Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|3173
Gene name
LocationContig_204:16650..18945
Strand+
Gene length (bp)2295
Transcript length (bp)2211
Coding sequence length (bp)2211
Protein length (aa) 737

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF06011 TRP Transient receptor potential (TRP) ion channel 6.4E-136 155 606
PF14558 TRP_N ML-like domain 3.0E-38 12 149

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P39719|FLC2_YEAST Flavin carrier protein 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=FLC2 PE=1 SV=2 7 698 2.0E-41
sp|P53121|FLC3_YEAST Putative flavin carrier protein 3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=FLC3 PE=1 SV=1 20 732 2.0E-36
sp|Q08967|FLC1_YEAST Flavin carrier protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=FLC1 PE=1 SV=1 2 602 1.0E-34
sp|Q08844|YO365_YEAST Uncharacterized membrane protein YOR365C OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YOR365C PE=1 SV=1 10 614 3.0E-29
sp|Q09917|PKD2_SCHPO TRP-like ion channel pkd2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pkd2 PE=1 SV=1 12 578 1.0E-28
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P39719|FLC2_YEAST Flavin carrier protein 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=FLC2 PE=1 SV=2 7 698 2.0E-41
sp|P53121|FLC3_YEAST Putative flavin carrier protein 3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=FLC3 PE=1 SV=1 20 732 2.0E-36
sp|Q08967|FLC1_YEAST Flavin carrier protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=FLC1 PE=1 SV=1 2 602 1.0E-34
sp|Q08844|YO365_YEAST Uncharacterized membrane protein YOR365C OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YOR365C PE=1 SV=1 10 614 3.0E-29
sp|Q09917|PKD2_SCHPO TRP-like ion channel pkd2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pkd2 PE=1 SV=1 12 578 1.0E-28
sp|O74520|YCPE_SCHPO Uncharacterized membrane protein C663.14c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC663.14c PE=3 SV=2 12 584 1.0E-20
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 17 0.45

Transmembrane Domains

Domain # Start End Length
1 334 356 22
2 376 398 22
3 413 435 22
4 471 492 21
5 496 518 22
6 525 547 22
7 562 584 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|3173
MLALPVSAADILKTDGFNDCGSDSSIKVDKVDIIYDKDHKTVDFDVAGSSTKEQNVTAELKVTAYGTVVYTNSFN
PCDQGNFVERLCPVPKGDFAAKGSRGIPSQFADMVPAIAFQVPDIAAQATLELKSLDNNAKVACIQSQVSNGKTA
NVPVVGYVVASFVGVAVIGAGISSAATAFSGGASGAAGSPSPSPSETCTWIQAVAMTGMSTVNYPLVCRKFFANV
GFAVGIISWEDLQRFIDNVRAKTGGDLTEDSVEYLHNATLVFPDNSTTNSHQGTLRLKRGLDAFASLVARQATTD
KSDPTSVTFQHAVKGIQAYAEQLAVPKSNVFMTALLVVAIAIAAIVVGILLVKVVLEFWALFGSFPKSLAGFRKH
YWGSIARTITSLILVLYGIWVLYCIYQFTHGDSWAAKTLAGVTLAIFTAVLGFFTYKIWSIARRLKHDAGDASGL
YYDKDTWVKYSLFYEAYKKDYWWLFIPAIVYMFAKGCALALGDGHGMIQSIAQLAIETIMLVLLLWSRPYERKSG
NVINIVIAVVRVLSIVCVLVFVEEFGIKQTTQTVAGVVLIVIQSALTGILAILIIWNAVNACCKVNPHRQRRKEL
EKDKRESDLLTPLDARNSLLRSHSRTGALTPAFSVTSDYKEKSVRRANSPERYFPEYLDMGRQSPPSGGQVYLSQ
SPPMSSEATHRLVDSAAPIAGGGMYEPNIPNAGYNYGRPAGQGFGVGNGPGRGHRRTNNLL*
Coding >OphauB2|3173
ATGCTGGCTCTGCCAGTCTCGGCGGCCGATATTCTCAAGACGGACGGCTTCAATGATTGCGGCTCCGACTCGAGC
ATCAAGGTGGACAAGGTGGACATTATCTACGACAAGGACCACAAGACTGTCGACTTTGATGTGGCTGGGTCGAGC
ACCAAGGAACAAAATGTCACGGCGGAGCTCAAGGTGACAGCCTACGGCACCGTGGTCTACACCAACAGCTTCAAC
CCTTGCGACCAGGGCAATTTTGTCGAGCGCCTATGCCCCGTGCCCAAGGGCGACTTTGCCGCCAAGGGCAGCCGT
GGAATCCCGTCGCAGTTTGCCGACATGGTGCCAGCTATTGCCTTTCAAGTCCCCGACATTGCGGCTCAGGCGACG
CTGGAGCTCAAGAGCCTCGACAACAATGCCAAGGTTGCCTGCATCCAGTCGCAAGTGTCGAATGGCAAGACGGCC
AATGTGCCCGTTGTCGGCTACGTTGTGGCCAGCTTTGTTGGAGTGGCCGTGATTGGCGCCGGCATCTCGTCAGCT
GCTACCGCCTTTTCGGGGGGAGCAAGCGGCGCCGCTGGCAGCCCCAGCCCCAGCCCTTCGGAGACGTGTACCTGG
ATCCAGGCCGTGGCCATGACGGGCATGTCTACGGTCAATTATCCCCTTGTCTGCCGCAAGTTTTTTGCAAATGTT
GGCTTTGCCGTGGGCATCATCTCGTGGGAGGACTTGCAGAGGTTTATTGACAATGTTCGCGCCAAGACGGGCGGC
GATTTGACCGAGGACAGTGTCGAATATCTCCATAACGCTACCCTGGTTTTCCCCGACAACTCAACCACCAACTCG
CACCAAGGCACTTTGAGGCTCAAACGAGGCCTCGATGCTTTTGCGTCTCTGGTTGCTCGCCAAGCCACTACCGAC
AAGTCGGACCCAACGTCGGTGACGTTTCAACACGCCGTCAAGGGCATTCAGGCTTATGCCGAGCAGCTAGCGGTG
CCAAAGTCCAATGTCTTTATGACGGCGCTGCTGGTTGTGGCGATTGCTATTGCAGCCATTGTTGTTGGCATTCTG
CTTGTCAAGGTGGTGCTTGAGTTTTGGGCCCTTTTTGGCAGCTTTCCCAAGTCTCTGGCCGGCTTCCGCAAGCAC
TATTGGGGCTCGATTGCACGCACCATTACGTCGCTCATTCTTGTGCTCTATGGCATTTGGGTCCTCTACTGCATT
TATCAATTCACCCACGGCGACTCGTGGGCAGCCAAGACGCTTGCCGGCGTGACTCTGGCCATTTTCACTGCTGTG
CTGGGCTTCTTCACCTACAAGATATGGAGCATTGCTCGGCGCCTCAAGCACGACGCGGGCGACGCCAGTGGCCTC
TATTACGACAAGGACACTTGGGTCAAGTACTCGCTCTTTTATGAAGCCTATAAAAAGGACTATTGGTGGCTCTTT
ATCCCAGCCATTGTCTACATGTTTGCCAAGGGCTGTGCCTTGGCCCTTGGCGACGGACACGGCATGATTCAGTCG
ATTGCCCAGCTTGCTATTGAGACTATTATGCTCGTTTTGTTGCTTTGGAGCCGCCCGTATGAGCGCAAGTCGGGC
AATGTCATCAATATTGTTATTGCCGTTGTCCGCGTCTTGTCCATTGTCTGCGTGCTGGTGTTTGTGGAGGAATTT
GGCATTAAGCAGACGACGCAGACTGTCGCGGGCGTGGTTCTCATTGTTATCCAGTCCGCCTTGACGGGCATTTTG
GCCATTCTTATTATTTGGAATGCCGTTAATGCTTGCTGCAAGGTGAATCCTCACCGCCAGCGCAGAAAGGAACTT
GAAAAAGACAAGAGAGAGTCGGATCTCTTGACGCCTTTGGATGCGCGAAACTCGCTTCTTCGCAGCCACAGCCGC
ACAGGCGCCCTGACGCCTGCTTTTTCAGTCACGTCGGACTACAAGGAAAAGTCTGTCCGTCGTGCCAACTCTCCC
GAGCGCTACTTTCCCGAATACTTGGACATGGGCCGCCAGTCGCCGCCGTCTGGTGGCCAAGTATACTTGTCGCAG
TCGCCGCCCATGTCGAGCGAGGCGACGCATAGGCTGGTTGACTCTGCTGCTCCTATTGCTGGAGGCGGCATGTAC
GAGCCCAATATACCAAACGCTGGATACAACTATGGAAGACCGGCTGGCCAAGGCTTTGGCGTTGGCAATGGGCCT
GGCCGGGGTCACCGGCGAACAAACAATCTACTTTGA
Transcript >OphauB2|3173
ATGCTGGCTCTGCCAGTCTCGGCGGCCGATATTCTCAAGACGGACGGCTTCAATGATTGCGGCTCCGACTCGAGC
ATCAAGGTGGACAAGGTGGACATTATCTACGACAAGGACCACAAGACTGTCGACTTTGATGTGGCTGGGTCGAGC
ACCAAGGAACAAAATGTCACGGCGGAGCTCAAGGTGACAGCCTACGGCACCGTGGTCTACACCAACAGCTTCAAC
CCTTGCGACCAGGGCAATTTTGTCGAGCGCCTATGCCCCGTGCCCAAGGGCGACTTTGCCGCCAAGGGCAGCCGT
GGAATCCCGTCGCAGTTTGCCGACATGGTGCCAGCTATTGCCTTTCAAGTCCCCGACATTGCGGCTCAGGCGACG
CTGGAGCTCAAGAGCCTCGACAACAATGCCAAGGTTGCCTGCATCCAGTCGCAAGTGTCGAATGGCAAGACGGCC
AATGTGCCCGTTGTCGGCTACGTTGTGGCCAGCTTTGTTGGAGTGGCCGTGATTGGCGCCGGCATCTCGTCAGCT
GCTACCGCCTTTTCGGGGGGAGCAAGCGGCGCCGCTGGCAGCCCCAGCCCCAGCCCTTCGGAGACGTGTACCTGG
ATCCAGGCCGTGGCCATGACGGGCATGTCTACGGTCAATTATCCCCTTGTCTGCCGCAAGTTTTTTGCAAATGTT
GGCTTTGCCGTGGGCATCATCTCGTGGGAGGACTTGCAGAGGTTTATTGACAATGTTCGCGCCAAGACGGGCGGC
GATTTGACCGAGGACAGTGTCGAATATCTCCATAACGCTACCCTGGTTTTCCCCGACAACTCAACCACCAACTCG
CACCAAGGCACTTTGAGGCTCAAACGAGGCCTCGATGCTTTTGCGTCTCTGGTTGCTCGCCAAGCCACTACCGAC
AAGTCGGACCCAACGTCGGTGACGTTTCAACACGCCGTCAAGGGCATTCAGGCTTATGCCGAGCAGCTAGCGGTG
CCAAAGTCCAATGTCTTTATGACGGCGCTGCTGGTTGTGGCGATTGCTATTGCAGCCATTGTTGTTGGCATTCTG
CTTGTCAAGGTGGTGCTTGAGTTTTGGGCCCTTTTTGGCAGCTTTCCCAAGTCTCTGGCCGGCTTCCGCAAGCAC
TATTGGGGCTCGATTGCACGCACCATTACGTCGCTCATTCTTGTGCTCTATGGCATTTGGGTCCTCTACTGCATT
TATCAATTCACCCACGGCGACTCGTGGGCAGCCAAGACGCTTGCCGGCGTGACTCTGGCCATTTTCACTGCTGTG
CTGGGCTTCTTCACCTACAAGATATGGAGCATTGCTCGGCGCCTCAAGCACGACGCGGGCGACGCCAGTGGCCTC
TATTACGACAAGGACACTTGGGTCAAGTACTCGCTCTTTTATGAAGCCTATAAAAAGGACTATTGGTGGCTCTTT
ATCCCAGCCATTGTCTACATGTTTGCCAAGGGCTGTGCCTTGGCCCTTGGCGACGGACACGGCATGATTCAGTCG
ATTGCCCAGCTTGCTATTGAGACTATTATGCTCGTTTTGTTGCTTTGGAGCCGCCCGTATGAGCGCAAGTCGGGC
AATGTCATCAATATTGTTATTGCCGTTGTCCGCGTCTTGTCCATTGTCTGCGTGCTGGTGTTTGTGGAGGAATTT
GGCATTAAGCAGACGACGCAGACTGTCGCGGGCGTGGTTCTCATTGTTATCCAGTCCGCCTTGACGGGCATTTTG
GCCATTCTTATTATTTGGAATGCCGTTAATGCTTGCTGCAAGGTGAATCCTCACCGCCAGCGCAGAAAGGAACTT
GAAAAAGACAAGAGAGAGTCGGATCTCTTGACGCCTTTGGATGCGCGAAACTCGCTTCTTCGCAGCCACAGCCGC
ACAGGCGCCCTGACGCCTGCTTTTTCAGTCACGTCGGACTACAAGGAAAAGTCTGTCCGTCGTGCCAACTCTCCC
GAGCGCTACTTTCCCGAATACTTGGACATGGGCCGCCAGTCGCCGCCGTCTGGTGGCCAAGTATACTTGTCGCAG
TCGCCGCCCATGTCGAGCGAGGCGACGCATAGGCTGGTTGACTCTGCTGCTCCTATTGCTGGAGGCGGCATGTAC
GAGCCCAATATACCAAACGCTGGATACAACTATGGAAGACCGGCTGGCCAAGGCTTTGGCGTTGGCAATGGGCCT
GGCCGGGGTCACCGGCGAACAAACAATCTACTTTGA
Gene >OphauB2|3173
ATGCTGGCTCTGCCAGTCTCGGCGGCCGATATTCTCAAGACGGACGGCTTCAATGATTGCGGCTCCGACTCGAGC
ATCAAGGTGGACAAGGTGGACATTATCTACGACAAGGACCACAAGACTGTCGACTTTGATGTGGCTGGGTCGAGC
ACCAAGGAACAAAATGTCACGGCGGAGCTCAAGGTGACAGCCTACGGCACCGTGGTCTACACCAACAGCTTCAAC
CCTTGCGACCAGGGCAATTTTGTCGAGCGCCTATGCCCCGTGCCCAAGGGCGACTTTGCCGCCAAGGGCAGCCGT
GGAATCCCGTCGCAGTTTGCCGACATGGTGCCAGCTATTGCCTTTCAAGTCCCCGACATTGCGGCTCAGGCGACG
CTGGAGCTCAAGAGCCTCGACAACAATGCCAAGGTTGCCTGCATCCAGTCGCAAGTGTCGAATGGCAAGACGGCC
AATGTGCCCGTTGTCGGCTACGTTGTGGCCAGCTTTGTTGGAGTGGCCGTGATTGGCGCCGGCATCTCGTCAGCT
GCTACCGCCTTTTCGGGGGGAGCAAGCGGCGCCGCTGGCAGCCCCAGCCCCAGCCCTTCGGAGACGTGTACCTGG
ATCCAGGCCGTGGCCATGACGGGCATGTCTACGGTCAATTATCCCCTTGTCTGCCGCAAGTTTTTTGCAAATGTT
GGCTTTGCCGTGGGCATCATCTCGTGGGAGGACTTGCAGAGGTTTATTGACAATGTTCGCGCCAAGACGGGCGGC
GATTTGACCGAGGACAGTGTCGAATATCTCCATAACGCTACCCTGGTTTTCCCCGACAACTCAACCACCAACTCG
CACCAAGGCACTTTGAGGCTCAAACGAGGCCTCGATGCTTTTGCGTCTCTGGTTGCTCGCCAAGCCACTACCGAC
AAGTCGGACCCAACGTCGGTGACGTTTCAACACGCCGTCAAGGGCATTCAGGCTTATGCCGAGCAGCTAGCGGTG
CCAAAGTCCAATGTCTTTATGACGGCGCTGCTGGTTGTGGCGATTGCTATTGCAGCCATTGTTGTTGGCATTCTG
CTTGTCAAGGTGGTGCTTGAGTTTTGGGCCCTTTTTGGCAGCTTTCCCAAGTCTCTGGCCGGCTTCCGCAAGCAC
TATTGGGGCTCGATTGCACGCACCATTACGTCGCTCATTCTTGTGCTCTATGGCATTTGGGTCCTCTACTGCATT
TATCAATTCACCCACGGCGACTCGTGGGCAGCCAAGACGCTTGCCGGCGTGACTCTGGCCATTTTCACTGCTGTG
CTGGGCTTCTTCACCTACAAGATATGGAGCATTGCTCGGCGCCTCAAGCACGACGCGGGCGACGCCAGTGGCCTC
TATTACGACAAGGACACTTGGGTCAAGTACTCGCTCTTTTATGAAGCCTATAAAAAGGACTATTGGTGGCTCTTT
ATCCCAGCCATTGTCTACATGTTTGCCAAGGGCTGTGCCTTGGCCCTTGGCGACGGACACGGCATGATTCAGTCG
ATTGCCCAGCTTGCTATTGAGACTATTATGCTCGTTTTGTTGCTTTGGAGCCGCCCGTATGAGCGCAAGTCGGGC
AATGTCATCAATATTGTTATTGCCGTTGTCCGCGTCTTGTCCATTGTCTGCGTGCTGGTGTTTGTGGAGGAATTT
GGCATTAAGCAGACGACGCAGACTGTCGCGGGCGTGGTTCTCATTGTTATCCAGTCCGCCTTGACGGGCATTTTG
GCCATTCTTATTATTTGGAATGCCGTTAATGCTTGCTGCAAGGTGAATCCTCACCGCCAGCGCAGAAAGGAACTT
GGTAAGTTTTCTTCATGTTGCCCATGTTTTTTTTTTGTCTCTTTTGCTGTTTTGCACCGACTAATATAAAATGTT
GCAAATACAGAAAAAGACAAGAGAGAGTCGGATCTCTTGACGCCTTTGGATGCGCGAAACTCGCTTCTTCGCAGC
CACAGCCGCACAGGCGCCCTGACGCCTGCTTTTTCAGTCACGTCGGACTACAAGGAAAAGTCTGTCCGTCGTGCC
AACTCTCCCGAGCGCTACTTTCCCGAATACTTGGACATGGGCCGCCAGTCGCCGCCGTCTGGTGGCCAAGTATAC
TTGTCGCAGTCGCCGCCCATGTCGAGCGAGGCGACGCATAGGCTGGTTGACTCTGCTGCTCCTATTGCTGGAGGC
GGCATGTACGAGCCCAATATACCAAACGCTGGATACAACTATGGAAGACCGGCTGGCCAAGGCTTTGGCGTTGGC
AATGGGCCTGGCCGGGGTCACCGGCGAACAAACAATCTACTTTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail