Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|3167
Gene name
LocationContig_203:17567..19548
Strand-
Gene length (bp)1981
Transcript length (bp)1641
Coding sequence length (bp)1641
Protein length (aa) 547

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF13347 MFS_2 MFS/sugar transport protein 1.3E-06 26 251

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O14091|SUT1_SCHPO General alpha-glucoside permease OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sut1 PE=3 SV=1 13 543 2.0E-58
sp|Q9FE59|SUC4_ARATH Sucrose transport protein SUC4 OS=Arabidopsis thaliana GN=SUC4 PE=1 SV=2 14 283 3.0E-27
sp|Q9C8X2|SUC5_ARATH Sucrose transport protein SUC5 OS=Arabidopsis thaliana GN=SUC5 PE=1 SV=1 26 321 4.0E-27
sp|A2X6E6|SUT5_ORYSI Sucrose transport protein SUT5 OS=Oryza sativa subsp. indica GN=SUT5 PE=3 SV=1 3 324 2.0E-26
sp|Q9FG00|SUC9_ARATH Sucrose transport protein SUC9 OS=Arabidopsis thaliana GN=SUC9 PE=1 SV=1 14 313 2.0E-26
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O14091|SUT1_SCHPO General alpha-glucoside permease OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sut1 PE=3 SV=1 13 543 2.0E-58
sp|Q9FE59|SUC4_ARATH Sucrose transport protein SUC4 OS=Arabidopsis thaliana GN=SUC4 PE=1 SV=2 14 283 3.0E-27
sp|Q9C8X2|SUC5_ARATH Sucrose transport protein SUC5 OS=Arabidopsis thaliana GN=SUC5 PE=1 SV=1 26 321 4.0E-27
sp|A2X6E6|SUT5_ORYSI Sucrose transport protein SUT5 OS=Oryza sativa subsp. indica GN=SUT5 PE=3 SV=1 3 324 2.0E-26
sp|Q9FG00|SUC9_ARATH Sucrose transport protein SUC9 OS=Arabidopsis thaliana GN=SUC9 PE=1 SV=1 14 313 2.0E-26
sp|Q69JW3|SUT5_ORYSJ Sucrose transport protein SUT5 OS=Oryza sativa subsp. japonica GN=SUT5 PE=1 SV=1 2 324 2.0E-26
sp|Q67YF8|SUC7_ARATH Sucrose transport protein SUC7 OS=Arabidopsis thaliana GN=SUC7 PE=2 SV=2 8 321 3.0E-26
sp|Q944W2|SUT3_ORYSI Sucrose transport protein SUT3 OS=Oryza sativa subsp. indica GN=SUT3 PE=3 SV=1 7 319 2.0E-25
sp|Q39231|SUC2_ARATH Sucrose transport protein SUC2 OS=Arabidopsis thaliana GN=SUC2 PE=1 SV=2 2 283 5.0E-25
sp|Q948L0|SUT3_ORYSJ Sucrose transport protein SUT3 OS=Oryza sativa subsp. japonica GN=SUT3 PE=2 SV=1 7 319 6.0E-25
sp|Q10R54|SUT1_ORYSJ Sucrose transport protein SUT1 OS=Oryza sativa subsp. japonica GN=SUT1 PE=1 SV=1 18 319 3.0E-24
sp|Q9LKH3|SUT1_ORYSI Sucrose transport protein SUT1 OS=Oryza sativa subsp. indica GN=SUT1 PE=3 SV=1 18 319 3.0E-24
sp|Q39232|SUC1_ARATH Sucrose transport protein SUC1 OS=Arabidopsis thaliana GN=SUC1 PE=1 SV=1 26 313 3.0E-24
sp|Q9ZVK6|SUC8_ARATH Sucrose transport protein SUC8 OS=Arabidopsis thaliana GN=SUC8 PE=1 SV=1 9 321 9.0E-24
sp|A2ZN77|SUT2_ORYSI Sucrose transport protein SUT2 OS=Oryza sativa subsp. indica GN=SUT2 PE=2 SV=2 26 313 3.0E-23
sp|Q6A329|SUC6_ARATH Putative sucrose transport protein SUC6 OS=Arabidopsis thaliana GN=SUC6 PE=5 SV=2 9 321 4.0E-23
sp|Q0ILJ3|SUT2_ORYSJ Sucrose transport protein SUT2 OS=Oryza sativa subsp. japonica GN=SUT2 PE=2 SV=2 26 313 4.0E-23
sp|Q03411|SUT_SPIOL Sucrose transport protein OS=Spinacia oleracea PE=2 SV=1 18 313 4.0E-23
sp|Q9UMX9|S45A2_HUMAN Membrane-associated transporter protein OS=Homo sapiens GN=SLC45A2 PE=1 SV=2 16 287 7.0E-23
sp|P58355|S45A2_MOUSE Membrane-associated transporter protein OS=Mus musculus GN=Slc45a2 PE=1 SV=1 16 321 3.0E-21
sp|O80605|SUC3_ARATH Sucrose transport protein SUC3 OS=Arabidopsis thaliana GN=SUC3 PE=1 SV=1 9 181 8.0E-19
sp|Q6YK44|SUT4_ORYSJ Sucrose transport protein SUT4 OS=Oryza sativa subsp. japonica GN=SUT4 PE=2 SV=1 13 181 3.0E-17
sp|B8AF63|SUT4_ORYSI Sucrose transport protein SUT4 OS=Oryza sativa subsp. indica GN=SUT4 PE=3 SV=1 13 181 3.0E-17
sp|Q4LE88|S45A2_PIG Membrane-associated transporter protein OS=Sus scrofa GN=SLC45A2 PE=2 SV=2 16 287 4.0E-16
sp|Q5BKX6|S45A4_HUMAN Solute carrier family 45 member 4 OS=Homo sapiens GN=SLC45A4 PE=1 SV=2 28 221 2.0E-12
sp|Q0P5V9|S45A4_MOUSE Solute carrier family 45 member 4 OS=Mus musculus GN=Slc45a4 PE=1 SV=1 28 221 6.0E-12
sp|Q9Y2W3|S45A1_HUMAN Proton-associated sugar transporter A OS=Homo sapiens GN=SLC45A1 PE=2 SV=4 28 247 2.0E-11
sp|Q8K0H7|S45A3_MOUSE Solute carrier family 45 member 3 OS=Mus musculus GN=Slc45a3 PE=2 SV=1 18 325 7.0E-11
sp|Q8BIV7|S45A1_MOUSE Proton-associated sugar transporter A OS=Mus musculus GN=Slc45a1 PE=1 SV=3 28 224 9.0E-11
sp|Q8K4S3|S45A1_RAT Proton-associated sugar transporter A OS=Rattus norvegicus GN=Slc45a1 PE=2 SV=1 28 224 1.0E-10
sp|Q96JT2|S45A3_HUMAN Solute carrier family 45 member 3 OS=Homo sapiens GN=SLC45A3 PE=2 SV=1 18 316 7.0E-10
sp|Q95KI5|S45A3_MACFA Solute carrier family 45 member 3 OS=Macaca fascicularis GN=SLC45A3 PE=2 SV=1 18 325 4.0E-09
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 35 0.5

Transmembrane Domains

Domain # Start End Length
1 20 39 19
2 54 76 22
3 89 111 22
4 121 143 22
5 171 193 22
6 203 225 22
7 262 284 22
8 304 326 22
9 357 376 19
10 386 408 22
11 478 500 22
12 520 539 19

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|3167
MATLEGQVSIRGSSETMRMMLLTFASTGMTFTWGVEMTYCTPYLLSLGLAKSTTSLIWIVGPLSGLLVQPIVGVV
ADGNASSWGRRRPLMAAGAGGVALGLLTLGFARELVVWMGMDGGSALVIVVAVAALCLVDFAVNVVMSCSRSLVI
DTLPLQKQQTGMAWASRMSAVGHMVGYAVGSLDLVALLGTAMGGAQFQQLTVIASLAIVASTAVTCWAVTEAVLV
RHDKETLQSRLLRVPSQILHAMGHLPPRIQAICWAQFWSWIGWFPFLFYNTTWIGEIYYRYDAPPRQSGGLMDMG
RIGSTVLLVYSIITFVAAFGLPLLVWAPDDDDSLARRPPHTAAAVIMETLRRCRPHLLTTWMCGHAVFAAAMSLA
PFARSYRFASFLVYFCGLSWSIAIWAPPALLGVEINKLGGPVQNGGEYRQVSHLPDVELSWLEQSSPGQALEAAT
GRVLPSLSLAPPLGASPTAQQSGIYSGILNVYTALPQLVSSFIAWLVFAILEPAGSTDPKEHSASDSAPNAISIC
LFIGALSSFGAIFATAKLKRL*
Coding >OphauB2|3167
ATGGCGACGCTCGAGGGCCAGGTGTCCATCAGGGGCAGCAGCGAGACGATGCGCATGATGCTGCTAACGTTTGCC
TCGACGGGCATGACCTTCACTTGGGGCGTCGAAATGACGTACTGCACGCCTTACCTGCTGAGCCTGGGGCTGGCC
AAGAGCACCACGTCGCTGATTTGGATCGTCGGCCCGCTGTCGGGCCTGTTGGTGCAGCCGATTGTGGGCGTCGTG
GCCGATGGCAATGCGTCGAGCTGGGGCCGGCGAAGACCGTTGATGGCGGCTGGCGCGGGCGGCGTGGCACTCGGT
CTCTTGACGCTGGGCTTTGCTCGCGAGCTGGTGGTTTGGATGGGCATGGATGGCGGCAGTGCCCTTGTCATTGTC
GTGGCTGTTGCGGCCCTGTGTCTTGTTGACTTTGCCGTCAATGTCGTCATGTCGTGTTCGCGGAGCCTCGTCATT
GACACGCTTCCGCTCCAGAAGCAGCAAACAGGAATGGCTTGGGCCAGTCGCATGTCGGCCGTGGGCCACATGGTG
GGCTATGCCGTTGGGTCGCTTGATCTCGTTGCCCTCTTGGGCACGGCCATGGGCGGCGCTCAGTTTCAGCAACTG
ACCGTCATTGCCTCGCTGGCCATTGTGGCGTCGACGGCTGTGACATGCTGGGCCGTGACCGAGGCGGTGCTTGTT
CGGCACGACAAGGAGACGCTGCAGAGCCGCCTGCTGAGGGTTCCGTCCCAGATATTGCATGCCATGGGCCATTTG
CCGCCTCGCATCCAGGCCATCTGCTGGGCTCAGTTCTGGTCTTGGATTGGCTGGTTTCCCTTTCTCTTTTACAAC
ACGACGTGGATTGGCGAAATCTACTACCGCTATGACGCTCCGCCCCGCCAGTCTGGCGGCCTCATGGACATGGGG
CGCATTGGCAGCACCGTTTTGCTTGTCTACTCCATCATCACCTTTGTTGCTGCCTTTGGTCTGCCGCTGCTCGTG
TGGGCGCCCGACGACGACGACTCTTTGGCCCGTCGCCCGCCGCATACTGCCGCTGCCGTCATCATGGAGACGCTG
CGCAGATGTCGGCCCCATCTCTTGACCACGTGGATGTGCGGCCACGCCGTCTTTGCCGCGGCCATGTCTCTGGCG
CCTTTTGCCCGAAGCTACCGCTTTGCCTCGTTTCTCGTTTATTTCTGTGGCCTATCATGGTCCATTGCTATTTGG
GCTCCGCCCGCCCTCCTTGGCGTCGAGATCAACAAGCTGGGCGGCCCCGTGCAAAACGGCGGCGAGTATCGACAA
GTCTCTCATCTACCAGATGTTGAACTATCTTGGCTGGAGCAAAGTAGCCCCGGCCAGGCTCTCGAGGCGGCTACT
GGCCGCGTGTTGCCGTCTTTGTCGTTGGCGCCGCCTCTTGGCGCCTCTCCGACGGCGCAGCAGTCTGGAATCTAC
TCGGGCATCCTCAACGTCTACACTGCGCTGCCTCAGCTCGTGAGCAGCTTCATTGCCTGGCTCGTCTTTGCCATT
TTGGAGCCGGCTGGGTCGACGGACCCCAAGGAGCACTCTGCGTCCGACTCTGCGCCCAATGCCATTTCCATATGT
CTCTTTATAGGAGCCTTGAGCTCCTTTGGCGCCATTTTTGCCACGGCAAAGCTTAAACGGCTGTAG
Transcript >OphauB2|3167
ATGGCGACGCTCGAGGGCCAGGTGTCCATCAGGGGCAGCAGCGAGACGATGCGCATGATGCTGCTAACGTTTGCC
TCGACGGGCATGACCTTCACTTGGGGCGTCGAAATGACGTACTGCACGCCTTACCTGCTGAGCCTGGGGCTGGCC
AAGAGCACCACGTCGCTGATTTGGATCGTCGGCCCGCTGTCGGGCCTGTTGGTGCAGCCGATTGTGGGCGTCGTG
GCCGATGGCAATGCGTCGAGCTGGGGCCGGCGAAGACCGTTGATGGCGGCTGGCGCGGGCGGCGTGGCACTCGGT
CTCTTGACGCTGGGCTTTGCTCGCGAGCTGGTGGTTTGGATGGGCATGGATGGCGGCAGTGCCCTTGTCATTGTC
GTGGCTGTTGCGGCCCTGTGTCTTGTTGACTTTGCCGTCAATGTCGTCATGTCGTGTTCGCGGAGCCTCGTCATT
GACACGCTTCCGCTCCAGAAGCAGCAAACAGGAATGGCTTGGGCCAGTCGCATGTCGGCCGTGGGCCACATGGTG
GGCTATGCCGTTGGGTCGCTTGATCTCGTTGCCCTCTTGGGCACGGCCATGGGCGGCGCTCAGTTTCAGCAACTG
ACCGTCATTGCCTCGCTGGCCATTGTGGCGTCGACGGCTGTGACATGCTGGGCCGTGACCGAGGCGGTGCTTGTT
CGGCACGACAAGGAGACGCTGCAGAGCCGCCTGCTGAGGGTTCCGTCCCAGATATTGCATGCCATGGGCCATTTG
CCGCCTCGCATCCAGGCCATCTGCTGGGCTCAGTTCTGGTCTTGGATTGGCTGGTTTCCCTTTCTCTTTTACAAC
ACGACGTGGATTGGCGAAATCTACTACCGCTATGACGCTCCGCCCCGCCAGTCTGGCGGCCTCATGGACATGGGG
CGCATTGGCAGCACCGTTTTGCTTGTCTACTCCATCATCACCTTTGTTGCTGCCTTTGGTCTGCCGCTGCTCGTG
TGGGCGCCCGACGACGACGACTCTTTGGCCCGTCGCCCGCCGCATACTGCCGCTGCCGTCATCATGGAGACGCTG
CGCAGATGTCGGCCCCATCTCTTGACCACGTGGATGTGCGGCCACGCCGTCTTTGCCGCGGCCATGTCTCTGGCG
CCTTTTGCCCGAAGCTACCGCTTTGCCTCGTTTCTCGTTTATTTCTGTGGCCTATCATGGTCCATTGCTATTTGG
GCTCCGCCCGCCCTCCTTGGCGTCGAGATCAACAAGCTGGGCGGCCCCGTGCAAAACGGCGGCGAGTATCGACAA
GTCTCTCATCTACCAGATGTTGAACTATCTTGGCTGGAGCAAAGTAGCCCCGGCCAGGCTCTCGAGGCGGCTACT
GGCCGCGTGTTGCCGTCTTTGTCGTTGGCGCCGCCTCTTGGCGCCTCTCCGACGGCGCAGCAGTCTGGAATCTAC
TCGGGCATCCTCAACGTCTACACTGCGCTGCCTCAGCTCGTGAGCAGCTTCATTGCCTGGCTCGTCTTTGCCATT
TTGGAGCCGGCTGGGTCGACGGACCCCAAGGAGCACTCTGCGTCCGACTCTGCGCCCAATGCCATTTCCATATGT
CTCTTTATAGGAGCCTTGAGCTCCTTTGGCGCCATTTTTGCCACGGCAAAGCTTAAACGGCTGTAG
Gene >OphauB2|3167
ATGGCGACGCTCGAGGGCCAGGTGTCCATCAGGGGCAGCAGCGAGACGATGCGCATGATGCTGCTAACGTTTGCC
TCGACGGGCATGACGTGAGTGCAAACCGCCCAGCGGCTGTCTCTTTTTTTTTTTTCTTTTTTTTTTTTTAAAAAA
AAGTGGTGATGCTGACTTTTGGCAGCTTCACTTGGGGCGTCGAAATGACGTGTACGTACGCCTGCCCAGCAACAG
AACGAGGGCTAACGGCCGGCAGACTGCACGCCTTACCTGCTGAGCCTGGGGCTGGCCAAGAGCACCACGTCGCTG
ATTTGGATCGTCGGCCCGCTGTCGGGCCTGTTGGTGCAGCCGATTGTGGGCGTCGTGGCCGATGGCAATGCGTCG
AGCTGGGGCCGGCGAAGACCGTTGATGGCGGCTGGCGCGGGCGGCGTGGCACTCGGTCTCTTGACGCTGGGCTTT
GCTCGCGAGCTGGTGGTTTGGATGGGCATGGATGGCGGCAGTGCCCTTGTCATTGTCGTGGCTGTTGCGGCCCTG
TGTCTTGTTGACTTTGCCGTCAATGTCGGTAGGCTCAAGGCGTGTGTCTTGGGGCCATGGGTCTGGGTCGCTGAC
GGGCAGACGGGCAGTCATGTCGTGTTCGCGGAGCCTCGTCATTGACACGCTTCCGCTCCAGAAGCAGCAAACAGG
AATGGCTTGGGGTGAGTTGCTTGGCTCTCCCTCCCTTGGCCGCCTCGAGTCTGGCTAATGCGTCTCTCCGTCTGC
TCCTCTAAGCCAGTCGCATGTCGGCCGTGGGCCACATGGTGGGCTATGCCGTTGGGTCGCTTGATCTCGTTGCCC
TCTTGGGCACGGCCATGGGCGGCGCTCAGTTTCAGCAACTGACCGTCATTGCCTCGCTGGCCATTGTGGCGTCGA
CGGCTGTGACATGCTGGGCCGTGACCGAGGCGGTGCTTGTTCGGCACGACAAGGAGACGCTGCAGAGCCGCCTGC
TGAGGGTTCCGTCCCAGATATTGCATGCCATGGGCCATTTGCCGCCTCGCATCCAGGCCATCTGCTGGGCTCAGT
TCTGGTCTTGGATTGGCTGGTTTCCCTTTCTCTTTTACAACACGACGTGGATTGGCGAAATCTACTACCGCTATG
ACGCTCCGCCCCGCCAGTCTGGCGGCCTCATGGACATGGGGCGCATTGGCAGCACCGTTTTGCTTGTCTACTCCA
TCATCACCTTTGTTGCTGCCTTTGGTCTGCCGCTGCTCGTGTGGGCGCCCGACGACGACGACTCTTTGGCCCGTC
GCCCGCCGCATACTGCCGCTGCCGTCATCATGGAGACGCTGCGCAGATGTCGGCCCCATCTCTTGACCACGTGGA
TGTGCGGCCACGCCGTCTTTGCCGCGGCCATGTCTCTGGCGCCTTTTGCCCGAAGCTACCGCTTTGCCTCGTTTC
TCGTTTATTTCTGTGGCCTGTAAGCCCTTGGCCGATGCCCTGTGACTGCTGTGCAATACGTCGTGGCTAATGTCG
TTTGTATGGCGCAACCAGATCATGGTCCATTGCTATTTGGGCTCCGCCCGCCCTCCTTGGCGTCGAGATCAACAA
GCTGGGCGGCCCCGTGCAAAACGGCGGCGAGTATCGACAAGTCTCTCATCTACCAGATGTTGAACTATCTTGGCT
GGAGCAAAGTAGCCCCGGCCAGGCTCTCGAGGCGGCTACTGGCCGCGTGTTGCCGTCTTTGTCGTTGGCGCCGCC
TCTTGGCGCCTCTCCGACGGCGCAGCAGTCTGGAATCTACTCGGGCATCCTCAACGTCTACACTGCGCTGCCTCA
GCTCGTGAGCAGCTTCATTGCCTGGCTCGTCTTTGCCATTTTGGAGCCGGCTGGGTCGACGGACCCCAAGGAGCA
CTCTGCGTCCGACTCTGCGCCCAATGCCATTTCCATATGTCTCTTTATAGGAGCCTTGAGCTCCTTTGGCGCCAT
TTTTGCCACGGCAAAGCTTAAACGGCTGTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail