-L-isoaspartate O-methyltransferase OS=Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / NBRC 12614 / NCIMB 9131 / NCTC 9757) GN=pcm PE=3 SV=1 1 209 1.0E-19
sp|Q88MF0|PIMT_PSEPK Protein-L-isoaspartate O-methyltransferase OS=Pseudomonas putida (strain KT2440) GN=pcm PE=3 SV=2 30 213 1.0E-19
sp|B0KSC8|PIMT_PSEPG Protein-L-isoaspartate O-methyltransferase OS=Pseudomonas putida (strain GB-1) GN=pcm PE=3 SV=2 30 213 1.0E-19
sp|A5W820|PIMT_PSEP1 Protein-L-isoaspartate O-methyltransferase OS=Pseudomonas putida (strain F1 / ATCC 700007) GN=pcm PE=3 SV=2 30 213 1.0E-19
sp|Q6M116|PIMT_METMP Protein-L-isoaspartate O-methyltransferase OS=Methanococcus maripaludis (strain S2 / LL) GN=pcm PE=3 SV=1 1 209 1.0E-19
sp|Q2SKW3|PIMT_HAHCH Protein-L-isoaspartate O-methyltransferase OS=Hahella chejuensis (strain KCTC 2396) GN=pcm PE=3 SV=1 3 209 2.0E-19
sp|A4XWR1|PIMT_PSEMY Protein-L-isoaspartate O-methyltransferase OS=Pseudomonas mendocina (strain ymp) GN=pcm PE=3 SV=2 1 213 2.0E-19
sp|A3QC83|PIMT_SHELP Protein-L-isoaspartate O-methyltransferase OS=Shewanella loihica (strain ATCC BAA-1088 / PV-4) GN=pcm PE=3 SV=2 7 211 2.0E-19
sp|B5FAF3|PIMT_VIBFM Protein-L-isoaspartate O-methyltransferase OS=Vibrio fischeri (strain MJ11) GN=pcm PE=3 SV=1 12 210 3.0E-19
sp|Q48F88|PIMT_PSE14 Protein-L-isoaspartate O-methyltransferase OS=Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6) GN=pcm PE=3 SV=2 7 213 3.0E-19
sp|Q4KHE7|PIMT_PSEF5 Protein-L-isoaspartate O-methyltransferase OS=Pseudomonas fluorescens (strain Pf-5 / ATCC BAA-477) GN=pcm PE=3 SV=2 7 213 3.0E-19
sp|C3K706|PIMT_PSEFS Protein-L-isoaspartate O-methyltransferase OS=Pseudomonas fluorescens (strain SBW25) GN=pcm PE=3 SV=1 30 213 3.0E-19
sp|Q4ZWP9|PIMT_PSEU2 Protein-L-isoaspartate O-methyltransferase OS=Pseudomonas syringae pv. syringae (strain B728a) GN=pcm PE=3 SV=2 7 213 3.0E-19
sp|Q2IIL9|PIMT_ANADE Protein-L-isoaspartate O-methyltransferase OS=Anaeromyxobacter dehalogenans (strain 2CP-C) GN=pcm PE=3 SV=1 11 213 3.0E-19
sp|Q87LQ6|PIMT_VIBPA Protein-L-isoaspartate O-methyltransferase OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) GN=pcm PE=3 SV=1 7 210 3.0E-19
sp|A7MTT6|PIMT_VIBCB Protein-L-isoaspartate O-methyltransferase OS=Vibrio campbellii (strain ATCC BAA-1116 / BB120) GN=pcm PE=3 SV=1 7 210 3.0E-19
sp|A0KU88|PIMT_SHESA Protein-L-isoaspartate O-methyltransferase OS=Shewanella sp. (strain ANA-3) GN=pcm PE=3 SV=1 7 211 4.0E-19
sp|A1S4E3|PIMT_SHEAM Protein-L-isoaspartate O-methyltransferase OS=Shewanella amazonensis (strain ATCC BAA-1098 / SB2B) GN=pcm PE=3 SV=1 12 211 4.0E-19
sp|B2A578|PIMT_NATTJ Protein-L-isoaspartate O-methyltransferase OS=Natranaerobius thermophilus (strain ATCC BAA-1301 / DSM 18059 / JW/NM-WN-LF) GN=pcm PE=3 SV=1 7 209 4.0E-19
sp|Q2J302|PIMT1_RHOP2 Protein-L-isoaspartate O-methyltransferase 1 OS=Rhodopseudomonas palustris (strain HaA2) GN=pcm1 PE=3 SV=1 7 209 5.0E-19
sp|Q086A4|PIMT_SHEFN Protein-L-isoaspartate O-methyltransferase OS=Shewanella frigidimarina (strain NCIMB 400) GN=pcm PE=3 SV=1 7 211 5.0E-19
sp|A1JJT8|PIMT_YERE8 Protein-L-isoaspartate O-methyltransferase OS=Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081) GN=pcm PE=3 SV=1 7 210 5.0E-19
sp|C6DDF9|PIMT_PECCP Protein-L-isoaspartate O-methyltransferase OS=Pectobacterium carotovorum subsp. carotovorum (strain PC1) GN=pcm PE=3 SV=1 7 211 6.0E-19
sp|Q0HXG4|PIMT_SHESR Protein-L-isoaspartate O-methyltransferase OS=Shewanella sp. (strain MR-7) GN=pcm PE=3 SV=1 7 211 6.0E-19
sp|Q0HL66|PIMT_SHESM Protein-L-isoaspartate O-methyltransferase OS=Shewanella sp. (strain MR-4) GN=pcm PE=3 SV=1 7 211 6.0E-19
sp|Q5E332|PIMT_VIBF1 Protein-L-isoaspartate O-methyltransferase OS=Vibrio fischeri (strain ATCC 700601 / ES114) GN=pcm PE=3 SV=1 12 210 8.0E-19
sp|A1ASW6|PIMT2_PELPD Protein-L-isoaspartate O-methyltransferase 2 OS=Pelobacter propionicus (strain DSM 2379) GN=pcm2 PE=3 SV=1 7 212 8.0E-19
sp|A7HXK6|PIMT_PARL1 Protein-L-isoaspartate O-methyltransferase OS=Parvibaculum lavamentivorans (strain DS-1 / DSM 13023 / NCIMB 13966) GN=pcm PE=3 SV=1 1 211 8.0E-19
sp|Q7NJY2|PIMT_GLOVI Protein-L-isoaspartate O-methyltransferase OS=Gloeobacter violaceus (strain PCC 7421) GN=pcm PE=3 SV=2 12 210 8.0E-19
sp|B1KPT0|PIMT_SHEWM Protein-L-isoaspartate O-methyltransferase OS=Shewanella woodyi (strain ATCC 51908 / MS32) GN=pcm PE=3 SV=1 30 211 1.0E-18
sp|Q15P27|PIMT_PSEA6 Protein-L-isoaspartate O-methyltransferase OS=Pseudoalteromonas atlantica (strain T6c / ATCC BAA-1087) GN=pcm PE=3 SV=1 7 210 1.0E-18
sp|Q487E5|PIMT_COLP3 Protein-L-isoaspartate O-methyltransferase OS=Colwellia psychrerythraea (strain 34H / ATCC BAA-681) GN=pcm PE=3 SV=1 7 210 1.0E-18
sp|Q21LB7|PIMT_SACD2 Protein-L-isoaspartate O-methyltransferase OS=Saccharophagus degradans (strain 2-40 / ATCC 43961 / DSM 17024) GN=pcm PE=3 SV=1 30 209 1.0E-18
sp|A4SRB5|PIMT_AERS4 Protein-L-isoaspartate O-methyltransferase OS=Aeromonas salmonicida (strain A449) GN=pcm PE=3 SV=1 11 211 1.0E-18
sp|Q5QUB2|PIMT_IDILO Protein-L-isoaspartate O-methyltransferase OS=Idiomarina loihiensis (strain ATCC BAA-735 / DSM 15497 / L2-TR) GN=pcm PE=3 SV=1 7 210 2.0E-18
sp|Q39VS0|PIMT_GEOMG Protein-L-isoaspartate O-methyltransferase OS=Geobacter metallireducens (strain GS-15 / ATCC 53774 / DSM 7210) GN=pcm PE=3 SV=1 28 210 2.0E-18
sp|A8H1T1|PIMT_SHEPA Protein-L-isoaspartate O-methyltransferase OS=Shewanella pealeana (strain ATCC 700345 / ANG-SQ1) GN=pcm PE=3 SV=1 30 211 2.0E-18
sp|Q886L4|PIMT_PSESM Protein-L-isoaspartate O-methyltransferase OS=Pseudomonas syringae pv. tomato (strain DC3000) GN=pcm PE=3 SV=1 7 213 2.0E-18
sp|Q6MCW9|PIMT_PARUW Protein-L-isoaspartate O-methyltransferase OS=Protochlamydia amoebophila (strain UWE25) GN=pcm PE=3 SV=1 7 210 3.0E-18
sp|B1JJF4|PIMT_YERPY Protein-L-isoaspartate O-methyltransferase OS=Yersinia pseudotuberculosis serotype O:3 (strain YPIII) GN=pcm PE=3 SV=1 11 210 3.0E-18
sp|Q66EB9|PIMT_YERPS Protein-L-isoaspartate O-methyltransferase OS=Yersinia pseudotuberculosis serotype I (strain IP32953) GN=pcm PE=3 SV=1 11 210 3.0E-18
sp|A4TQ01|PIMT_YERPP Protein-L-isoaspartate O-methyltransferase OS=Yersinia pestis (strain Pestoides F) GN=pcm PE=3 SV=1 11 210 3.0E-18
sp|Q1CLR2|PIMT_YERPN Protein-L-isoaspartate O-methyltransferase OS=Yersinia pestis bv. Antiqua (strain Nepal516) GN=pcm PE=3 SV=1 11 210 3.0E-18
sp|A9R115|PIMT_YERPG Protein-L-isoaspartate O-methyltransferase OS=Yersinia pestis bv. Antiqua (strain Angola) GN=pcm PE=3 SV=1 11 210 3.0E-18
sp|Q8ZBQ0|PIMT_YERPE Protein-L-isoaspartate O-methyltransferase OS=Yersinia pestis GN=pcm PE=3 SV=1 11 210 3.0E-18
sp|B2K581|PIMT_YERPB Protein-L-isoaspartate O-methyltransferase OS=Yersinia pseudotuberculosis serotype IB (strain PB1/+) GN=pcm PE=3 SV=1 11 210 3.0E-18
sp|Q1C474|PIMT_YERPA Protein-L-isoaspartate O-methyltransferase OS=Yersinia pestis bv. Antiqua (strain Antiqua) GN=pcm PE=3 SV=1 11 210 3.0E-18
sp|A7FLX4|PIMT_YERP3 Protein-L-isoaspartate O-methyltransferase OS=Yersinia pseudotuberculosis serotype O:1b (strain IP 31758) GN=pcm PE=3 SV=1 11 210 3.0E-18
sp|A8G9Z6|PIMT_SERP5 Protein-L-isoaspartate O-methyltransferase OS=Serratia proteamaculans (strain 568) GN=pcm PE=3 SV=1 11 210 4.0E-18
sp|B8DJP7|PIMT_DESVM Protein-L-isoaspartate O-methyltransferase OS=Desulfovibrio vulgaris (strain Miyazaki F / DSM 19637) GN=pcm PE=3 SV=1 7 210 4.0E-18
sp|Q6LMT7|PIMT_PHOPR Protein-L-isoaspartate O-methyltransferase OS=Photobacterium profundum GN=pcm PE=3 SV=1 1 210 5.0E-18
sp|Q3KH83|PIMT_PSEPF Protein-L-isoaspartate O-methyltransferase OS=Pseudomonas fluorescens (strain Pf0-1) GN=pcm PE=3 SV=2 30 213 8.0E-18
sp|A5G6S0|PIMT3_GEOUR Protein-L-isoaspartate O-methyltransferase 3 OS=Geobacter uraniireducens (strain Rf4) GN=pcm3 PE=3 SV=1 11 210 9.0E-18
sp|A1TZ54|PIMT1_MARHV Protein-L-isoaspartate O-methyltransferase 1 OS=Marinobacter hydrocarbonoclasticus (strain ATCC 700491 / DSM 11845 / VT8) GN=pcm1 PE=3 SV=1 2 209 1.0E-17
sp|A9BH07|PIMT_PETMO Protein-L-isoaspartate O-methyltransferase OS=Petrotoga mobilis (strain DSM 10674 / SJ95) GN=pcm PE=3 SV=1 7 209 1.0E-17
sp|B3ELJ9|PIMT_CHLPB Protein-L-isoaspartate O-methyltransferase OS=Chlorobium phaeobacteroides (strain BS1) GN=pcm PE=3 SV=1 3 209 1.0E-17
sp|Q1MRE5|PIMT_LAWIP Protein-L-isoaspartate O-methyltransferase OS=Lawsonia intracellularis (strain PHE/MN1-00) GN=pcm PE=3 SV=1 7 177 1.0E-17
sp|Q2RTH7|PIMT_RHORT Protein-L-isoaspartate O-methyltransferase OS=Rhodospirillum rubrum (strain ATCC 11170 / ATH 1.1.1 / DSM 467 / LMG 4362 / NCIB 8255 / S1) GN=pcm PE=3 SV=1 1 211 1.0E-17
sp|Q2L008|PIMT_BORA1 Protein-L-isoaspartate O-methyltransferase OS=Bordetella avium (strain 197N) GN=pcm PE=3 SV=1 7 209 2.0E-17
sp|Q7MHQ8|PIMT_VIBVY Protein-L-isoaspartate O-methyltransferase OS=Vibrio vulnificus (strain YJ016) GN=pcm PE=3 SV=1 7 209 2.0E-17
sp|Q8DC56|PIMT_VIBVU Protein-L-isoaspartate O-methyltransferase OS=Vibrio vulnificus (strain CMCP6) GN=pcm PE=3 SV=1 7 209 2.0E-17
sp|Q2LUT4|PIMT_SYNAS Protein-L-isoaspartate O-methyltransferase OS=Syntrophus aciditrophicus (strain SB) GN=pcm PE=3 SV=1 7 209 2.0E-17
sp|Q9YDA1|PIMT_AERPE Protein-L-isoaspartate O-methyltransferase OS=Aeropyrum pernix (strain ATCC 700893 / DSM 11879 / JCM 9820 / NBRC 100138 / K1) GN=pcm PE=3 SV=2 3 209 2.0E-17
sp|B8J9E3|PIMT_ANAD2 Protein-L-isoaspartate O-methyltransferase OS=Anaeromyxobacter dehalogenans (strain 2CP-1 / ATCC BAA-258) GN=pcm PE=3 SV=1 11 213 3.0E-17
sp|Q0W2W0|PIMT_METAR Protein-L-isoaspartate O-methyltransferase OS=Methanocella arvoryzae (strain DSM 22066 / NBRC 105507 / MRE50) GN=pcm PE=3 SV=1 19 209 3.0E-17
sp|Q9A6T6|PIMT_CAUCR Protein-L-isoaspartate O-methyltransferase OS=Caulobacter crescentus (strain ATCC 19089 / CB15) GN=pcm PE=3 SV=1 7 209 3.0E-17
sp|B8GX51|PIMT_CAUCN Protein-L-isoaspartate O-methyltransferase OS=Caulobacter crescentus (strain NA1000 / CB15N) GN=pcm PE=3 SV=1 7 209 3.0E-17
sp|B8CJQ2|PIMT_SHEPW Protein-L-isoaspartate O-methyltransferase OS=Shewanella piezotolerans (strain WP3 / JCM 13877) GN=pcm PE=3 SV=1 1 211 4.0E-17
sp|C6A3F2|PIMT_THESM Protein-L-isoaspartate O-methyltransferase OS=Thermococcus sibiricus (strain MM 739 / DSM 12597) GN=pcm PE=3 SV=1 3 210 4.0E-17
sp|Q3A4N4|PIMT_PELCD Protein-L-isoaspartate O-methyltransferase OS=Pelobacter carbinolicus (strain DSM 2380 / Gra Bd 1) GN=pcm PE=3 SV=1 7 210 4.0E-17
sp|B0TK10|PIMT_SHEHH Protein-L-isoaspartate O-methyltransferase OS=Shewanella halifaxensis (strain HAW-EB4) GN=pcm PE=3 SV=1 11 211 5.0E-17
sp|Q74CZ5|PIMT_GEOSL Protein-L-isoaspartate O-methyltransferase OS=Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA) GN=pcm PE=3 SV=2 7 210 5.0E-17
sp|Q47D25|PIMT_DECAR Protein-L-isoaspartate O-methyltransferase OS=Dechloromonas aromatica (strain RCB) GN=pcm PE=3 SV=1 12 209 7.0E-17
sp|Q0A7L5|PIMT_ALKEH Protein-L-isoaspartate O-methyltransferase OS=Alkalilimnicola ehrlichii (strain ATCC BAA-1101 / DSM 17681 / MLHE-1) GN=pcm PE=3 SV=1 7 209 7.0E-17
sp|A5GEF7|PIMT1_GEOUR Protein-L-isoaspartate O-methyltransferase 1 OS=Geobacter uraniireducens (strain Rf4) GN=pcm1 PE=3 SV=1 7 212 7.0E-17
sp|B1XQE1|PIMT_SYNP2 Protein-L-isoaspartate O-methyltransferase OS=Synechococcus sp. (strain ATCC 27264 / PCC 7002 / PR-6) GN=pcm PE=3 SV=1 7 209 7.0E-17
sp|O59534|PIMT_PYRHO Protein-L-isoaspartate O-methyltransferase OS=Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3) GN=pcm PE=3 SV=2 4 210 8.0E-17
sp|Q2FRW3|PIMT_METHJ Protein-L-isoaspartate O-methyltransferase OS=Methanospirillum hungatei JF-1 (strain ATCC 27890 / DSM 864 / NBRC 100397 / JF-1) GN=pcm PE=3 SV=1 7 209 9.0E-17
sp|Q6NCU3|PIMT_RHOPA Protein-L-isoaspartate O-methyltransferase OS=Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009) GN=pcm PE=3 SV=2 10 212 1.0E-16
sp|A5G4S7|PIMT2_GEOUR Protein-L-isoaspartate O-methyltransferase 2 OS=Geobacter uraniireducens (strain Rf4) GN=pcm2 PE=3 SV=1 7 209 1.0E-16
sp|B3EEX3|PIMT_CHLL2 Protein-L-isoaspartate O-methyltransferase OS=Chlorobium limicola (strain DSM 245 / NBRC 103803) GN=pcm PE=3 SV=1 3 209 2.0E-16
sp|Q1QU77|PIMT_CHRSD Protein-L-isoaspartate O-methyltransferase OS=Chromohalobacter salexigens (strain DSM 3043 / ATCC BAA-138 / NCIMB 13768) GN=pcm PE=3 SV=1 30 211 2.0E-16
sp|A4WDU8|PIMT_ENT38 Protein-L-isoaspartate O-methyltransferase OS=Enterobacter sp. (strain 638) GN=pcm PE=3 SV=1 7 210 2.0E-16
sp|B5XV38|PIMT_KLEP3 Protein-L-isoaspartate O-methyltransferase OS=Klebsiella pneumoniae (strain 342) GN=pcm PE=3 SV=1 7 210 2.0E-16
sp|B7VK62|PIMT_VIBTL Protein-L-isoaspartate O-methyltransferase OS=Vibrio tasmaniensis (strain LGP32) GN=pcm PE=3 SV=1 7 210 2.0E-16
sp|B0T1Q1|PIMT_CAUSK Protein-L-isoaspartate O-methyltransferase OS=Caulobacter sp. (strain K31) GN=pcm PE=3 SV=1 7 211 3.0E-16
sp|A7MJ61|PIMT_CROS8 Protein-L-isoaspartate O-methyltransferase OS=Cronobacter sakazakii (strain ATCC BAA-894) GN=pcm PE=3 SV=1 7 210 3.0E-16
sp|A6TD35|PIMT_KLEP7 Protein-L-isoaspartate O-methyltransferase OS=Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578) GN=pcm PE=3 SV=1 7 210 3.0E-16
sp|A8FX24|PIMT2_SHESH Protein-L-isoaspartate O-methyltransferase 2 OS=Shewanella sediminis (strain HAW-EB3) GN=pcm2 PE=3 SV=1 7 210 3.0E-16
sp|Q7N8K3|PIMT_PHOLL Protein-L-isoaspartate O-methyltransferase OS=Photorhabdus luminescens subsp. laumondii (strain TT01) GN=pcm PE=3 SV=1 7 211 4.0E-16
sp|Q8ZMF9|PIMT_SALTY Protein-L-isoaspartate O-methyltransferase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=pcm PE=3 SV=1 7 210 4.0E-16
sp|C0PXA3|PIMT_SALPC Protein-L-isoaspartate O-methyltransferase OS=Salmonella paratyphi C (strain RKS4594) GN=pcm PE=3 SV=1 7 210 4.0E-16
sp|A9N1H6|PIMT_SALPB Protein-L-isoaspartate O-methyltransferase OS=Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7) GN=pcm PE=3 SV=2 7 210 4.0E-16
sp|B4T453|PIMT_SALNS Protein-L-isoaspartate O-methyltransferase OS=Salmonella newport (strain SL254) GN=pcm PE=3 SV=1 7 210 4.0E-16
sp|B4TFW3|PIMT_SALHS Protein-L-isoaspartate O-methyltransferase OS=Salmonella heidelberg (strain SL476) GN=pcm PE=3 SV=1 7 210 4.0E-16
sp|B5RDP9|PIMT_SALG2 Protein-L-isoaspartate O-methyltransferase OS=Salmonella gallinarum (strain 287/91 / NCTC 13346) GN=pcm PE=3 SV=1 7 210 4.0E-16
sp|B5QW14|PIMT_SALEP Protein-L-isoaspartate O-methyltransferase OS=Salmonella enteritidis PT4 (strain P125109) GN=pcm PE=3 SV=1 7 210 4.0E-16
sp|B5FTS1|PIMT_SALDC Protein-L-isoaspartate O-methyltransferase OS=Salmonella dublin (strain CT_02021853) GN=pcm PE=3 SV=1 7 210 4.0E-16
sp|Q57KJ8|PIMT_SALCH Protein-L-isoaspartate O-methyltransferase OS=Salmonella choleraesuis (strain SC-B67) GN=pcm PE=3 SV=1 7 210 4.0E-16
sp|B5F407|PIMT_SALA4 Protein-L-isoaspartate O-methyltransferase OS=Salmonella agona (strain SL483) GN=pcm PE=3 SV=1 7 210 4.0E-16
sp|A2SF76|PIMT_METPP Protein-L-isoaspartate O-methyltransferase OS=Methylibium petroleiphilum (strain PM1) GN=pcm PE=3 SV=1 11 209 5.0E-16
sp|Q7W671|PIMT_BORPA Protein-L-isoaspartate O-methyltransferase OS=Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253) GN=pcm PE=3 SV=1 7 209 5.0E-16
sp|Q7WI37|PIMT_BORBR Protein-L-isoaspartate O-methyltransferase OS=Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50) GN=pcm PE=3 SV=2 7 209 5.0E-16
sp|Q8Z474|PIMT_SALTI Protein-L-isoaspartate O-methyltransferase OS=Salmonella typhi GN=pcm PE=3 SV=1 12 210 6.0E-16
sp|B4TTV7|PIMT_SALSV Protein-L-isoaspartate O-methyltransferase OS=Salmonella schwarzengrund (strain CVM19633) GN=pcm PE=3 SV=1 12 210 6.0E-16
sp|B5BEY0|PIMT_SALPK Protein-L-isoaspartate O-methyltransferase OS=Salmonella paratyphi A (strain AKU_12601) GN=pcm PE=3 SV=1 12 210 6.0E-16
sp|Q5PEE9|PIMT_SALPA Protein-L-isoaspartate O-methyltransferase OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=pcm PE=3 SV=1 12 210 6.0E-16
sp|A7HC32|PIMT1_ANADF Protein-L-isoaspartate O-methyltransferase 1 OS=Anaeromyxobacter sp. (strain Fw109-5) GN=pcm1 PE=3 SV=1 7 212 6.0E-16
sp|A9MF32|PIMT_SALAR Protein-L-isoaspartate O-methyltransferase OS=Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980) GN=pcm PE=3 SV=1 7 210 7.0E-16
sp|A3CXP8|PIMT_METMJ Protein-L-isoaspartate O-methyltransferase OS=Methanoculleus marisnigri (strain ATCC 35101 / DSM 1498 / JR1) GN=pcm PE=3 SV=1 11 209 8.0E-16
sp|A9AUP1|PIMT_HERA2 Protein-L-isoaspartate O-methyltransferase OS=Herpetosiphon aurantiacus (strain ATCC 23779 / DSM 785) GN=pcm PE=3 SV=1 11 212 9.0E-16
sp|Q9UXX0|PIMT_PYRAB Protein-L-isoaspartate O-methyltransferase OS=Pyrococcus abyssi (strain GE5 / Orsay) GN=pcm PE=3 SV=2 3 210 1.0E-15
sp|Q07N42|PIMT_RHOP5 Protein-L-isoaspartate O-methyltransferase OS=Rhodopseudomonas palustris (strain BisA53) GN=pcm PE=3 SV=1 1 208 1.0E-15
sp|Q2JJN4|PIMT_SYNJB Protein-L-isoaspartate O-methyltransferase OS=Synechococcus sp. (strain JA-2-3B'a(2-13)) GN=pcm PE=3 SV=1 7 210 1.0E-15
sp|B3PJA8|PIMT_CELJU Protein-L-isoaspartate O-methyltransferase OS=Cellvibrio japonicus (strain Ueda107) GN=pcm PE=3 SV=1 7 209 1.0E-15
sp|B9KQZ1|PIMT_RHOSK Protein-L-isoaspartate O-methyltransferase OS=Rhodobacter sphaeroides (strain KD131 / KCTC 12085) GN=pcm PE=3 SV=1 7 211 2.0E-15
sp|Q3J3D1|PIMT_RHOS4 Protein-L-isoaspartate O-methyltransferase OS=Rhodobacter sphaeroides (strain ATCC 17023 / 2.4.1 / NCIB 8253 / DSM 158) GN=pcm PE=3 SV=1 7 211 2.0E-15
sp|A3PIZ8|PIMT_RHOS1 Protein-L-isoaspartate O-methyltransferase OS=Rhodobacter sphaeroides (strain ATCC 17029 / ATH 2.4.9) GN=pcm PE=3 SV=1 7 211 2.0E-15
sp|B6YX51|PIMT_THEON Protein-L-isoaspartate O-methyltransferase OS=Thermococcus onnurineus (strain NA1) GN=pcm PE=3 SV=1 3 210 2.0E-15
sp|Q3B1L6|PIMT_CHLL7 Protein-L-isoaspartate O-methyltransferase OS=Chlorobium luteolum (strain DSM 273 / 2530) GN=pcm PE=3 SV=1 3 174 2.0E-15
sp|Q8TZR3|PIMT_PYRFU Protein-L-isoaspartate O-methyltransferase OS=Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1) GN=pcm PE=1 SV=2 4 209 3.0E-15
sp|B2VG25|PIMT_ERWT9 Protein-L-isoaspartate O-methyltransferase OS=Erwinia tasmaniensis (strain DSM 17950 / Et1/99) GN=pcm PE=3 SV=1 7 210 3.0E-15
sp|B6EKL2|PIMT_ALISL Protein-L-isoaspartate O-methyltransferase OS=Aliivibrio salmonicida (strain LFI1238) GN=pcm PE=3 SV=1 7 210 4.0E-15
sp|Q30ZM2|PIMT_DESAG Protein-L-isoaspartate O-methyltransferase OS=Desulfovibrio alaskensis (strain G20) GN=pcm PE=3 SV=1 7 210 4.0E-15
sp|P56133|PIMT_HELPY Protein-L-isoaspartate O-methyltransferase OS=Helicobacter pylori (strain ATCC 700392 / 26695) GN=pcm PE=3 SV=1 10 211 5.0E-15
sp|B6JMT1|PIMT_HELP2 Protein-L-isoaspartate O-methyltransferase OS=Helicobacter pylori (strain P12) GN=pcm PE=3 SV=1 10 211 7.0E-15
sp|Q8Y039|PIMT_RALSO Protein-L-isoaspartate O-methyltransferase OS=Ralstonia solanacearum (strain GMI1000) GN=pcm PE=3 SV=1 7 209 7.0E-15
sp|Q5LQ09|PIMT_RUEPO Protein-L-isoaspartate O-methyltransferase OS=Ruegeria pomeroyi (strain ATCC 700808 / DSM 15171 / DSS-3) GN=pcm PE=3 SV=1 7 211 7.0E-15
sp|A1B5M0|PIMT_PARDP Protein-L-isoaspartate O-methyltransferase OS=Paracoccus denitrificans (strain Pd 1222) GN=pcm PE=3 SV=1 7 211 7.0E-15
sp|A7INP1|PIMT_XANP2 Protein-L-isoaspartate O-methyltransferase OS=Xanthobacter autotrophicus (strain ATCC BAA-1158 / Py2) GN=pcm PE=3 SV=1 15 209 7.0E-15
sp|B7NT87|PIMT_ECO7I Protein-L-isoaspartate O-methyltransferase OS=Escherichia coli O7:K1 (strain IAI39 / ExPEC) GN=pcm PE=3 SV=1 7 210 8.0E-15
sp|Q0T1H4|PIMT_SHIF8 Protein-L-isoaspartate O-methyltransferase OS=Shigella flexneri serotype 5b (strain 8401) GN=pcm PE=3 SV=1 7 210 8.0E-15
sp|Q32CI7|PIMT_SHIDS Protein-L-isoaspartate O-methyltransferase OS=Shigella dysenteriae serotype 1 (strain Sd197) GN=pcm PE=3 SV=1 7 210 8.0E-15
sp|Q31XA5|PIMT_SHIBS Protein-L-isoaspartate O-methyltransferase OS=Shigella boydii serotype 4 (strain Sb227) GN=pcm PE=3 SV=1 7 210 8.0E-15
sp|B2TZI8|PIMT_SHIB3 Protein-L-isoaspartate O-methyltransferase OS=Shigella boydii serotype 18 (strain CDC 3083-94 / BS512) GN=pcm PE=3 SV=1 7 210 8.0E-15
sp|B1LQ63|PIMT_ECOSM Protein-L-isoaspartate O-methyltransferase OS=Escherichia coli (strain SMS-3-5 / SECEC) GN=pcm PE=3 SV=1 7 210 8.0E-15
sp|B6I6D3|PIMT_ECOSE Protein-L-isoaspartate O-methyltransferase OS=Escherichia coli (strain SE11) GN=pcm PE=3 SV=1 7 210 8.0E-15
sp|B7N6X3|PIMT_ECOLU Protein-L-isoaspartate O-methyltransferase OS=Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC) GN=pcm PE=3 SV=1 7 210 8.0E-15
sp|P0A7A5|PIMT_ECOLI Protein-L-isoaspartate O-methyltransferase OS=Escherichia coli (strain K12) GN=pcm PE=1 SV=2 7 210 8.0E-15
sp|B1IUT6|PIMT_ECOLC Protein-L-isoaspartate O-methyltransferase OS=Escherichia coli (strain ATCC 8739 / DSM 1576 / Crooks) GN=pcm PE=3 SV=1 7 210 8.0E-15
sp|A8A3M2|PIMT_ECOHS Protein-L-isoaspartate O-methyltransferase OS=Escherichia coli O9:H4 (strain HS) GN=pcm PE=3 SV=1 7 210 8.0E-15
sp|B1XCR9|PIMT_ECODH Protein-L-isoaspartate O-methyltransferase OS=Escherichia coli (strain K12 / DH10B) GN=pcm PE=3 SV=1 7 210 8.0E-15
sp|C4ZZP7|PIMT_ECOBW Protein-L-isoaspartate O-methyltransferase OS=Escherichia coli (strain K12 / MC4100 / BW2952) GN=pcm PE=3 SV=1 7 210 8.0E-15
sp|B7LXF5|PIMT_ECO8A Protein-L-isoaspartate O-methyltransferase OS=Escherichia coli O8 (strain IAI1) GN=pcm PE=3 SV=1 7 210 8.0E-15
sp|B5Z3A5|PIMT_ECO5E Protein-L-isoaspartate O-methyltransferase OS=Escherichia coli O157:H7 (strain EC4115 / EHEC) GN=pcm PE=3 SV=1 7 210 8.0E-15
sp|P0A7A6|PIMT_ECO57 Protein-L-isoaspartate O-methyltransferase OS=Escherichia coli O157:H7 GN=pcm PE=3 SV=2 7 210 8.0E-15
sp|B7LEG1|PIMT_ECO55 Protein-L-isoaspartate O-methyltransferase OS=Escherichia coli (strain 55989 / EAEC) GN=pcm PE=3 SV=1 7 210 8.0E-15
sp|B7UHG2|PIMT_ECO27 Protein-L-isoaspartate O-methyltransferase OS=Escherichia coli O127:H6 (strain E2348/69 / EPEC) GN=pcm PE=3 SV=1 7 210 8.0E-15
sp|A7ZQI7|PIMT_ECO24 Protein-L-isoaspartate O-methyltransferase OS=Escherichia coli O139:H28 (strain E24377A / ETEC) GN=pcm PE=3 SV=1 7 210 8.0E-15
sp|Q3YYB9|PIMT_SHISS Protein-L-isoaspartate O-methyltransferase OS=Shigella sonnei (strain Ss046) GN=pcm PE=3 SV=1 7 210 8.0E-15
sp|Q2W4A2|PIMT_MAGSA Protein-L-isoaspartate O-methyltransferase OS=Magnetospirillum magneticum (strain AMB-1 / ATCC 700264) GN=pcm PE=3 SV=1 1 211 9.0E-15
sp|B7LWJ2|PIMT_ESCF3 Protein-L-isoaspartate O-methyltransferase OS=Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CDC 0568-73) GN=pcm PE=3 SV=1 7 210 1.0E-14
sp|A1ASL8|PIMT1_PELPD Protein-L-isoaspartate O-methyltransferase 1 OS=Pelobacter propionicus (strain DSM 2379) GN=pcm1 PE=3 SV=1 7 209 1.0E-14
sp|A5CYQ6|PIMT_PELTS Protein-L-isoaspartate O-methyltransferase OS=Pelotomaculum thermopropionicum (strain DSM 13744 / JCM 10971 / SI) GN=pcm PE=3 SV=1 19 210 1.0E-14
sp|A9IP04|PIMT_BORPD Protein-L-isoaspartate O-methyltransferase OS=Bordetella petrii (strain ATCC BAA-461 / DSM 12804 / CCUG 43448) GN=pcm PE=3 SV=1 7 209 1.0E-14
sp|Q1H095|PIMT_METFK Protein-L-isoaspartate O-methyltransferase OS=Methylobacillus flagellatus (strain KT / ATCC 51484 / DSM 6875) GN=pcm PE=3 SV=1 12 214 1.0E-14
sp|Q1R7U8|PIMT_ECOUT Protein-L-isoaspartate O-methyltransferase OS=Escherichia coli (strain UTI89 / UPEC) GN=pcm PE=3 SV=1 12 210 1.0E-14
sp|Q8FEJ8|PIMT_ECOL6 Protein-L-isoaspartate O-methyltransferase OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=pcm PE=3 SV=3 12 210 1.0E-14
sp|A1AET7|PIMT_ECOK1 Protein-L-isoaspartate O-methyltransferase OS=Escherichia coli O1:K1 / APEC GN=pcm PE=3 SV=1 12 210 1.0E-14
sp|B7MZ44|PIMT_ECO81 Protein-L-isoaspartate O-methyltransferase OS=Escherichia coli O81 (strain ED1a) GN=pcm PE=3 SV=1 12 210 1.0E-14
sp|B7MKL7|PIMT_ECO45 Protein-L-isoaspartate O-methyltransferase OS=Escherichia coli O45:K1 (strain S88 / ExPEC) GN=pcm PE=3 SV=1 12 210 1.0E-14
sp|A7I4W9|PIMT_METB6 Protein-L-isoaspartate O-methyltransferase OS=Methanoregula boonei (strain 6A8) GN=pcm PE=3 SV=1 7 209 1.0E-14
sp|Q5GYL2|PIMT_XANOR Protein-L-isoaspartate O-methyltransferase OS=Xanthomonas oryzae pv. oryzae (strain KACC10331 / KXO85) GN=pcm PE=3 SV=1 15 209 1.0E-14
sp|B2SUB3|PIMT_XANOP Protein-L-isoaspartate O-methyltransferase OS=Xanthomonas oryzae pv. oryzae (strain PXO99A) GN=pcm PE=3 SV=1 15 209 1.0E-14
sp|Q2P1L5|PIMT_XANOM Protein-L-isoaspartate O-methyltransferase OS=Xanthomonas oryzae pv. oryzae (strain MAFF 311018) GN=pcm PE=3 SV=1 15 209 1.0E-14
sp|Q163U2|PIMT_ROSDO Protein-L-isoaspartate O-methyltransferase OS=Roseobacter denitrificans (strain ATCC 33942 / OCh 114) GN=pcm PE=3 SV=1 7 211 1.0E-14
sp|B4F223|PIMT_PROMH Protein-L-isoaspartate O-methyltransferase OS=Proteus mirabilis (strain HI4320) GN=pcm PE=3 SV=1 3 209 2.0E-14
sp|Q3BUS3|PIMT_XANC5 Protein-L-isoaspartate O-methyltransferase OS=Xanthomonas campestris pv. vesicatoria (strain 85-10) GN=pcm PE=3 SV=1 15 209 2.0E-14
sp|Q83JY3|PIMT_SHIFL Protein-L-isoaspartate O-methyltransferase OS=Shigella flexneri GN=pcm PE=3 SV=3 7 210 2.0E-14
sp|C6BTT9|PIMT_DESAD Protein-L-isoaspartate O-methyltransferase OS=Desulfovibrio salexigens (strain ATCC 14822 / DSM 2638 / NCIB 8403 / VKM B-1763) GN=pcm PE=3 SV=1 15 210 2.0E-14
sp|Q8PLR3|PIMT_XANAC Protein-L-isoaspartate O-methyltransferase OS=Xanthomonas axonopodis pv. citri (strain 306) GN=pcm PE=3 SV=1 15 209 2.0E-14
sp|A1WWY5|PIMT_HALHL Protein-L-isoaspartate O-methyltransferase OS=Halorhodospira halophila (strain DSM 244 / SL1) GN=pcm PE=3 SV=1 7 211 2.0E-14
sp|Q8P9Y6|PIMT_XANCP Protein-L-isoaspartate O-methyltransferase OS=Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25) GN=pcm PE=3 SV=1 15 209 2.0E-14
sp|B0RTZ8|PIMT_XANCB Protein-L-isoaspartate O-methyltransferase OS=Xanthomonas campestris pv. campestris (strain B100) GN=pcm PE=3 SV=1 15 209 2.0E-14
sp|Q4UTP9|PIMT_XANC8 Protein-L-isoaspartate O-methyltransferase OS=Xanthomonas campestris pv. campestris (strain 8004) GN=pcm PE=3 SV=1 15 209 2.0E-14
sp|Q1GFP1|PIMT_RUEST Protein-L-isoaspartate O-methyltransferase OS=Ruegeria sp. (strain TM1040) GN=pcm PE=3 SV=1 7 211 2.0E-14
sp|Q9ZKC2|PIMT_HELPJ Protein-L-isoaspartate O-methyltransferase OS=Helicobacter pylori (strain J99 / ATCC 700824) GN=pcm PE=3 SV=1 10 211 3.0E-14
sp|A8ANV7|PIMT_CITK8 Protein-L-isoaspartate O-methyltransferase OS=Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696) GN=pcm PE=3 SV=1 7 210 3.0E-14
sp|A4WU05|PIMT_RHOS5 Protein-L-isoaspartate O-methyltransferase OS=Rhodobacter sphaeroides (strain ATCC 17025 / ATH 2.4.3) GN=pcm PE=3 SV=1 7 215 3.0E-14
sp|A4YV66|PIMT_BRASO Protein-L-isoaspartate O-methyltransferase OS=Bradyrhizobium sp. (strain ORS278) GN=pcm PE=3 SV=1 1 208 4.0E-14
sp|A7HHV3|PIMT2_ANADF Protein-L-isoaspartate O-methyltransferase 2 OS=Anaeromyxobacter sp. (strain Fw109-5) GN=pcm2 PE=3 SV=2 11 209 4.0E-14
sp|B1L6T9|PIMT_KORCO Protein-L-isoaspartate O-methyltransferase OS=Korarchaeum cryptofilum (strain OPF8) GN=pcm PE=3 SV=1 1 209 6.0E-14
sp|A1U4P7|PIMT2_MARHV Protein-L-isoaspartate O-methyltransferase 2 OS=Marinobacter hydrocarbonoclasticus (strain ATCC 700491 / DSM 11845 / VT8) GN=pcm2 PE=3 SV=1 7 209 6.0E-14
sp|A9VY77|PIMT_METEP Protein-L-isoaspartate O-methyltransferase OS=Methylobacterium extorquens (strain PA1) GN=pcm PE=3 SV=1 15 209 8.0E-14
sp|Q136H9|PIMT_RHOPS Protein-L-isoaspartate O-methyltransferase OS=Rhodopseudomonas palustris (strain BisB5) GN=pcm PE=3 SV=1 12 208 9.0E-14
sp|B4SFU3|PIMT_PELPB Protein-L-isoaspartate O-methyltransferase OS=Pelodictyon phaeoclathratiforme (strain DSM 5477 / BU-1) GN=pcm PE=3 SV=1 3 210 1.0E-13
sp|B4SR93|PIMT_STRM5 Protein-L-isoaspartate O-methyltransferase OS=Stenotrophomonas maltophilia (strain R551-3) GN=pcm PE=3 SV=1 15 209 1.0E-13
sp|Q8KFW8|PIMT_CHLTE Protein-L-isoaspartate O-methyltransferase OS=Chlorobium tepidum (strain ATCC 49652 / DSM 12025 / NBRC 103806 / TLS) GN=pcm PE=3 SV=1 3 210 1.0E-13
sp|Q3IDD2|PIMT_PSEHT Protein-L-isoaspartate O-methyltransferase OS=Pseudoalteromonas haloplanktis (strain TAC 125) GN=pcm PE=3 SV=1 30 210 1.0E-13
sp|Q0K951|PIMT2_CUPNH Protein-L-isoaspartate O-methyltransferase 2 OS=Cupriavidus necator (strain ATCC 17699 / H16 / DSM 428 / Stanier 337) GN=pcm2 PE=3 SV=1 11 209 2.0E-13
sp|B6ISM3|PIMT_RHOCS Protein-L-isoaspartate O-methyltransferase OS=Rhodospirillum centenum (strain ATCC 51521 / SW) GN=pcm PE=3 SV=1 15 209 3.0E-13
sp|A4SGH4|PIMT_CHLPM Protein-L-isoaspartate O-methyltransferase OS=Chlorobium phaeovibrioides (strain DSM 265 / 1930) GN=pcm PE=3 SV=1 3 210 4.0E-13
sp|Q11TS0|PIMT_CYTH3 Protein-L-isoaspartate O-methyltransferase OS=Cytophaga hutchinsonii (strain ATCC 33406 / NCIMB 9469) GN=pcm PE=3 SV=1 12 210 4.0E-13
sp|Q12A85|PIMT1_POLSJ Protein-L-isoaspartate O-methyltransferase 1 OS=Polaromonas sp. (strain JS666 / ATCC BAA-500) GN=pcm1 PE=3 SV=1 7 212 5.0E-13
sp|B2FK95|PIMT_STRMK Protein-L-isoaspartate O-methyltransferase OS=Stenotrophomonas maltophilia (strain K279a) GN=pcm PE=3 SV=1 15 209 5.0E-13
sp|A8LQK6|PIMT_DINSH Protein-L-isoaspartate O-methyltransferase OS=Dinoroseobacter shibae (strain DSM 16493 / NCIMB 14021 / DFL 12) GN=pcm PE=3 SV=1 12 211 6.0E-13
sp|A8ZXR8|PIMT_DESOH Protein-L-isoaspartate O-methyltransferase OS=Desulfococcus oleovorans (strain DSM 6200 / Hxd3) GN=pcm PE=3 SV=1 7 209 9.0E-13
sp|A8I4G3|PIMT_AZOC5 Protein-L-isoaspartate O-methyltransferase OS=Azorhizobium caulinodans (strain ATCC 43989 / DSM 5975 / JCM 20966 / NBRC 14845 / NCIMB 13405 / ORS 571) GN=pcm PE=3 SV=2 15 210 1.0E-12
sp|Q3JCZ3|PIMT1_NITOC Protein-L-isoaspartate O-methyltransferase 1 OS=Nitrosococcus oceani (strain ATCC 19707 / NCIMB 11848) GN=pcm1 PE=3 SV=1 7 209 1.0E-12
sp|A5EJV5|PIMT_BRASB Protein-L-isoaspartate O-methyltransferase OS=Bradyrhizobium sp. (strain BTAi1 / ATCC BAA-1182) GN=pcm PE=3 SV=1 1 208 1.0E-12
sp|B3QQM1|PIMT_CHLP8 Protein-L-isoaspartate O-methyltransferase OS=Chlorobaculum parvum (strain NCIB 8327) GN=pcm PE=3 SV=1 3 174 2.0E-12
sp|A4JEQ0|PIMT_BURVG Protein-L-isoaspartate O-methyltransferase OS=Burkholderia vietnamiensis (strain G4 / LMG 22486) GN=pcm PE=3 SV=1 7 209 2.0E-12
sp|Q46ZH2|PIMT_CUPPJ Protein-L-isoaspartate O-methyltransferase OS=Cupriavidus pinatubonensis (strain JMP 134 / LMG 1197) GN=pcm PE=3 SV=1 11 211 2.0E-12
sp|Q2IWH1|PIMT2_RHOP2 Protein-L-isoaspartate O-methyltransferase 2 OS=Rhodopseudomonas palustris (strain HaA2) GN=pcm2 PE=3 SV=1 12 208 2.0E-12
sp|A0LL58|PIMT1_SYNFM Protein-L-isoaspartate O-methyltransferase 1 OS=Syntrophobacter fumaroxidans (strain DSM 10017 / MPOB) GN=pcm1 PE=3 SV=1 11 210 2.0E-12
sp|Q3SKJ2|PIMT_THIDA Protein-L-isoaspartate O-methyltransferase OS=Thiobacillus denitrificans (strain ATCC 25259) GN=pcm PE=3 SV=1 12 209 2.0E-12
sp|A1BDC1|PIMT_CHLPD Protein-L-isoaspartate O-methyltransferase OS=Chlorobium phaeobacteroides (strain DSM 266) GN=pcm PE=3 SV=1 7 209 2.0E-12
sp|Q9PF21|PIMT_XYLFA Protein-L-isoaspartate O-methyltransferase OS=Xylella fastidiosa (strain 9a5c) GN=pcm PE=3 SV=1 28 209 3.0E-12
sp|B0U4U6|PIMT_XYLFM Protein-L-isoaspartate O-methyltransferase OS=Xylella fastidiosa (strain M12) GN=pcm PE=3 SV=1 28 209 4.0E-12
sp|Q87AK5|PIMT_XYLFT Protein-L-isoaspartate O-methyltransferase OS=Xylella fastidiosa (strain Temecula1 / ATCC 700964) GN=pcm PE=3 SV=1 28 209 4.0E-12
sp|B2I8X8|PIMT_XYLF2 Protein-L-isoaspartate O-methyltransferase OS=Xylella fastidiosa (strain M23) GN=pcm PE=3 SV=1 28 209 4.0E-12
sp|A0L4K5|PIMT_MAGMM Protein-L-isoaspartate O-methyltransferase OS=Magnetococcus marinus (strain ATCC BAA-1437 / JCM 17883 / MC-1) GN=pcm PE=3 SV=1 7 210 5.0E-12
sp|B2JG67|PIMT_BURP8 Protein-L-isoaspartate O-methyltransferase OS=Burkholderia phymatum (strain DSM 17167 / STM815) GN=pcm PE=3 SV=1 7 209 6.0E-12
sp|Q0VQD1|PIMT_ALCBS Protein-L-isoaspartate O-methyltransferase OS=Alcanivorax borkumensis (strain ATCC 700651 / DSM 11573 / NCIMB 13689 / SK2) GN=pcm PE=3 SV=1 7 209 7.0E-12
sp|B8J017|PIMT_DESDA Protein-L-isoaspartate O-methyltransferase OS=Desulfovibrio desulfuricans (strain ATCC 27774 / DSM 6949) GN=pcm PE=3 SV=1 7 192 9.0E-12
sp|Q63UU3|PIMT_BURPS Protein-L-isoaspartate O-methyltransferase OS=Burkholderia pseudomallei (strain K96243) GN=pcm PE=3 SV=1 7 211 1.0E-11
sp|Q3JRP1|PIMT_BURP1 Protein-L-isoaspartate O-methyltransferase OS=Burkholderia pseudomallei (strain 1710b) GN=pcm PE=3 SV=1 7 211 1.0E-11
sp|A3NVY1|PIMT_BURP0 Protein-L-isoaspartate O-methyltransferase OS=Burkholderia pseudomallei (strain 1106a) GN=pcm PE=3 SV=1 7 211 1.0E-11
sp|A3NA64|PIMT_BURP6 Protein-L-isoaspartate O-methyltransferase OS=Burkholderia pseudomallei (strain 668) GN=pcm PE=3 SV=1 7 211 1.0E-11
sp|A5UZW2|PIMT_ROSS1 Protein-L-isoaspartate O-methyltransferase OS=Roseiflexus sp. (strain RS-1) GN=pcm PE=3 SV=1 11 209 1.0E-11
sp|A1V4L2|PIMT_BURMS Protein-L-isoaspartate O-methyltransferase OS=Burkholderia mallei (strain SAVP1) GN=pcm PE=3 SV=1 7 211 1.0E-11
sp|Q62JV3|PIMT_BURMA Protein-L-isoaspartate O-methyltransferase OS=Burkholderia mallei (strain ATCC 23344) GN=pcm PE=3 SV=1 7 211 1.0E-11
sp|A2S291|PIMT_BURM9 Protein-L-isoaspartate O-methyltransferase OS=Burkholderia mallei (strain NCTC 10229) GN=pcm PE=3 SV=1 7 211 1.0E-11
sp|A3MK86|PIMT_BURM7 Protein-L-isoaspartate O-methyltransferase OS=Burkholderia mallei (strain NCTC 10247) GN=pcm PE=3 SV=2 7 211 1.0E-11
sp|Q2SWF4|PIMT_BURTA Protein-L-isoaspartate O-methyltransferase OS=Burkholderia thailandensis (strain E264 / ATCC 700388 / DSM 13276 / CIP 106301) GN=pcm PE=3 SV=1 7 211 2.0E-11
sp|A6H0V1|PIMT_FLAPJ Protein-L-isoaspartate O-methyltransferase OS=Flavobacterium psychrophilum (strain JIP02/86 / ATCC 49511) GN=pcm PE=3 SV=1 7 214 2.0E-11
sp|Q3SRQ7|PIMT_NITWN Protein-L-isoaspartate O-methyltransferase OS=Nitrobacter winogradskyi (strain Nb-255 / ATCC 25391) GN=pcm PE=3 SV=1 1 208 2.0E-11
sp|A4G4J3|PIMT_HERAR Protein-L-isoaspartate O-methyltransferase OS=Herminiimonas arsenicoxydans GN=pcm PE=3 SV=1 7 209 2.0E-11
sp|A0LZ51|PIMT_GRAFK Protein-L-isoaspartate O-methyltransferase OS=Gramella forsetii (strain KT0803) GN=pcm PE=3 SV=1 7 214 3.0E-11
sp|A6X6Y1|PIMT_OCHA4 Protein-L-isoaspartate O-methyltransferase OS=Ochrobactrum anthropi (strain ATCC 49188 / DSM 6882 / NCTC 12168) GN=pcm PE=3 SV=1 31 209 4.0E-11
sp|Q2S176|PIMT_SALRD Protein-L-isoaspartate O-methyltransferase OS=Salinibacter ruber (strain DSM 13855 / M31) GN=pcm PE=3 SV=1 11 211 4.0E-11
sp|Q0BEV7|PIMT_BURCM Protein-L-isoaspartate O-methyltransferase OS=Burkholderia ambifaria (strain ATCC BAA-244 / AMMD) GN=pcm PE=3 SV=1 7 209 4.0E-11
sp|B1YRE4|PIMT_BURA4 Protein-L-isoaspartate O-methyltransferase OS=Burkholderia ambifaria (strain MC40-6) GN=pcm PE=3 SV=1 7 209 6.0E-11
sp|Q39FP9|PIMT_BURL3 Protein-L-isoaspartate O-methyltransferase OS=Burkholderia lata (strain ATCC 17760 / LMG 22485 / NCIMB 9086 / R18194 / 383) GN=pcm PE=3 SV=1 7 211 7.0E-11
sp|B1ZJW1|PIMT_METPB Protein-L-isoaspartate O-methyltransferase OS=Methylobacterium populi (strain ATCC BAA-705 / NCIMB 13946 / BJ001) GN=pcm PE=3 SV=1 19 209 1.0E-10
sp|B1JTA2|PIMT_BURCC Protein-L-isoaspartate O-methyltransferase OS=Burkholderia cenocepacia (strain MC0-3) GN=pcm PE=3 SV=1 7 211 2.0E-10
sp|A6SZX9|PIMT_JANMA Protein-L-isoaspartate O-methyltransferase OS=Janthinobacterium sp. (strain Marseille) GN=pcm PE=3 SV=1 11 209 2.0E-10
sp|A0K7U6|PIMT_BURCH Protein-L-isoaspartate O-methyltransferase OS=Burkholderia cenocepacia (strain HI2424) GN=pcm PE=3 SV=1 7 211 2.0E-10
sp|Q1BGY4|PIMT_BURCA Protein-L-isoaspartate O-methyltransferase OS=Burkholderia cenocepacia (strain AU 1054) GN=pcm PE=3 SV=1 7 211 2.0E-10
sp|B1Y0T0|PIMT_LEPCP Protein-L-isoaspartate O-methyltransferase OS=Leptothrix cholodnii (strain ATCC 51168 / LMG 8142 / SP-6) GN=pcm PE=3 SV=1 15 209 4.0E-10
sp|Q56308|PIMT_THEMA Protein-L-isoaspartate O-methyltransferase OS=Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099) GN=pcm PE=1 SV=1 24 175 7.0E-10
sp|A1K4F0|PIMT_AZOSB Protein-L-isoaspartate O-methyltransferase OS=Azoarcus sp. (strain BH72) GN=pcm PE=3 SV=2 28 209 3.0E-09
sp|A5FEA5|PIMT_FLAJ1 Protein-L-isoaspartate O-methyltransferase OS=Flavobacterium johnsoniae (strain ATCC 17061 / DSM 2064 / UW101) GN=pcm PE=3 SV=1 7 214 6.0E-09
sp|Q1INS6|PIMT_KORVE Protein-L-isoaspartate O-methyltransferase OS=Koribacter versatilis (strain Ellin345) GN=pcm PE=3 SV=1 11 209 9.0E-09
sp|Q0ADP2|PIMT_NITEC Protein-L-isoaspartate O-methyltransferase OS=Nitrosomonas eutropha (strain C91) GN=pcm PE=3 SV=1 12 209 1.0E-08
sp|Q28TH8|PIMT_JANSC Protein-L-isoaspartate O-methyltransferase OS=Jannaschia sp. (strain CCS1) GN=pcm PE=3 SV=1 2 211 2.0E-08
sp|Q82VW0|PIMT_NITEU Protein-L-isoaspartate O-methyltransferase OS=Nitrosomonas europaea (strain ATCC 19718 / NBRC 14298) GN=pcm PE=3 SV=1 12 209 3.0E-08
sp|Q2YBR7|PIMT2_NITMU Protein-L-isoaspartate O-methyltransferase 2 OS=Nitrosospira multiformis (strain ATCC 25196 / NCIMB 11849) GN=pcm2 PE=3 SV=1 7 209 4.0E-08
sp|A2VDP2|PCMD1_BOVIN Protein-L-isoaspartate O-methyltransferase domain-containing protein 1 OS=Bos taurus GN=PCMTD1 PE=2 SV=1 7 210 6.0E-07
sp|Q5P833|PIMT_AROAE Protein-L-isoaspartate O-methyltransferase OS=Aromatoleum aromaticum (strain EbN1) GN=pcm PE=3 SV=1 28 209 4.0E-06
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|3189
MWRHGLITQPRVRAAFEAVDRAHYAPSALRAYEDAPQSIGHGATISAPHMHAAAAEHLVGFLLPDGAARVLDVGS
GSGYLTHVLAELVGSGGRVVGLEHIDALRDLGEANMRRSDRGRELLDKGSVEFVLGDGRMGWEEQGGKWDVIHVG
AAAKEVHPQLLAQLKAPGCIFIPVDDDEDGTSQHIWRIEQDKEGKLSKKQLFGVRYVPLTDAPNT*
Coding >OphauB2|3189
ATGTGGCGCCACGGCCTCATCACCCAGCCTCGCGTCCGCGCTGCCTTTGAAGCCGTTGACCGCGCCCACTATGCC
CCCAGCGCCCTGCGCGCCTACGAAGACGCGCCGCAGAGCATTGGCCACGGCGCCACCATTTCGGCGCCGCACATG
CACGCCGCCGCAGCCGAGCACCTCGTAGGCTTCTTGCTGCCCGACGGCGCGGCGCGGGTCCTCGACGTGGGCTCG
GGCAGCGGATACCTGACGCACGTGCTGGCGGAGCTGGTGGGCAGTGGAGGCAGGGTGGTTGGGCTGGAGCACATA
GACGCGCTGCGGGACCTGGGCGAGGCGAATATGCGGCGCAGCGATAGGGGGAGGGAATTGCTGGACAAGGGGAGC
GTTGAGTTTGTGCTTGGAGATGGGAGGATGGGATGGGAGGAGCAAGGGGGGAAGTGGGATGTCATTCACGTTGGG
GCGGCGGCCAAGGAGGTGCATCCGCAGTTGCTGGCGCAGCTCAAGGCGCCGGGATGCATCTTTATACCCGTGGAT
GACGATGAGGATGGCACTTCGCAGCACATTTGGCGCATCGAACAGGACAAGGAGGGCAAGCTGTCCAAGAAGCAG
TTATTCGGAGTGCGCTATGTCCCTCTGACTGATGCTCCAAACACCTGA
Transcript >OphauB2|3189
ATGTGGCGCCACGGCCTCATCACCCAGCCTCGCGTCCGCGCTGCCTTTGAAGCCGTTGACCGCGCCCACTATGCC
CCCAGCGCCCTGCGCGCCTACGAAGACGCGCCGCAGAGCATTGGCCACGGCGCCACCATTTCGGCGCCGCACATG
CACGCCGCCGCAGCCGAGCACCTCGTAGGCTTCTTGCTGCCCGACGGCGCGGCGCGGGTCCTCGACGTGGGCTCG
GGCAGCGGATACCTGACGCACGTGCTGGCGGAGCTGGTGGGCAGTGGAGGCAGGGTGGTTGGGCTGGAGCACATA
GACGCGCTGCGGGACCTGGGCGAGGCGAATATGCGGCGCAGCGATAGGGGGAGGGAATTGCTGGACAAGGGGAGC
GTTGAGTTTGTGCTTGGAGATGGGAGGATGGGATGGGAGGAGCAAGGGGGGAAGTGGGATGTCATTCACGTTGGG
GCGGCGGCCAAGGAGGTGCATCCGCAGTTGCTGGCGCAGCTCAAGGCGCCGGGATGCATCTTTATACCCGTGGAT
GACGATGAGGATGGCACTTCGCAGCACATTTGGCGCATCGAACAGGACAAGGAGGGCAAGCTGTCCAAGAAGCAG
TTATTCGGAGTGCGCTATGTCCCTCTGACTGATGCTCCAAACACCTGA
Gene >OphauB2|3189
ATGTGGCGCCACGGCCTCATCACCCAGCCTCGCGTCCGCGCTGCCTTTGAAGCCGTTGACCGCGCCCACTATGCC
CCCAGCGCCCTGCGCGCCTACGAAGACGCGCCGCAGAGCATTGGCCACGGCGCCACCATTTCGGCGCCGCACATG
CACGCCGCCGCAGCCGAGCACCTCGTAGGCTTCTTGCTGCCCGACGGCGCGGCGCGGGTCCTCGACGTGGGCTCG
GGCAGCGGATACCTGACGCACGTGCTGGCGGAGCTGGTGGGCAGTGGAGGCAGGGTGGTTGGGCTGGAGCACATA
GACGCGCTGCGGGACCTGGGCGAGGCGAATATGCGGCGCAGCGATAGGGGGAGGGAATTGCTGGACAAGGGGAGC
GTTGAGTTTGTGCTTGGAGATGGGAGGATGGGATGGGAGGAGCAAGGGGGGAAGTGGGATGTCATTCACGTTGGG
GCGGCGGCCAAGGAGGTGCATCCGCAGTTGCTGGCGCAGCTCAAGGCGCCGGGATGGTGAGATTGCATTCTTGTT
TCTTGTCCCTCTTCTTTTTTGTTTCTTGTCCCTCTTCTTTTTTGTGGGAGGGGGGAGTTTTGAGGACACGTGCAG
CTTTGGCTAACTAGTGGTAGCATCTTTATACCCGTGGATGACGATGAGGATGGCACTTCGCAGCACATTTGGCGC
ATCGAACAGGACAAGGAGGGCAAGCTGTCCAAGAAGCAGTTATTCGGAGTGCGCTATGTCCCTCTGACTGATGCT
CCAAACACCTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail