Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|3173
Gene name
LocationContig_204:16650..18945
Strand+
Gene length (bp)2295
Transcript length (bp)2211
Coding sequence length (bp)2211
Protein length (aa) 737

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF06011 TRP Transient receptor potential (TRP) ion channel 6.4E-136 155 606
PF14558 TRP_N ML-like domain 3.0E-38 12 149

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P39719|FLC2_YEAST Flavin carrier protein 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=FLC2 PE=1 SV=2 7 698 2.0E-41
sp|P53121|FLC3_YEAST Putative flavin carrier protein 3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=FLC3 PE=1 SV=1 20 732 2.0E-36
sp|Q08967|FLC1_YEAST Flavin carrier protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=FLC1 PE=1 SV=1 2 602 1.0E-34
sp|Q08844|YO365_YEAST Uncharacterized membrane protein YOR365C OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YOR365C PE=1 SV=1 10 614 3.0E-29
sp|Q09917|PKD2_SCHPO TRP-like ion channel pkd2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pkd2 PE=1 SV=1 12 578 1.0E-28
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P39719|FLC2_YEAST Flavin carrier protein 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=FLC2 PE=1 SV=2 7 698 2.0E-41
sp|P53121|FLC3_YEAST Putative flavin carrier protein 3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=FLC3 PE=1 SV=1 20 732 2.0E-36
sp|Q08967|FLC1_YEAST Flavin carrier protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=FLC1 PE=1 SV=1 2 602 1.0E-34
sp|Q08844|YO365_YEAST Uncharacterized membrane protein YOR365C OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YOR365C PE=1 SV=1 10 614 3.0E-29
sp|Q09917|PKD2_SCHPO TRP-like ion channel pkd2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pkd2 PE=1 SV=1 12 578 1.0E-28
sp|O74520|YCPE_SCHPO Uncharacterized membrane protein C663.14c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC663.14c PE=3 SV=2 12 584 1.0E-20
[Show less]

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

Domain # Start End Length
1 334 356 22
2 376 398 22
3 413 435 22
4 471 492 21
5 496 518 22
6 525 547 22
7 562 584 22

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup1291
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|6719
Ophiocordyceps australis map64 (Brazil) OphauB2|3173 (this protein)
Ophiocordyceps camponoti-floridani Ophcf2|07162
Ophiocordyceps camponoti-rufipedis Ophun1|6183
Ophiocordyceps kimflemingae Ophio5|7283
Ophiocordyceps subramaniannii Hirsu2|10591

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|3173
MLALPVSAADILKTDGFNDCGSDSSIKVDKVDIIYDKDHKTVDFDVAGSSTKEQNVTAELKVTAYGTVVYTNSFN
PCDQGNFVERLCPVPKGDFAAKGSRGIPSQFADMVPAIAFQVPDIAAQATLELKSLDNNAKVACIQSQVSNGKTA
NVPVVGYVVASFVGVAVIGAGISSAATAFSGGASGAAGSPSPSPSETCTWIQAVAMTGMSTVNYPLVCRKFFANV
GFAVGIISWEDLQRFIDNVRAKTGGDLTEDSVEYLHNATLVFPDNSTTNSHQGTLRLKRGLDAFASLVARQATTD
KSDPTSVTFQHAVKGIQAYAEQLAVPKSNVFMTALLVVAIAIAAIVVGILLVKVVLEFWALFGSFPKSLAGFRKH
YWGSIARTITSLILVLYGIWVLYCIYQFTHGDSWAAKTLAGVTLAIFTAVLGFFTYKIWSIARRLKHDAGDASGL
YYDKDTWVKYSLFYEAYKKDYWWLFIPAIVYMFAKGCALALGDGHGMIQSIAQLAIETIMLVLLLWSRPYERKSG
NVINIVIAVVRVLSIVCVLVFVEEFGIKQTTQTVAGVVLIVIQSALTGILAILIIWNAVNACCKVNPHRQRRKEL
EKDKRESDLLTPLDARNSLLRSHSRTGALTPAFSVTSDYKEKSVRRANSPERYFPEYLDMGRQSPPSGGQVYLSQ
SPPMSSEATHRLVDSAAPIAGGGMYEPNIPNAGYNYGRPAGQGFGVGNGPGRGHRRTNNLL*
Coding >OphauB2|3173
ATGCTGGCTCTGCCAGTCTCGGCGGCCGATATTCTCAAGACGGACGGCTTCAATGATTGCGGCTCCGACTCGAGC
ATCAAGGTGGACAAGGTGGACATTATCTACGACAAGGACCACAAGACTGTCGACTTTGATGTGGCTGGGTCGAGC
ACCAAGGAACAAAATGTCACGGCGGAGCTCAAGGTGACAGCCTACGGCACCGTGGTCTACACCAACAGCTTCAAC
CCTTGCGACCAGGGCAATTTTGTCGAGCGCCTATGCCCCGTGCCCAAGGGCGACTTTGCCGCCAAGGGCAGCCGT
GGAATCCCGTCGCAGTTTGCCGACATGGTGCCAGCTATTGCCTTTCAAGTCCCCGACATTGCGGCTCAGGCGACG
CTGGAGCTCAAGAGCCTCGACAACAATGCCAAGGTTGCCTGCATCCAGTCGCAAGTGTCGAATGGCAAGACGGCC
AATGTGCCCGTTGTCGGCTACGTTGTGGCCAGCTTTGTTGGAGTGGCCGTGATTGGCGCCGGCATCTCGTCAGCT
GCTACCGCCTTTTCGGGGGGAGCAAGCGGCGCCGCTGGCAGCCCCAGCCCCAGCCCTTCGGAGACGTGTACCTGG
ATCCAGGCCGTGGCCATGACGGGCATGTCTACGGTCAATTATCCCCTTGTCTGCCGCAAGTTTTTTGCAAATGTT
GGCTTTGCCGTGGGCATCATCTCGTGGGAGGACTTGCAGAGGTTTATTGACAATGTTCGCGCCAAGACGGGCGGC
GATTTGACCGAGGACAGTGTCGAATATCTCCATAACGCTACCCTGGTTTTCCCCGACAACTCAACCACCAACTCG
CACCAAGGCACTTTGAGGCTCAAACGAGGCCTCGATGCTTTTGCGTCTCTGGTTGCTCGCCAAGCCACTACCGAC
AAGTCGGACCCAACGTCGGTGACGTTTCAACACGCCGTCAAGGGCATTCAGGCTTATGCCGAGCAGCTAGCGGTG
CCAAAGTCCAATGTCTTTATGACGGCGCTGCTGGTTGTGGCGATTGCTATTGCAGCCATTGTTGTTGGCATTCTG
CTTGTCAAGGTGGTGCTTGAGTTTTGGGCCCTTTTTGGCAGCTTTCCCAAGTCTCTGGCCGGCTTCCGCAAGCAC
TATTGGGGCTCGATTGCACGCACCATTACGTCGCTCATTCTTGTGCTCTATGGCATTTGGGTCCTCTACTGCATT
TATCAATTCACCCACGGCGACTCGTGGGCAGCCAAGACGCTTGCCGGCGTGACTCTGGCCATTTTCACTGCTGTG
CTGGGCTTCTTCACCTACAAGATATGGAGCATTGCTCGGCGCCTCAAGCACGACGCGGGCGACGCCAGTGGCCTC
TATTACGACAAGGACACTTGGGTCAAGTACTCGCTCTTTTATGAAGCCTATAAAAAGGACTATTGGTGGCTCTTT
ATCCCAGCCATTGTCTACATGTTTGCCAAGGGCTGTGCCTTGGCCCTTGGCGACGGACACGGCATGATTCAGTCG
ATTGCCCAGCTTGCTATTGAGACTATTATGCTCGTTTTGTTGCTTTGGAGCCGCCCGTATGAGCGCAAGTCGGGC
AATGTCATCAATATTGTTATTGCCGTTGTCCGCGTCTTGTCCATTGTCTGCGTGCTGGTGTTTGTGGAGGAATTT
GGCATTAAGCAGACGACGCAGACTGTCGCGGGCGTGGTTCTCATTGTTATCCAGTCCGCCTTGACGGGCATTTTG
GCCATTCTTATTATTTGGAATGCCGTTAATGCTTGCTGCAAGGTGAATCCTCACCGCCAGCGCAGAAAGGAACTT
GAAAAAGACAAGAGAGAGTCGGATCTCTTGACGCCTTTGGATGCGCGAAACTCGCTTCTTCGCAGCCACAGCCGC
ACAGGCGCCCTGACGCCTGCTTTTTCAGTCACGTCGGACTACAAGGAAAAGTCTGTCCGTCGTGCCAACTCTCCC
GAGCGCTACTTTCCCGAATACTTGGACATGGGCCGCCAGTCGCCGCCGTCTGGTGGCCAAGTATACTTGTCGCAG
TCGCCGCCCATGTCGAGCGAGGCGACGCATAGGCTGGTTGACTCTGCTGCTCCTATTGCTGGAGGCGGCATGTAC
GAGCCCAATATACCAAACGCTGGATACAACTATGGAAGACCGGCTGGCCAAGGCTTTGGCGTTGGCAATGGGCCT
GGCCGGGGTCACCGGCGAACAAACAATCTACTTTGA
Transcript >OphauB2|3173
ATGCTGGCTCTGCCAGTCTCGGCGGCCGATATTCTCAAGACGGACGGCTTCAATGATTGCGGCTCCGACTCGAGC
ATCAAGGTGGACAAGGTGGACATTATCTACGACAAGGACCACAAGACTGTCGACTTTGATGTGGCTGGGTCGAGC
ACCAAGGAACAAAATGTCACGGCGGAGCTCAAGGTGACAGCCTACGGCACCGTGGTCTACACCAACAGCTTCAAC
CCTTGCGACCAGGGCAATTTTGTCGAGCGCCTATGCCCCGTGCCCAAGGGCGACTTTGCCGCCAAGGGCAGCCGT
GGAATCCCGTCGCAGTTTGCCGACATGGTGCCAGCTATTGCCTTTCAAGTCCCCGACATTGCGGCTCAGGCGACG
CTGGAGCTCAAGAGCCTCGACAACAATGCCAAGGTTGCCTGCATCCAGTCGCAAGTGTCGAATGGCAAGACGGCC
AATGTGCCCGTTGTCGGCTACGTTGTGGCCAGCTTTGTTGGAGTGGCCGTGATTGGCGCCGGCATCTCGTCAGCT
GCTACCGCCTTTTCGGGGGGAGCAAGCGGCGCCGCTGGCAGCCCCAGCCCCAGCCCTTCGGAGACGTGTACCTGG
ATCCAGGCCGTGGCCATGACGGGCATGTCTACGGTCAATTATCCCCTTGTCTGCCGCAAGTTTTTTGCAAATGTT
GGCTTTGCCGTGGGCATCATCTCGTGGGAGGACTTGCAGAGGTTTATTGACAATGTTCGCGCCAAGACGGGCGGC
GATTTGACCGAGGACAGTGTCGAATATCTCCATAACGCTACCCTGGTTTTCCCCGACAACTCAACCACCAACTCG
CACCAAGGCACTTTGAGGCTCAAACGAGGCCTCGATGCTTTTGCGTCTCTGGTTGCTCGCCAAGCCACTACCGAC
AAGTCGGACCCAACGTCGGTGACGTTTCAACACGCCGTCAAGGGCATTCAGGCTTATGCCGAGCAGCTAGCGGTG
CCAAAGTCCAATGTCTTTATGACGGCGCTGCTGGTTGTGGCGATTGCTATTGCAGCCATTGTTGTTGGCATTCTG
CTTGTCAAGGTGGTGCTTGAGTTTTGGGCCCTTTTTGGCAGCTTTCCCAAGTCTCTGGCCGGCTTCCGCAAGCAC
TATTGGGGCTCGATTGCACGCACCATTACGTCGCTCATTCTTGTGCTCTATGGCATTTGGGTCCTCTACTGCATT
TATCAATTCACCCACGGCGACTCGTGGGCAGCCAAGACGCTTGCCGGCGTGACTCTGGCCATTTTCACTGCTGTG
CTGGGCTTCTTCACCTACAAGATATGGAGCATTGCTCGGCGCCTCAAGCACGACGCGGGCGACGCCAGTGGCCTC
TATTACGACAAGGACACTTGGGTCAAGTACTCGCTCTTTTATGAAGCCTATAAAAAGGACTATTGGTGGCTCTTT
ATCCCAGCCATTGTCTACATGTTTGCCAAGGGCTGTGCCTTGGCCCTTGGCGACGGACACGGCATGATTCAGTCG
ATTGCCCAGCTTGCTATTGAGACTATTATGCTCGTTTTGTTGCTTTGGAGCCGCCCGTATGAGCGCAAGTCGGGC
AATGTCATCAATATTGTTATTGCCGTTGTCCGCGTCTTGTCCATTGTCTGCGTGCTGGTGTTTGTGGAGGAATTT
GGCATTAAGCAGACGACGCAGACTGTCGCGGGCGTGGTTCTCATTGTTATCCAGTCCGCCTTGACGGGCATTTTG
GCCATTCTTATTATTTGGAATGCCGTTAATGCTTGCTGCAAGGTGAATCCTCACCGCCAGCGCAGAAAGGAACTT
GAAAAAGACAAGAGAGAGTCGGATCTCTTGACGCCTTTGGATGCGCGAAACTCGCTTCTTCGCAGCCACAGCCGC
ACAGGCGCCCTGACGCCTGCTTTTTCAGTCACGTCGGACTACAAGGAAAAGTCTGTCCGTCGTGCCAACTCTCCC
GAGCGCTACTTTCCCGAATACTTGGACATGGGCCGCCAGTCGCCGCCGTCTGGTGGCCAAGTATACTTGTCGCAG
TCGCCGCCCATGTCGAGCGAGGCGACGCATAGGCTGGTTGACTCTGCTGCTCCTATTGCTGGAGGCGGCATGTAC
GAGCCCAATATACCAAACGCTGGATACAACTATGGAAGACCGGCTGGCCAAGGCTTTGGCGTTGGCAATGGGCCT
GGCCGGGGTCACCGGCGAACAAACAATCTACTTTGA
Gene >OphauB2|3173
ATGCTGGCTCTGCCAGTCTCGGCGGCCGATATTCTCAAGACGGACGGCTTCAATGATTGCGGCTCCGACTCGAGC
ATCAAGGTGGACAAGGTGGACATTATCTACGACAAGGACCACAAGACTGTCGACTTTGATGTGGCTGGGTCGAGC
ACCAAGGAACAAAATGTCACGGCGGAGCTCAAGGTGACAGCCTACGGCACCGTGGTCTACACCAACAGCTTCAAC
CCTTGCGACCAGGGCAATTTTGTCGAGCGCCTATGCCCCGTGCCCAAGGGCGACTTTGCCGCCAAGGGCAGCCGT
GGAATCCCGTCGCAGTTTGCCGACATGGTGCCAGCTATTGCCTTTCAAGTCCCCGACATTGCGGCTCAGGCGACG
CTGGAGCTCAAGAGCCTCGACAACAATGCCAAGGTTGCCTGCATCCAGTCGCAAGTGTCGAATGGCAAGACGGCC
AATGTGCCCGTTGTCGGCTACGTTGTGGCCAGCTTTGTTGGAGTGGCCGTGATTGGCGCCGGCATCTCGTCAGCT
GCTACCGCCTTTTCGGGGGGAGCAAGCGGCGCCGCTGGCAGCCCCAGCCCCAGCCCTTCGGAGACGTGTACCTGG
ATCCAGGCCGTGGCCATGACGGGCATGTCTACGGTCAATTATCCCCTTGTCTGCCGCAAGTTTTTTGCAAATGTT
GGCTTTGCCGTGGGCATCATCTCGTGGGAGGACTTGCAGAGGTTTATTGACAATGTTCGCGCCAAGACGGGCGGC
GATTTGACCGAGGACAGTGTCGAATATCTCCATAACGCTACCCTGGTTTTCCCCGACAACTCAACCACCAACTCG
CACCAAGGCACTTTGAGGCTCAAACGAGGCCTCGATGCTTTTGCGTCTCTGGTTGCTCGCCAAGCCACTACCGAC
AAGTCGGACCCAACGTCGGTGACGTTTCAACACGCCGTCAAGGGCATTCAGGCTTATGCCGAGCAGCTAGCGGTG
CCAAAGTCCAATGTCTTTATGACGGCGCTGCTGGTTGTGGCGATTGCTATTGCAGCCATTGTTGTTGGCATTCTG
CTTGTCAAGGTGGTGCTTGAGTTTTGGGCCCTTTTTGGCAGCTTTCCCAAGTCTCTGGCCGGCTTCCGCAAGCAC
TATTGGGGCTCGATTGCACGCACCATTACGTCGCTCATTCTTGTGCTCTATGGCATTTGGGTCCTCTACTGCATT
TATCAATTCACCCACGGCGACTCGTGGGCAGCCAAGACGCTTGCCGGCGTGACTCTGGCCATTTTCACTGCTGTG
CTGGGCTTCTTCACCTACAAGATATGGAGCATTGCTCGGCGCCTCAAGCACGACGCGGGCGACGCCAGTGGCCTC
TATTACGACAAGGACACTTGGGTCAAGTACTCGCTCTTTTATGAAGCCTATAAAAAGGACTATTGGTGGCTCTTT
ATCCCAGCCATTGTCTACATGTTTGCCAAGGGCTGTGCCTTGGCCCTTGGCGACGGACACGGCATGATTCAGTCG
ATTGCCCAGCTTGCTATTGAGACTATTATGCTCGTTTTGTTGCTTTGGAGCCGCCCGTATGAGCGCAAGTCGGGC
AATGTCATCAATATTGTTATTGCCGTTGTCCGCGTCTTGTCCATTGTCTGCGTGCTGGTGTTTGTGGAGGAATTT
GGCATTAAGCAGACGACGCAGACTGTCGCGGGCGTGGTTCTCATTGTTATCCAGTCCGCCTTGACGGGCATTTTG
GCCATTCTTATTATTTGGAATGCCGTTAATGCTTGCTGCAAGGTGAATCCTCACCGCCAGCGCAGAAAGGAACTT
GGTAAGTTTTCTTCATGTTGCCCATGTTTTTTTTTTGTCTCTTTTGCTGTTTTGCACCGACTAATATAAAATGTT
GCAAATACAGAAAAAGACAAGAGAGAGTCGGATCTCTTGACGCCTTTGGATGCGCGAAACTCGCTTCTTCGCAGC
CACAGCCGCACAGGCGCCCTGACGCCTGCTTTTTCAGTCACGTCGGACTACAAGGAAAAGTCTGTCCGTCGTGCC
AACTCTCCCGAGCGCTACTTTCCCGAATACTTGGACATGGGCCGCCAGTCGCCGCCGTCTGGTGGCCAAGTATAC
TTGTCGCAGTCGCCGCCCATGTCGAGCGAGGCGACGCATAGGCTGGTTGACTCTGCTGCTCCTATTGCTGGAGGC
GGCATGTACGAGCCCAATATACCAAACGCTGGATACAACTATGGAAGACCGGCTGGCCAAGGCTTTGGCGTTGGC
AATGGGCCTGGCCGGGGTCACCGGCGAACAAACAATCTACTTTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail