Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|3188
Gene name
LocationContig_205:25303..26399
Strand+
Gene length (bp)1096
Transcript length (bp)984
Coding sequence length (bp)984
Protein length (aa) 328

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF10176 DUF2370 Protein of unknown function (DUF2370) 2.4E-87 104 310

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|P38356|BSD2_YEAST Metal homeostatis protein BSD2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=BSD2 PE=1 SV=1 116 305 6.0E-37
sp|Q9P3T9|BSD2_SCHPO Probable metal homeostasis protein bsd1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=bsd1 PE=3 SV=1 112 304 3.0E-28

GO

GO Term Description Terminal node
GO:0007034 vacuolar transport Yes
GO:0030001 metal ion transport Yes
GO:0046907 intracellular transport No
GO:0006811 ion transport No
GO:0009987 cellular process No
GO:0051179 localization No
GO:0008150 biological_process No
GO:0051649 establishment of localization in cell No
GO:0051234 establishment of localization No
GO:0006812 cation transport No
GO:0006810 transport No
GO:0051641 cellular localization No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 58 0.45

Transmembrane Domains

Domain # Start End Length
1 179 201 22
2 269 288 19

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|3188
MSGRYERVNERDDHDNDVSVHHAPRITSPTSPPPSFHSRSSSPTGHRRVDSTLADAFDSDEASDDEDDDRQRLVR
QNTITGSIPVGTGGAGEDADTSMSGASGSRPRQVGGGIGTDGVFANLSARPERTESEKEEQPPTYEQAAADAAPP
YWETTILAPGFGGLDEVYVDGMPVGSVFSFIWNGMISTSFQLVGFLLTYLLHSTHAAKNGSRAGLGVTLIQYGFY
MKGPNEDDPPVMSGPDGYAAPPDPNSHNFNPGEVTEGGGGDSSITGGDWIAWALMVVGWFILIKSMAEYLKARRH
EQLILQSPDRGLGVPIIAEGESAERVV*
Coding >OphauB2|3188
ATGTCGGGTCGCTATGAAAGGGTGAATGAGCGCGATGACCACGATAACGACGTCTCGGTCCATCATGCGCCCCGT
ATTACCTCGCCTACGTCGCCACCTCCTTCATTTCACTCGAGATCTTCGTCTCCCACTGGCCATCGACGCGTCGAC
TCTACCCTGGCAGATGCATTTGATAGCGATGAGGCAAGCGACGATGAAGATGATGACCGACAGCGCCTGGTTCGA
CAAAATACGATTACCGGCAGCATCCCAGTTGGGACTGGTGGTGCGGGCGAAGATGCAGACACGTCCATGTCTGGG
GCCTCTGGGTCGAGACCGAGGCAGGTAGGCGGAGGAATTGGAACAGACGGCGTCTTTGCAAACCTGTCAGCACGG
CCTGAGCGTACAGAGTCGGAAAAGGAGGAGCAGCCACCAACGTATGAACAGGCTGCAGCCGACGCTGCCCCACCC
TATTGGGAAACGACGATTCTGGCGCCTGGATTTGGCGGGTTAGACGAGGTTTACGTTGACGGCATGCCTGTGGGA
TCGGTCTTTTCCTTCATCTGGAACGGAATGATATCCACATCTTTCCAACTCGTGGGCTTTTTACTCACATACCTG
CTGCACTCGACACATGCAGCCAAGAATGGATCTCGGGCCGGGCTGGGTGTTACTCTCATTCAATACGGCTTCTAC
ATGAAGGGCCCTAATGAAGACGACCCGCCCGTCATGAGTGGTCCAGACGGGTATGCAGCGCCACCCGACCCCAAC
TCACACAATTTCAATCCAGGAGAAGTAACAGAGGGTGGGGGTGGAGACTCGTCAATAACGGGCGGCGACTGGATA
GCGTGGGCTCTCATGGTGGTGGGCTGGTTCATCTTGATCAAGAGCATGGCCGAGTACCTTAAGGCGCGTCGGCAC
GAGCAGTTGATTCTGCAGAGCCCCGACCGTGGGCTCGGCGTGCCTATTATTGCCGAGGGAGAGAGCGCCGAGAGA
GTGGTGTGA
Transcript >OphauB2|3188
ATGTCGGGTCGCTATGAAAGGGTGAATGAGCGCGATGACCACGATAACGACGTCTCGGTCCATCATGCGCCCCGT
ATTACCTCGCCTACGTCGCCACCTCCTTCATTTCACTCGAGATCTTCGTCTCCCACTGGCCATCGACGCGTCGAC
TCTACCCTGGCAGATGCATTTGATAGCGATGAGGCAAGCGACGATGAAGATGATGACCGACAGCGCCTGGTTCGA
CAAAATACGATTACCGGCAGCATCCCAGTTGGGACTGGTGGTGCGGGCGAAGATGCAGACACGTCCATGTCTGGG
GCCTCTGGGTCGAGACCGAGGCAGGTAGGCGGAGGAATTGGAACAGACGGCGTCTTTGCAAACCTGTCAGCACGG
CCTGAGCGTACAGAGTCGGAAAAGGAGGAGCAGCCACCAACGTATGAACAGGCTGCAGCCGACGCTGCCCCACCC
TATTGGGAAACGACGATTCTGGCGCCTGGATTTGGCGGGTTAGACGAGGTTTACGTTGACGGCATGCCTGTGGGA
TCGGTCTTTTCCTTCATCTGGAACGGAATGATATCCACATCTTTCCAACTCGTGGGCTTTTTACTCACATACCTG
CTGCACTCGACACATGCAGCCAAGAATGGATCTCGGGCCGGGCTGGGTGTTACTCTCATTCAATACGGCTTCTAC
ATGAAGGGCCCTAATGAAGACGACCCGCCCGTCATGAGTGGTCCAGACGGGTATGCAGCGCCACCCGACCCCAAC
TCACACAATTTCAATCCAGGAGAAGTAACAGAGGGTGGGGGTGGAGACTCGTCAATAACGGGCGGCGACTGGATA
GCGTGGGCTCTCATGGTGGTGGGCTGGTTCATCTTGATCAAGAGCATGGCCGAGTACCTTAAGGCGCGTCGGCAC
GAGCAGTTGATTCTGCAGAGCCCCGACCGTGGGCTCGGCGTGCCTATTATTGCCGAGGGAGAGAGCGCCGAGAGA
GTGGTGTGA
Gene >OphauB2|3188
ATGTCGGGTCGCTATGAAAGGGTACATGGAACCAAGCGCATTGTTGGCTTGATCACGCTGACACTGTGATTAGGT
GAATGAGCGCGATGACCACGATAACGACGTCTCGGTCCATCATGCGCCCCGTATTACCTCGCCTACGTCGCCACC
TCCTTCATTTCACTCGAGATCTTCGTCTCCCACTGGCCATCGACGCGTCGACTCTACCCTGGCAGATGCATTTGA
TAGCGATGAGGCAAGCGACGATGAAGATGATGACCGACAGCGCCTGGTTCGACAAAATACGATTACCGGCAGCAT
CCCAGTTGGGACTGGTGGTGCGGGCGAAGATGCAGACACGTCCATGTCTGGGGCCTCTGGGTCGAGACCGAGGCA
GGTAGGCGGAGGAATTGGAACAGACGGCGTCTTTGCAAACCTGTCAGCACGGCCTGAGCGTACAGAGTCGGAAAA
GGAGGAGCAGCCACCAGTAAGCAATGCATATTTATCAAGCAGAATTGTAAAACACGGCTAATTTGGAGGGCGGCA
GACGTATGAACAGGCTGCAGCCGACGCTGCCCCACCCTATTGGGAAACGACGATTCTGGCGCCTGGATTTGGCGG
GTTAGACGAGGTTTACGTTGACGGCATGCCTGTGGGATCGGTCTTTTCCTTCATCTGGAACGGAATGATATCCAC
ATCTTTCCAACTCGTGGGCTTTTTACTCACATACCTGCTGCACTCGACACATGCAGCCAAGAATGGATCTCGGGC
CGGGCTGGGTGTTACTCTCATTCAATACGGCTTCTACATGAAGGGCCCTAATGAAGACGACCCGCCCGTCATGAG
TGGTCCAGACGGGTATGCAGCGCCACCCGACCCCAACTCACACAATTTCAATCCAGGAGAAGTAACAGAGGGTGG
GGGTGGAGACTCGTCAATAACGGGCGGCGACTGGATAGCGTGGGCTCTCATGGTGGTGGGCTGGTTCATCTTGAT
CAAGAGCATGGCCGAGTACCTTAAGGCGCGTCGGCACGAGCAGTTGATTCTGCAGAGCCCCGACCGTGGGCTCGG
CGTGCCTATTATTGCCGAGGGAGAGAGCGCCGAGAGAGTGGTGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail