Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|3175
Gene name
LocationContig_204:23676..24142
Strand-
Gene length (bp)466
Transcript length (bp)264
Coding sequence length (bp)264
Protein length (aa) 88

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|P0C5R9|YP17B_YEAST Uncharacterized protein YPR170W-B OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YPR170W-B PE=3 SV=1 1 87 2.0E-21
sp|P0C5R7|YP169_YEAST Putative uncharacterized protein YPR169W-A OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YPR169W-A PE=5 SV=1 1 57 3.0E-12

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 29 0.5

Transmembrane Domains

Domain # Start End Length
1 9 31 22
2 54 76 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|3175
MKPVVSAKNAWACTVVSVYAVFILGAIALLYRNDHEQFVGGRDDVEDGKAASNVIFAAVIVYAAFLVFCGFQGLL
HVREKRRGAISL*
Coding >OphauB2|3175
ATGAAGCCCGTTGTCAGTGCCAAGAATGCGTGGGCATGCACCGTTGTCTCGGTATACGCCGTCTTCATCCTCGGC
GCCATCGCGTTGCTCTACCGCAATGATCACGAACAGTTTGTTGGCGGCCGCGACGACGTGGAGGACGGCAAGGCA
GCTTCCAACGTCATCTTTGCCGCAGTCATTGTTTACGCCGCCTTTTTAGTCTTTTGTGGCTTCCAGGGCCTCCTT
CACGTGCGCGAGAAACGAAGAGGTGCCATCTCCTTGTGA
Transcript >OphauB2|3175
ATGAAGCCCGTTGTCAGTGCCAAGAATGCGTGGGCATGCACCGTTGTCTCGGTATACGCCGTCTTCATCCTCGGC
GCCATCGCGTTGCTCTACCGCAATGATCACGAACAGTTTGTTGGCGGCCGCGACGACGTGGAGGACGGCAAGGCA
GCTTCCAACGTCATCTTTGCCGCAGTCATTGTTTACGCCGCCTTTTTAGTCTTTTGTGGCTTCCAGGGCCTCCTT
CACGTGCGCGAGAAACGAAGAGGTGCCATCTCCTTGTGA
Gene >OphauB2|3175
ATGAAGCCCGTTGTCAGTGCCAAGAATGCGTGGGCATGGTGCGTCGGACGCTCAAGACGCCAAGTGATGCCAAGT
CGTGATGCTTACAATAATGGCAGCACCGTTGTCTCGGTATACGCCGTCTTCATCCTCGGCGCCATCGCGTTGCTC
TACCGCAATGATCACGAACAGTTTGTTGGCGGCCGCGACGACGTGGAGGACGGCAAGGCAGCTTCCAACGTCATC
TTTGCCGCAGTCATTGTTTACGCCGTATGCCTCTCCTTGCCCATGCCAGCTCAGCTGCCTCGAAAACCTTGCCCT
TTTTGGACAGCTCTTGACTCGAAGAAAATTTGCCTCTTGTTTTGAATTTCTTTCTCGTCGTACCATGGCTGACTT
GGCTCTGCCCTTGTAGGCCTTTTTAGTCTTTTGTGGCTTCCAGGGCCTCCTTCACGTGCGCGAGAAACGAAGAGG
TGCCATCTCCTTGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail